Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009400
Gene name
Locationscaffold_1:2216882..2217969
Strand-
Gene length (bp)1087
Transcript length (bp)777
Coding sequence length (bp)777
Protein length (aa) 259

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 4.5E-17 9 248

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 149 171 22
3 178 200 22
4 225 247 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 148.40 88.80 208.00
Initials Initials knots 131.78 78.86 184.70
Pileal_Stipeal_center Stage I stipe center 149.27 89.14 209.40
Pileal_Stipeal_shell Stage I stipe shell 137.76 82.51 193.00
DIF_stipe_center Stage II stipe center 150.31 90.32 210.31
DIF_stipe_shell Stage II stipe shell 150.99 90.54 211.44
DIF_stipe_skin Stage II stipe skin 155.10 93.23 216.98
DIF_cap_skin Stage II cap skin 148.28 88.93 207.62
DIF_cap_tissue Stage II cap tissue 144.35 86.46 202.24
DIF_gill_tissue Stage II gill tissue 145.95 87.48 204.41
YFB_stipe_center Young fruiting body stipe center 175.21 105.37 245.06
YFB_stipe_shell Young fruiting body stipe shell 160.64 96.50 224.79
YFB_stipe_skin Young fruiting body stipe skin 153.27 92.13 214.41
YFB_cap_skin Young fruiting body cap skin 157.99 95.02 220.97
YFB_cap_tissue Young fruiting body cap tissue 138.70 82.73 194.67
YFB_gill_tissue Young fruiting body gill tissue 153.42 91.75 215.08
YFB_veil Young fruiting body veil 148.62 89.15 208.08

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.977378 no
Casing YFB_stipe_center 0.671584 no
Casing YFB_stipe_shell 0.869520 no
Casing YFB_stipe_skin 0.953623 no
Casing YFB_cap_skin 0.904124 no
Casing YFB_cap_tissue 0.895410 no
Casing YFB_gill_tissue 0.951435 no
Casing YFB_veil 0.996937 no
Casing Initials 0.785574 no
Casing Pileal_Stipeal_center 0.990970 no
Casing Pileal_Stipeal_shell 0.877517 no
Casing DIF_stipe_center 0.981687 no
Casing DIF_stipe_shell 0.975790 no
Casing DIF_stipe_skin 0.933418 no
Casing DIF_cap_skin 0.998290 no
Casing DIF_cap_tissue 0.959814 no
DIF_gill_tissue YFB_stipe_center 0.629369 no
DIF_gill_tissue YFB_stipe_shell 0.837780 no
DIF_gill_tissue YFB_stipe_skin 0.925263 no
DIF_gill_tissue YFB_cap_skin 0.871309 no
DIF_gill_tissue YFB_cap_tissue 0.923335 no
DIF_gill_tissue YFB_gill_tissue 0.923568 no
DIF_gill_tissue YFB_veil 0.972240 no
YFB_stipe_center YFB_stipe_shell 0.854387 no
YFB_stipe_center YFB_stipe_skin 0.748765 no
YFB_stipe_center YFB_cap_skin 0.820234 no
YFB_stipe_center YFB_cap_tissue 0.506520 no
YFB_stipe_center YFB_gill_tissue 0.751797 no
YFB_stipe_center YFB_veil 0.673301 no
YFB_stipe_shell YFB_stipe_skin 0.928823 no
YFB_stipe_shell YFB_cap_skin 0.975107 no
YFB_stipe_shell YFB_cap_tissue 0.721963 no
YFB_stipe_shell YFB_gill_tissue 0.929789 no
YFB_stipe_shell YFB_veil 0.870475 no
YFB_stipe_skin YFB_cap_skin 0.954946 no
YFB_stipe_skin YFB_cap_tissue 0.829235 no
YFB_stipe_skin YFB_gill_tissue 0.998365 no
YFB_stipe_skin YFB_veil 0.953095 no
YFB_cap_skin YFB_cap_tissue 0.761397 no
YFB_cap_skin YFB_gill_tissue 0.957035 no
YFB_cap_skin YFB_veil 0.902043 no
YFB_cap_tissue YFB_gill_tissue 0.827638 no
YFB_cap_tissue YFB_veil 0.888706 no
YFB_gill_tissue YFB_veil 0.952320 no
Initials DIF_gill_tissue 0.818546 no
Initials YFB_stipe_center 0.366140 no
Initials YFB_stipe_shell 0.584608 no
Initials YFB_stipe_skin 0.700763 no
Initials YFB_cap_skin 0.625404 no
Initials YFB_cap_tissue 0.921044 no
Initials YFB_gill_tissue 0.699718 no
Initials YFB_veil 0.775991 no
Initials Pileal_Stipeal_center 0.764002 no
Initials Pileal_Stipeal_shell 0.931121 no
Initials DIF_stipe_center 0.751271 no
Initials DIF_stipe_shell 0.740638 no
Initials DIF_stipe_skin 0.668252 no
Initials DIF_cap_skin 0.778374 no
Initials DIF_cap_tissue 0.841831 no
Pileal_Stipeal_center DIF_gill_tissue 0.966897 no
Pileal_Stipeal_center YFB_stipe_center 0.683033 no
Pileal_Stipeal_center YFB_stipe_shell 0.878407 no
Pileal_Stipeal_center YFB_stipe_skin 0.961158 no
Pileal_Stipeal_center YFB_cap_skin 0.911483 no
Pileal_Stipeal_center YFB_cap_tissue 0.880678 no
Pileal_Stipeal_center YFB_gill_tissue 0.959699 no
Pileal_Stipeal_center YFB_veil 0.992898 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.863356 no
Pileal_Stipeal_center DIF_stipe_center 0.989491 no
Pileal_Stipeal_center DIF_stipe_shell 0.983154 no
Pileal_Stipeal_center DIF_stipe_skin 0.941443 no
Pileal_Stipeal_center DIF_cap_skin 0.989868 no
Pileal_Stipeal_center DIF_cap_tissue 0.949013 no
Pileal_Stipeal_shell DIF_gill_tissue 0.909046 no
Pileal_Stipeal_shell YFB_stipe_center 0.474750 no
Pileal_Stipeal_shell YFB_stipe_shell 0.701043 no
Pileal_Stipeal_shell YFB_stipe_skin 0.807607 no
Pileal_Stipeal_shell YFB_cap_skin 0.740105 no
Pileal_Stipeal_shell YFB_cap_tissue 0.989110 no
Pileal_Stipeal_shell YFB_gill_tissue 0.807003 no
Pileal_Stipeal_shell YFB_veil 0.873947 no
Pileal_Stipeal_shell DIF_stipe_center 0.853004 no
Pileal_Stipeal_shell DIF_stipe_shell 0.844673 no
Pileal_Stipeal_shell DIF_stipe_skin 0.779500 no
Pileal_Stipeal_shell DIF_cap_skin 0.876171 no
Pileal_Stipeal_shell DIF_cap_tissue 0.927040 no
DIF_stipe_center DIF_gill_tissue 0.957408 no
DIF_stipe_center YFB_stipe_center 0.703924 no
DIF_stipe_center YFB_stipe_shell 0.893133 no
DIF_stipe_center YFB_stipe_skin 0.972224 no
DIF_stipe_center YFB_cap_skin 0.925143 no
DIF_stipe_center YFB_cap_tissue 0.869363 no
DIF_stipe_center YFB_gill_tissue 0.970845 no
DIF_stipe_center YFB_veil 0.982660 no
DIF_stipe_center DIF_stipe_shell 0.993329 no
DIF_stipe_center DIF_stipe_skin 0.954523 no
DIF_stipe_center DIF_cap_skin 0.979062 no
DIF_stipe_center DIF_cap_tissue 0.939373 no
DIF_stipe_shell DIF_gill_tissue 0.950844 no
DIF_stipe_shell YFB_stipe_center 0.712426 no
DIF_stipe_shell YFB_stipe_shell 0.903770 no
DIF_stipe_shell YFB_stipe_skin 0.979259 no
DIF_stipe_shell YFB_cap_skin 0.932948 no
DIF_stipe_shell YFB_cap_tissue 0.861938 no
DIF_stipe_shell YFB_gill_tissue 0.977504 no
DIF_stipe_shell YFB_veil 0.976599 no
DIF_stipe_shell DIF_stipe_skin 0.961538 no
DIF_stipe_shell DIF_cap_skin 0.973480 no
DIF_stipe_shell DIF_cap_tissue 0.932378 no
DIF_stipe_skin DIF_gill_tissue 0.905191 no
DIF_stipe_skin YFB_stipe_center 0.774402 no
DIF_stipe_skin YFB_stipe_shell 0.947914 no
DIF_stipe_skin YFB_stipe_skin 0.982650 no
DIF_stipe_skin YFB_cap_skin 0.973017 no
DIF_stipe_skin YFB_cap_tissue 0.804141 no
DIF_stipe_skin YFB_gill_tissue 0.983711 no
DIF_stipe_skin YFB_veil 0.935199 no
DIF_stipe_skin DIF_cap_skin 0.930058 no
DIF_stipe_skin DIF_cap_tissue 0.883406 no
DIF_cap_skin DIF_gill_tissue 0.977185 no
DIF_cap_skin YFB_stipe_center 0.669956 no
DIF_cap_skin YFB_stipe_shell 0.866224 no
DIF_cap_skin YFB_stipe_skin 0.950720 no
DIF_cap_skin YFB_cap_skin 0.900134 no
DIF_cap_skin YFB_cap_tissue 0.894478 no
DIF_cap_skin YFB_gill_tissue 0.948619 no
DIF_cap_skin YFB_veil 0.995947 no
DIF_cap_skin DIF_cap_tissue 0.959748 no
DIF_cap_tissue DIF_gill_tissue 0.983831 no
DIF_cap_tissue YFB_stipe_center 0.596653 no
DIF_cap_tissue YFB_stipe_shell 0.812134 no
DIF_cap_tissue YFB_stipe_skin 0.905639 no
DIF_cap_tissue YFB_cap_skin 0.847331 no
DIF_cap_tissue YFB_cap_tissue 0.939951 no
DIF_cap_tissue YFB_gill_tissue 0.903501 no
DIF_cap_tissue YFB_veil 0.955961 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009400
MRGELCVGVGSLLSLVSVLLMIFVHVGQINTSNVPRNVYMAKVNVSAYGDALSFAIAPDPVFGLYTDNASAPLQA
AAGLRQIYKFGIYSHCAYLNDTAGRCGNQTIGDQFKPYEAITNDMSANWSIFTQSFIPDSTFRDSKFLGHNSKAA
YWMLLLGLLCAAAAFITGVAKHNMTFLVSTLFAIAGSLLLLIGASIWTVIIQRAANINDLPVHSHSGDQSVPLGI
VVSLGPGLLLTWAAFACLVASVIPYMISCCTFR*
Coding >AgabiH97|009400
ATGCGCGGCGAACTCTGCGTCGGCGTTGGCTCGCTCCTTTCTCTTGTGTCTGTTCTTCTCATGATTTTCGTCCAT
GTCGGTCAAATTAATACCTCAAATGTCCCCCGTAACGTCTACATGGCCAAAGTGAACGTCTCGGCGTACGGCGAT
GCCCTGAGTTTTGCCATTGCGCCAGATCCAGTTTTCGGCCTCTATACCGATAACGCGTCCGCACCTCTGCAGGCT
GCCGCGGGCCTGCGCCAAATCTACAAATTTGGCATCTATTCCCATTGTGCATACCTCAATGATACCGCAGGCCGA
TGCGGAAACCAAACCATAGGCGATCAGTTCAAACCATACGAAGCCATTACGAACGACATGAGCGCAAACTGGTCC
ATATTCACTCAATCATTCATACCCGACTCTACTTTTCGGGATTCCAAGTTTCTGGGGCACAACTCCAAGGCGGCT
TACTGGATGCTTCTCCTTGGGCTGTTGTGTGCTGCCGCTGCATTCATCACCGGTGTCGCTAAACACAATATGACA
TTCCTCGTTTCGACTCTCTTCGCGATAGCGGGAAGCCTATTGTTGTTGATTGGCGCTAGTATTTGGACTGTTATC
ATCCAGAGGGCTGCAAACATCAATGACCTCCCCGTGCATTCGCACTCGGGGGACCAGTCCGTACCACTTGGCATC
GTTGTATCTCTTGGCCCGGGCTTACTCTTGACGTGGGCTGCGTTTGCTTGCCTCGTGGCGTCCGTGATTCCATAC
ATGATTAGCTGCTGCACGTTTCGCTGA
Transcript >AgabiH97|009400
ATGCGCGGCGAACTCTGCGTCGGCGTTGGCTCGCTCCTTTCTCTTGTGTCTGTTCTTCTCATGATTTTCGTCCAT
GTCGGTCAAATTAATACCTCAAATGTCCCCCGTAACGTCTACATGGCCAAAGTGAACGTCTCGGCGTACGGCGAT
GCCCTGAGTTTTGCCATTGCGCCAGATCCAGTTTTCGGCCTCTATACCGATAACGCGTCCGCACCTCTGCAGGCT
GCCGCGGGCCTGCGCCAAATCTACAAATTTGGCATCTATTCCCATTGTGCATACCTCAATGATACCGCAGGCCGA
TGCGGAAACCAAACCATAGGCGATCAGTTCAAACCATACGAAGCCATTACGAACGACATGAGCGCAAACTGGTCC
ATATTCACTCAATCATTCATACCCGACTCTACTTTTCGGGATTCCAAGTTTCTGGGGCACAACTCCAAGGCGGCT
TACTGGATGCTTCTCCTTGGGCTGTTGTGTGCTGCCGCTGCATTCATCACCGGTGTCGCTAAACACAATATGACA
TTCCTCGTTTCGACTCTCTTCGCGATAGCGGGAAGCCTATTGTTGTTGATTGGCGCTAGTATTTGGACTGTTATC
ATCCAGAGGGCTGCAAACATCAATGACCTCCCCGTGCATTCGCACTCGGGGGACCAGTCCGTACCACTTGGCATC
GTTGTATCTCTTGGCCCGGGCTTACTCTTGACGTGGGCTGCGTTTGCTTGCCTCGTGGCGTCCGTGATTCCATAC
ATGATTAGCTGCTGCACGTTTCGCTGA
Gene >AgabiH97|009400
ATGCGCGGCGAACTCTGCGTCGGCGTTGGCTCGCTCCTTTCGTACGTCTGTGCCCTCTCTCGCCCCTCTCGCTTT
TGTTCACCCCTCCGCCCAGTCTTGTGTCTGTTCTTCTCATGATTTTCGTCCATGTGCGGCCCACGATCTCTTTTC
AGCGCCGTCGCTCAATCCACCCCTTCTCAGGTCGGTCAAATTAATACCTCAAATGTCCCCCGTAACGTCTACATG
GTATGTCCCCATTTCCGTCTCCGCGCATCGGCTTGTTCATCCGTCCTAGGCCAAAGTGAACGTCTCGGCGTACGG
GTATGTCTTCGCGCATGTCATTTACAGCCCTGTCTTACATAGGGTGTTGTCCAGCGATGCCCTGAGTTTTGCCAT
TGCGCCAGATCCAGTTTTCGGCCTCTATACCGATAACGCGTCCGCACCTCTGCAGGCTGCCGCGGGCCTGCGCCA
AATCTACAAATTTGGCATCTATTCCCATTGTGCATACCTCAATGATACCGCAGGCCGATGCGGAAACCAAACCAT
AGGCGATCAGTTCAAACCATACGAAGCCATTACGAACGACATGAGCGCAAACTGGTCCATATTCACTCAATCATT
CATACCCGACTCTACTTTTCGGGATTCCAAGTTTCTGGGGCACAACTCCAAGGCGGCTTACTGGATGCTTCTCCT
TGGGCTGTTGTGTGCTGCCGCTGCATTCATCACGTACGTCGCTTGAATTTGATCCTCGATTTTTTTTATTTATAG
GCAGTACAGCGGTGTCGCTAAACACAATATGACATTCCTCGTTTCGACTCTCTTCGCGATAGCGGGAAGCCTATT
GTTGTTGATTGGCGCTAGTATTTGGACTGTTATCATCCAGAGGGCTGCAAACATCAATGACCTCCCCGTGCATTC
GCACTCGGGGGACCAGTCCGTACCACTTGGCATCGTTGTATCTCTTGGCCCGGGCTTACTCTTGACGTGGGCTGC
GTTTGCTTGCCTCGTGGCGTCCGTGATTCCATACATGATTAGGTGCGTCATGCATGCTGTTAACCATCCATGGCC
CCACTGAGTCCCCCGCAGCTGCTGCACGTTTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail