Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009680
Gene name
Locationscaffold_1:2285238..2286937
Strand+
Gene length (bp)1699
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00481 PP2C Protein phosphatase 2C 2.4E-08 105 250

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14156|PP2C4_SCHPO Protein phosphatase 2C homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc4 PE=1 SV=2 1 356 5.0E-17
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 44 352 8.0E-15
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 44 352 7.0E-13
sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 44 345 2.0E-12
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 107 340 3.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14156|PP2C4_SCHPO Protein phosphatase 2C homolog 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc4 PE=1 SV=2 1 356 5.0E-17
sp|Q8BXN7|PPM1K_MOUSE Protein phosphatase 1K, mitochondrial OS=Mus musculus GN=Ppm1k PE=1 SV=1 44 352 8.0E-15
sp|Q2PC20|PPM1K_BOVIN Protein phosphatase 1K, mitochondrial OS=Bos taurus GN=PPM1K PE=2 SV=1 44 352 7.0E-13
sp|Q8N3J5|PPM1K_HUMAN Protein phosphatase 1K, mitochondrial OS=Homo sapiens GN=PPM1K PE=1 SV=1 44 345 2.0E-12
sp|P40371|PP2C1_SCHPO Protein phosphatase 2C homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptc1 PE=2 SV=1 107 340 3.0E-11
sp|P25646|PDP2_YEAST [Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTC6 PE=1 SV=2 279 369 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004722 protein serine/threonine phosphatase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0003674 molecular_function No
GO:0016791 phosphatase activity No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0004721 phosphoprotein phosphatase activity No
GO:0042578 phosphoric ester hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009680
MALCVLGRACALSRRLTTFSAFNARYHDYVRVASPSSPSDIIRVPLASPKVIGVANSRGNRSHQEDFYGFATLSL
NPEELRLNVKKFHNISWDPSRVGPLLARQAVFVGIYDGHGGSAVSQYLRQELHGIFESVHKSHIPDLFAWIKEIG
GYFKRFRGGPLAPWINGSKGTPELDLEARATQAFFEVDKNLSADDTAEACGATASVAIFHSLDNPSTTFFSADEL
SLTVAHCGDTRVLLTAVDGEHTLTQNDGLLAHYRFIRGIEMDGRAFKYTMLRLLNGNEWSCAIFVSDGISSMLSD
QEVVDLARRASSPGVAAQRILSFSEELGGSDNGTVIVVPLKGWGKTQGPDKTKELREYRLKQNVGSERQRRM*
Coding >AgabiH97|009680
ATGGCTCTCTGTGTGCTTGGCCGTGCTTGTGCTCTTTCACGCCGCCTAACCACCTTTTCCGCATTCAACGCTCGA
TACCATGACTACGTTCGCGTTGCATCCCCAAGCTCACCAAGTGATATCATTCGTGTTCCTCTGGCTTCGCCAAAG
GTAATTGGAGTCGCAAATTCACGGGGCAACCGGAGTCATCAGGAAGACTTTTATGGGTTTGCGACTTTATCCCTA
AACCCAGAGGAGCTGCGCCTAAACGTCAAGAAGTTCCACAACATCAGCTGGGATCCGTCCCGAGTAGGTCCATTA
CTCGCGAGGCAAGCAGTGTTTGTTGGCATCTACGATGGTCACGGCGGGTCTGCAGTATCACAATACCTTAGACAA
GAACTTCATGGCATCTTCGAGTCTGTCCACAAATCCCACATACCCGATCTGTTTGCATGGATCAAAGAAATAGGT
GGTTACTTCAAAAGGTTCAGAGGTGGTCCACTAGCGCCTTGGATAAATGGATCCAAGGGGACGCCAGAATTGGAC
TTAGAAGCTCGTGCTACTCAAGCGTTTTTCGAGGTAGACAAAAACCTCTCCGCTGATGACACTGCCGAAGCTTGC
GGCGCTACGGCTTCTGTCGCCATATTTCATTCATTGGATAATCCCTCAACAACTTTTTTCTCTGCTGACGAACTT
TCCCTAACGGTGGCTCATTGTGGAGATACACGTGTACTCTTGACCGCTGTGGATGGTGAGCACACGCTTACGCAG
AATGATGGGCTCCTCGCTCATTACAGATTCATTCGGGGAATCGAGATGGATGGGCGTGCTTTCAAATACACGATG
CTTAGGCTACTTAACGGGAACGAATGGTCTTGTGCGATATTTGTTTCGGATGGAATTTCATCAATGCTCTCTGAC
CAAGAGGTGGTCGACTTGGCGCGACGCGCATCCAGCCCGGGGGTAGCAGCACAGCGCATCCTATCATTTTCAGAG
GAGTTGGGTGGTAGCGATAATGGAACCGTAATCGTAGTACCATTGAAGGGGTGGGGAAAGACTCAAGGACCAGAC
AAGACGAAGGAGCTGAGAGAATACCGTCTCAAACAAAATGTGGGAAGTGAACGCCAGAGGCGTATGTAA
Transcript >AgabiH97|009680
ATGGCTCTCTGTGTGCTTGGCCGTGCTTGTGCTCTTTCACGCCGCCTAACCACCTTTTCCGCATTCAACGCTCGA
TACCATGACTACGTTCGCGTTGCATCCCCAAGCTCACCAAGTGATATCATTCGTGTTCCTCTGGCTTCGCCAAAG
GTAATTGGAGTCGCAAATTCACGGGGCAACCGGAGTCATCAGGAAGACTTTTATGGGTTTGCGACTTTATCCCTA
AACCCAGAGGAGCTGCGCCTAAACGTCAAGAAGTTCCACAACATCAGCTGGGATCCGTCCCGAGTAGGTCCATTA
CTCGCGAGGCAAGCAGTGTTTGTTGGCATCTACGATGGTCACGGCGGGTCTGCAGTATCACAATACCTTAGACAA
GAACTTCATGGCATCTTCGAGTCTGTCCACAAATCCCACATACCCGATCTGTTTGCATGGATCAAAGAAATAGGT
GGTTACTTCAAAAGGTTCAGAGGTGGTCCACTAGCGCCTTGGATAAATGGATCCAAGGGGACGCCAGAATTGGAC
TTAGAAGCTCGTGCTACTCAAGCGTTTTTCGAGGTAGACAAAAACCTCTCCGCTGATGACACTGCCGAAGCTTGC
GGCGCTACGGCTTCTGTCGCCATATTTCATTCATTGGATAATCCCTCAACAACTTTTTTCTCTGCTGACGAACTT
TCCCTAACGGTGGCTCATTGTGGAGATACACGTGTACTCTTGACCGCTGTGGATGGTGAGCACACGCTTACGCAG
AATGATGGGCTCCTCGCTCATTACAGATTCATTCGGGGAATCGAGATGGATGGGCGTGCTTTCAAATACACGATG
CTTAGGCTACTTAACGGGAACGAATGGTCTTGTGCGATATTTGTTTCGGATGGAATTTCATCAATGCTCTCTGAC
CAAGAGGTGGTCGACTTGGCGCGACGCGCATCCAGCCCGGGGGTAGCAGCACAGCGCATCCTATCATTTTCAGAG
GAGTTGGGTGGTAGCGATAATGGAACCGTAATCGTAGTACCATTGAAGGGGTGGGGAAAGACTCAAGGACCAGAC
AAGACGAAGGAGCTGAGAGAATACCGTCTCAAACAAAATGTGGGAAGTGAACGCCAGAGGCGTATGTAA
Gene >AgabiH97|009680
ATGGCTCTCTGTGTGCTTGGCCGTGCTTGTGCTCTTTCACGCCGCCTAACCACCTTTTCCGCATTCAACGCTCGA
TACCATGACTACGTTCGCGTTGCATCCCCAAGCTCACCAAGTACGAGCACCACCCAGGCCATGTCTCGTTGATTT
GATTTTTGTACGCAGGTGATATCATTCGTGTTCCTCTGGCTTCGCCAAAGGTAATTGGAGTCGCAAATTCACGGG
GCAACCGGAGGTGTTCATCATACGTCCTTATGTTGCGTTCTATTCTTAACATTCACAGTCATCAGGAAGACTTTT
ATGGGTTTGCGACTTTATCCCTAAACCCAGAGGAGCTGCGCCTAAACGTCAAGAAGTTCCACAACATCAGCTGGG
ATCCGTCCCGAGTAGGTCCATTACTCGCGAGGCAAGCAGTGTTTGTTGGCATCTACGATGGGTGTGTTCACAATC
TTCTCCGTCTCCGTCTCCAGCCGTTGTTAATGTCCTTCTTAAAGTCACGGCGGGTCTGCAGTATCACAATACCTT
AGACAAGAACTTCATGGCATCTTCGAGTCTGTCCACAAATCCCACATACCCGATCTGTTTGCATGGATCAAAGAA
ATAGGTGGTTACTTCAAAAGGTTCAGAGGTGGTCCACTAGCGCCTTGGATAAATGGATCCAAGGGGACGCCAGAA
TTGGACTTAGAAGCTCGTGCTACTCAAGCGTTTTTCGAGGTGTGTGTATATGCTCTTGGTTATTACTTCTGATAC
ATATTACAGTGGAGCCTAGGTAGACAAAAACCTCTCCGCTGATGACACTGCCGAAGCTTGCGGCGCTACGGCTTC
TGTCGCCATATTTCATTCATTGGATAATCCCTCAACAACTTTTTTCTCTGCTGACGAACTTTCCCTAACGGTGGC
TCATTGTGGGTAGGTCAACTAGTACCACTGGTTTGCCGACATCATTCTCATGGAATGCACAGAGATACACGTGTA
CTCTTGACCGCTGTGGATGGTGGTACCGTGTTTCCAATGACAGAAAACCATCATGCTGATGCGCACATTGAGAGC
ACACGCTTACGCAGAATGATGGGCTCCTCGCTCATTACAGATTCATTCGGGGAATCGAGGTATTTCTTGACGATA
CTCACCTCGTACATAGCCTCACATAGGCCTTGACCTGTATAGATGGATGGGCGTGCTTTCAAATACACGATGGTA
TCAAATTGCATCAACTTTATCCGCCGTCACTCACAAAATCATCTCAGCTTAGGTGACCTCAGATTCAAGAAATTT
GGCGTAACACCAGAACCTGAGGTCAGGTCCAGGCTACTTAACGGTATACTTCTTATCTATAAAATTATGACGAAC
CACTAACATTCAGGAGGGAACGAATGGTCTTGTGCGATATTTGTTTCGGATGGAATTTCATCAATGCTCTCTGAC
CAAGAGGTGGTCGACTTGGCGCGACGCGCATCCAGCCCGGGGGTAGCAGCACAGCGCATCCTATCATTTTCAGAG
GAGTTGGGTGGTAGCGATAATGGAACCGTAATCGTAGTACCATTGAAGGGGTGGGGAAAGACTCAAGGACCAGAC
AAGACGAAGGAGCTGAGAGAATACCGTCTCAAACAAAATGGTACGCTTTTCATTTCAGATCCCTGCATAGTAATA
CCCCTAACGGTTGCTGCCAGTGGGAAGTGAACGCCAGAGGCGTATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail