Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009610
Gene name
Locationscaffold_1:2270629..2273921
Strand-
Gene length (bp)3292
Transcript length (bp)2901
Coding sequence length (bp)2901
Protein length (aa) 967

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13886 DUF4203 Domain of unknown function (DUF4203) 1.6E-54 114 325

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

Domain # Start End Length
1 112 131 19
2 138 160 22
3 170 192 22
4 199 221 22
5 225 244 19
6 251 273 22
7 306 328 22
8 915 937 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009610
MRILLPLLALCGLAAAQSSTTGAQQSSQQPSQQSTSFPVSVALTTASTTITTTTRSNGVNTQIVTVLPTIFNVTR
TLTPTSTSATVSAAADSTSSSPSPAPIVLDTRIDPAFGVLGAILILTGLPSTFWGHKNRWTSFFLIGFYTLSLVC
AVLIIRYGVVPAINPPSNTLRGMFVLASVIAGVAGGGIAIFFWKAARYGIGAWGGLALGFWIECFHNGGLIKPVG
YRWILYIALAVVGFTLSTIPKIHYHVLLISTAIVGSSAFILGVDCYTTAGLKEFYMWNLGFQSLFPKFTENQIQF
PVSQTMQIELGLIGAIALMGTAVQLRILRVLKKKLMEIAEESRKRDEEAELHAASQFTTITQEKEAWMKEHPTLG
KQPRQDSMFSSLPLLKDQDGSSSPTTLTDEGRQRHVSGLSDFKVAPVPEDDFRRSRMSQTPGVLPTLDLGLGIQD
DVPSSFIAEAKEKPKLKDMSLQELQAIKKKEELLVEIQNIRKSIEVLKSEPGPSSASQSRRPSMTSRRTLSIDAS
TALLPAAHPHTRPPREADPRARAHSMEFSSLVHAHSPPVGALSESPSRPTSVPVKDPDWDAYIHERKLLQPPSGV
TPPISTSLGHRGSMSAAVQEALESRKRRESLLVTSSGSGTPIGSSGGEEMDDVPLSKIVSDKRHSGLGGVTGFGN
LGYAPAPKDKDPAVTILPPRKSPAGNVQAPAPQRVSSKAPAVKTFEELNDRHREKMRNLQEPLTKAEKESADVRN
AKERWEKAKRVEKESMLRKQAEKVAALEKKEQGHHRGRSGGQSGRARDTDGAGDAVGQNRHSRSLSADRLGFAGA
GNSSKRLSVLKVEDWQKYQATNSSGARDSSTGEFGVKKRDSSVPFPPHSRSRGPAGVFLLEEWDLDILPKYFWPF
HAGGRTQTLSSAALCFAYYFFYPLYFSSSLCFLYPYVPPYPCTTTLIAFRTPSHHASTPPSFYFGI*
Coding >AgabiH97|009610
ATGAGGATCTTGCTCCCCCTCCTCGCCCTCTGTGGTCTCGCTGCCGCCCAGTCCTCAACGACTGGCGCCCAGCAA
TCCTCCCAACAGCCCTCCCAGCAGTCCACCTCCTTCCCCGTCTCCGTCGCACTCACTACTGCCTCAACCACCATC
ACCACTACCACTCGTTCAAATGGTGTCAACACTCAGATCGTGACTGTCCTACCAACCATCTTCAACGTGACCCGC
ACCCTCACGCCCACCTCGACGTCCGCCACAGTTTCGGCAGCTGCCGATTCAACCTCCAGCTCTCCGTCGCCTGCC
CCAATCGTCCTCGATACCCGCATTGACCCGGCTTTTGGCGTGCTCGGAGCTATTCTCATCCTTACCGGTCTCCCT
TCAACTTTCTGGGGTCACAAAAATCGTTGGACATCGTTTTTTCTCATTGGCTTCTACACACTTTCCCTTGTCTGT
GCCGTCCTCATTATCCGCTATGGTGTTGTACCAGCTATCAATCCCCCATCAAACACCCTTCGCGGCATGTTTGTC
CTTGCAAGCGTCATAGCCGGAGTTGCCGGGGGCGGCATTGCCATTTTTTTCTGGAAAGCTGCTAGGTATGGTATC
GGTGCCTGGGGAGGTCTTGCCCTCGGCTTCTGGATCGAATGTTTCCACAACGGTGGTCTCATTAAACCTGTTGGT
TACCGATGGATTTTGTACATCGCCTTAGCGGTCGTAGGCTTTACGTTGAGCACCATCCCAAAGATCCATTATCAT
GTCCTTCTCATTTCCACGGCAATCGTTGGCTCCTCTGCTTTTATACTGGGGGTGGACTGCTACACCACCGCTGGC
CTTAAGGAGTTCTATATGTGGAACTTGGGATTTCAATCTCTCTTTCCAAAATTCACCGAGAACCAGATACAGTTT
CCGGTATCCCAGACCATGCAGATTGAACTTGGCCTCATTGGTGCTATTGCCCTCATGGGAACCGCTGTCCAACTT
CGTATTCTAAGGGTTCTGAAGAAAAAACTTATGGAAATTGCTGAGGAAAGCCGGAAACGGGATGAAGAGGCCGAG
CTACACGCCGCCAGTCAGTTCACAACTATCACGCAAGAGAAGGAGGCCTGGATGAAGGAGCACCCCACGTTAGGC
AAACAACCTAGACAAGACAGCATGTTTTCTTCCCTGCCTTTGTTGAAAGATCAAGATGGCTCTTCCTCTCCCACA
ACTCTCACCGATGAAGGTCGGCAACGCCACGTGTCAGGGCTATCTGATTTCAAAGTTGCACCGGTCCCAGAAGAT
GATTTCCGTCGCTCACGCATGTCTCAAACGCCGGGGGTATTGCCTACTCTGGACCTTGGGCTTGGTATTCAGGAT
GATGTTCCCTCCAGTTTTATCGCCGAGGCGAAAGAGAAACCGAAGTTGAAGGATATGAGCCTGCAGGAACTTCAA
GCCATAAAGAAAAAAGAAGAGTTACTCGTTGAAATTCAAAATATTCGCAAGTCAATTGAAGTCTTAAAATCGGAA
CCAGGACCATCCTCAGCAAGTCAATCAAGAAGGCCTTCAATGACCTCAAGACGCACTTTGAGTATTGATGCATCC
ACAGCTCTTTTGCCAGCTGCTCATCCACACACCCGTCCACCTAGGGAGGCGGACCCTCGTGCTCGCGCACACTCG
ATGGAATTTTCGTCGCTTGTTCATGCACATAGTCCACCGGTAGGAGCCCTGAGTGAATCTCCATCAAGACCGACC
AGTGTACCCGTGAAGGACCCCGACTGGGATGCATATATTCACGAACGCAAGTTGTTACAACCTCCGTCTGGTGTC
ACTCCTCCTATTTCGACATCACTAGGTCATCGCGGTTCCATGTCCGCGGCTGTGCAAGAAGCTTTGGAGAGCAGG
AAAAGGAGGGAGAGCTTGTTGGTCACCAGCAGCGGGAGTGGAACGCCAATCGGGAGTTCAGGTGGAGAGGAAATG
GACGATGTACCTCTGTCGAAAATCGTCTCCGATAAGAGACATTCTGGATTGGGAGGCGTCACTGGCTTTGGCAAC
TTGGGATATGCCCCGGCGCCGAAGGATAAGGATCCCGCCGTCACGATCTTGCCTCCCCGAAAATCACCTGCTGGA
AACGTACAGGCGCCTGCGCCCCAGCGTGTATCATCTAAAGCTCCTGCTGTAAAGACGTTCGAGGAGCTGAACGAC
AGACATCGGGAGAAGATGAGAAATCTACAAGAGCCTCTGACAAAAGCAGAGAAGGAGAGCGCGGATGTGAGGAAC
GCAAAAGAAAGATGGGAGAAGGCGAAGAGGGTTGAGAAGGAATCGATGCTACGAAAGCAGGCAGAGAAAGTTGCT
GCGCTAGAGAAGAAGGAGCAAGGGCACCATCGCGGTCGCAGTGGCGGTCAGTCGGGGAGGGCAAGGGATACTGAT
GGTGCTGGCGATGCTGTTGGTCAGAACAGACATTCGAGATCCTTGAGCGCAGATAGGCTTGGTTTCGCTGGTGCA
GGCAACTCGTCCAAAAGGTTGTCGGTACTGAAGGTCGAGGACTGGCAGAAATATCAGGCCACTAACAGTAGTGGT
GCCAGGGATTCTAGTACAGGCGAATTTGGAGTCAAGAAGAGGGATTCGTCTGTACCGTTCCCTCCCCACTCGCGG
TCTAGGGGGCCAGCTGGCGTATTTCTGCTTGAAGAGTGGGATTTGGATATCCTCCCTAAATATTTCTGGCCATTC
CATGCAGGTGGGAGAACGCAGACTCTTTCCTCTGCAGCCCTTTGCTTTGCGTACTATTTTTTTTACCCCCTCTAT
TTTTCCTCATCGCTATGCTTCCTCTATCCATATGTGCCCCCATACCCATGTACGACTACTCTTATTGCCTTTCGC
ACTCCAAGCCATCACGCTTCTACACCACCTTCGTTCTATTTTGGCATTTGA
Transcript >AgabiH97|009610
ATGAGGATCTTGCTCCCCCTCCTCGCCCTCTGTGGTCTCGCTGCCGCCCAGTCCTCAACGACTGGCGCCCAGCAA
TCCTCCCAACAGCCCTCCCAGCAGTCCACCTCCTTCCCCGTCTCCGTCGCACTCACTACTGCCTCAACCACCATC
ACCACTACCACTCGTTCAAATGGTGTCAACACTCAGATCGTGACTGTCCTACCAACCATCTTCAACGTGACCCGC
ACCCTCACGCCCACCTCGACGTCCGCCACAGTTTCGGCAGCTGCCGATTCAACCTCCAGCTCTCCGTCGCCTGCC
CCAATCGTCCTCGATACCCGCATTGACCCGGCTTTTGGCGTGCTCGGAGCTATTCTCATCCTTACCGGTCTCCCT
TCAACTTTCTGGGGTCACAAAAATCGTTGGACATCGTTTTTTCTCATTGGCTTCTACACACTTTCCCTTGTCTGT
GCCGTCCTCATTATCCGCTATGGTGTTGTACCAGCTATCAATCCCCCATCAAACACCCTTCGCGGCATGTTTGTC
CTTGCAAGCGTCATAGCCGGAGTTGCCGGGGGCGGCATTGCCATTTTTTTCTGGAAAGCTGCTAGGTATGGTATC
GGTGCCTGGGGAGGTCTTGCCCTCGGCTTCTGGATCGAATGTTTCCACAACGGTGGTCTCATTAAACCTGTTGGT
TACCGATGGATTTTGTACATCGCCTTAGCGGTCGTAGGCTTTACGTTGAGCACCATCCCAAAGATCCATTATCAT
GTCCTTCTCATTTCCACGGCAATCGTTGGCTCCTCTGCTTTTATACTGGGGGTGGACTGCTACACCACCGCTGGC
CTTAAGGAGTTCTATATGTGGAACTTGGGATTTCAATCTCTCTTTCCAAAATTCACCGAGAACCAGATACAGTTT
CCGGTATCCCAGACCATGCAGATTGAACTTGGCCTCATTGGTGCTATTGCCCTCATGGGAACCGCTGTCCAACTT
CGTATTCTAAGGGTTCTGAAGAAAAAACTTATGGAAATTGCTGAGGAAAGCCGGAAACGGGATGAAGAGGCCGAG
CTACACGCCGCCAGTCAGTTCACAACTATCACGCAAGAGAAGGAGGCCTGGATGAAGGAGCACCCCACGTTAGGC
AAACAACCTAGACAAGACAGCATGTTTTCTTCCCTGCCTTTGTTGAAAGATCAAGATGGCTCTTCCTCTCCCACA
ACTCTCACCGATGAAGGTCGGCAACGCCACGTGTCAGGGCTATCTGATTTCAAAGTTGCACCGGTCCCAGAAGAT
GATTTCCGTCGCTCACGCATGTCTCAAACGCCGGGGGTATTGCCTACTCTGGACCTTGGGCTTGGTATTCAGGAT
GATGTTCCCTCCAGTTTTATCGCCGAGGCGAAAGAGAAACCGAAGTTGAAGGATATGAGCCTGCAGGAACTTCAA
GCCATAAAGAAAAAAGAAGAGTTACTCGTTGAAATTCAAAATATTCGCAAGTCAATTGAAGTCTTAAAATCGGAA
CCAGGACCATCCTCAGCAAGTCAATCAAGAAGGCCTTCAATGACCTCAAGACGCACTTTGAGTATTGATGCATCC
ACAGCTCTTTTGCCAGCTGCTCATCCACACACCCGTCCACCTAGGGAGGCGGACCCTCGTGCTCGCGCACACTCG
ATGGAATTTTCGTCGCTTGTTCATGCACATAGTCCACCGGTAGGAGCCCTGAGTGAATCTCCATCAAGACCGACC
AGTGTACCCGTGAAGGACCCCGACTGGGATGCATATATTCACGAACGCAAGTTGTTACAACCTCCGTCTGGTGTC
ACTCCTCCTATTTCGACATCACTAGGTCATCGCGGTTCCATGTCCGCGGCTGTGCAAGAAGCTTTGGAGAGCAGG
AAAAGGAGGGAGAGCTTGTTGGTCACCAGCAGCGGGAGTGGAACGCCAATCGGGAGTTCAGGTGGAGAGGAAATG
GACGATGTACCTCTGTCGAAAATCGTCTCCGATAAGAGACATTCTGGATTGGGAGGCGTCACTGGCTTTGGCAAC
TTGGGATATGCCCCGGCGCCGAAGGATAAGGATCCCGCCGTCACGATCTTGCCTCCCCGAAAATCACCTGCTGGA
AACGTACAGGCGCCTGCGCCCCAGCGTGTATCATCTAAAGCTCCTGCTGTAAAGACGTTCGAGGAGCTGAACGAC
AGACATCGGGAGAAGATGAGAAATCTACAAGAGCCTCTGACAAAAGCAGAGAAGGAGAGCGCGGATGTGAGGAAC
GCAAAAGAAAGATGGGAGAAGGCGAAGAGGGTTGAGAAGGAATCGATGCTACGAAAGCAGGCAGAGAAAGTTGCT
GCGCTAGAGAAGAAGGAGCAAGGGCACCATCGCGGTCGCAGTGGCGGTCAGTCGGGGAGGGCAAGGGATACTGAT
GGTGCTGGCGATGCTGTTGGTCAGAACAGACATTCGAGATCCTTGAGCGCAGATAGGCTTGGTTTCGCTGGTGCA
GGCAACTCGTCCAAAAGGTTGTCGGTACTGAAGGTCGAGGACTGGCAGAAATATCAGGCCACTAACAGTAGTGGT
GCCAGGGATTCTAGTACAGGCGAATTTGGAGTCAAGAAGAGGGATTCGTCTGTACCGTTCCCTCCCCACTCGCGG
TCTAGGGGGCCAGCTGGCGTATTTCTGCTTGAAGAGTGGGATTTGGATATCCTCCCTAAATATTTCTGGCCATTC
CATGCAGGTGGGAGAACGCAGACTCTTTCCTCTGCAGCCCTTTGCTTTGCGTACTATTTTTTTTACCCCCTCTAT
TTTTCCTCATCGCTATGCTTCCTCTATCCATATGTGCCCCCATACCCATGTACGACTACTCTTATTGCCTTTCGC
ACTCCAAGCCATCACGCTTCTACACCACCTTCGTTCTATTTTGGCATTTGA
Gene >AgabiH97|009610
ATGAGGATCTTGCTCCCCCTCCTCGCCCTCTGTGGTCTCGCTGCCGCCCAGTCCTCAACGACTGGCGCCCAGCAA
TCCTCCCAACAGCCCTCCCAGCAGTCCACCTCCTTCCCCGTCTCCGTCGCACTCACTACTGCCTCAACCACCATC
ACCACTACCACTCGTTCAAATGGTGTCAACACTCAGATCGTGACTGTCCTACCAACCATCTTCAACGTGACCCGC
ACCCTCACGCCCACCTCGACGTCCGCCACAGTTTCGGCAGCTGCCGATTCAACCTCCAGCTCTCCGTCGCCTGCC
CCAATCGTCCTCGTGCGTACCGCTTGATCCATACGTATTGTCCCCATTCATTTTTTTTTTCAGGATACCCGCATT
GACCCGGCTTTTGGCGTGCTCGGAGCTATTCTCATCCTTACCGGTCTCCCTTCAACTTTCTGGGGTCACAAAAAT
CGTTGGTAGGCAACTCGATCAATTATGAATGAACTTCATTTGACAAGCGACTCGACAGGACATCGTTTTTTCTCA
TTGGCTTCTACACACTTTCCCTTGTCTGTGCCGTCCTCATTATCCGCTATGGTGTTGTACCAGCTATCAATCCCC
CATCAAACACCCTTCGCGGCATGTTTGTCCTTGCAAGCGTCATAGCCGGAGTTGCCGGGGGCGGCATTGCCATTT
TTTTCTGGAAAGCTGCTAGGTATGGTATCGGTGCCTGGGGAGGTCTTGCCCTCGGCTTCTGGATCGAATGTTTCC
ACAACGGTGGTCTCATTAAACCTGTTGGTTACCGATGGATTTTGTACATCGGCAAGTCTTTTCATTTCTGACCAC
TCATCCAGCCCTAATTCATTCATCAACCAGCCTTAGCGGTCGTAGGCTTTACGTTGAGCACCATCCCAAAGGTGA
GCTTATCATTCTCCTCACTTCAAGCCGCCTCCCCATGACCGGACAATGAATTAGATCCATTATCATGTCCTTCTC
ATTTCCACGGCAATCGTTGGCTCCTCTGCTTTTATACTGGGGGTGGACTGCTACACCACCGCTGGCCTTAAGGAG
GTGAGATTACTCTTTGAACCTGTTGCAATTCGGGATGTCATGATTTGTATAGTTCTATATGTGGAACTTGGGATT
TCAATCTCTCTTTCCAAAATTCACCGAGAACCAGATACAGTTTCCGGTATCCCAGACCATGCAGATTGAACTTGG
CCTCATTGGTGCTATTGCCCTCATGGGAACCGCTGTCCAACTTCGTATTCTAAGGGTTCTGAAGAAAAAACTTAT
GGAAATTGCTGAGGAAAGCCGGAAACGGGATGAAGAGGCCGAGCTACACGCCGCCAGTCAGTTCACAACTATCAC
GCAAGAGAAGGAGGCCTGGATGAAGGAGCACCCCACGTTAGGCAAACAACCTAGACAAGACAGCATGTTTTCTTC
CCTGCCTTTGTTGAAAGATCAAGATGGCTCTTCCTCTCCCACAACTCTCACCGATGAAGGTCGGCAACGCCACGT
GTCAGGGCTATCTGATTTCAAAGTTGCACCGGTCCCAGAAGATGATTTCCGTCGCTCACGCATGTCTCAAACGCC
GGGGGTATTGCCTACTCTGGACCTTGGGCTTGGTATTCAGGATGATGTTCCCTCCAGTTTTATCGCCGAGGCGAA
AGAGAAACCGAAGTTGAAGGATATGAGCCTGCAGGAACTTCAAGCCATAAAGAAAAAAGAAGAGTTACTCGTTGA
AATTCAAAATATTCGCAAGTCAATTGAAGTCTTAAAATCGGAACCAGGACCATCCTCAGCAAGTCAATCAAGAAG
GCCTTCAATGACCTCAAGACGCACTTTGAGTATTGATGCATCCACAGCTCTTTTGCCAGCTGCTCATCCACACAC
CCGTCCACCTAGGGAGGCGGACCCTCGTGCTCGCGCACACTCGATGGAATTTTCGTCGCTTGTTCATGCACATAG
TCCACCGGTAGGAGCCCTGAGTGAATCTCCATCAAGACCGACCAGTGTACCCGTGAAGGACCCCGACTGGGATGC
ATATATTCACGAACGCAAGTTGTTACAACCTCCGTCTGGTGTCACTCCTCCTATTTCGACATCACTAGGTCATCG
CGGTTCCATGTCCGCGGCTGTGCAAGAAGCTTTGGAGAGCAGGAAAAGGAGGGAGAGCTTGTTGGTCACCAGCAG
CGGGAGTGGAACGCCAATCGGGAGTTCAGGTGGAGAGGAAATGGACGATGTACCTCTGTCGAAAATCGTCTCCGA
TAAGAGACATTCTGGATTGGGAGGCGTCACTGGCTTTGGCAACTTGGGATATGCCCCGGCGCCGAAGGATAAGGA
TCCCGCCGTCACGATCTTGCCTCCCCGAAAATCACCTGCTGGAAACGTACAGGCGCCTGCGCCCCAGCGTGTATC
ATCTAAAGCTCCTGCTGTAAAGACGTTCGAGGAGCTGAACGACAGACATCGGGAGAAGATGAGAAATCTACAAGA
GCCTCTGACAAAAGCAGAGAAGGAGAGCGCGGATGTGAGGAACGCAAAAGAAAGATGGGAGAAGGCGAAGAGGGT
TGAGAAGGAATCGATGCTACGAAAGCAGGCAGAGAAAGTTGCTGCGCTAGAGAAGAAGGAGCAAGGGCACCATCG
CGGTCGCAGTGGCGGTCAGTCGGGGAGGGCAAGGGATACTGATGGTGCTGGCGATGCTGTTGGTCAGAACAGACA
TTCGAGATCCTTGAGCGCAGATAGGCTTGGTTTCGCTGGTGCAGGCAACTCGTCCAAAAGGTTGTCGGTACTGAA
GGTCGAGGACTGGCAGAAATATCAGGCCACTAACAGTAGTGGTGCCAGGGATTCTAGTACAGGCGAATTTGGAGT
CAAGAAGAGGGATTCGTCTGTACCGTTCCCTCCCCACTCGCGGTCTAGGGGGCCAGCTGGTAGGCGGAGTCAGGA
AGTGCCGAAGAGGGAAGGAGATTGGAGAAAAAGCAAAGATTATTTGACCTAAGGCGTATTTCTGCTTGAAGAGTG
GGATTTGGGTATGTTGACCAGCTAGCTATTCTTGACGCCGATTTTATCGACTTTCCTATCAGATATCCTCCCTAA
ATATTTCTGGCCATTCCATGCAGGTGGGAGAACGCAGACTCTTTCCTCTGCAGCCCTTTGCTTTGCGTACTATTT
TTTTTACCCCCTCTATTTTTCCTCATCGCTATGCTTCCTCTATCCATATGTGCCCCCATACCCATGTACGACTAC
TCTTATTGCCTTTCGCACTCCAAGCCATCACGCTTCTACACCACCTTCGTTCTATTTTGGCATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail