Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009390
Gene name
Locationscaffold_1:2214786..2216685
Strand-
Gene length (bp)1899
Transcript length (bp)1695
Coding sequence length (bp)1695
Protein length (aa) 565

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03198 Glyco_hydro_72 Glucanosyltransferase 5.6E-86 28 342
PF07983 X8 X8 domain 2.7E-17 390 472

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0XVI5|GEL4_ASPFC 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel4 PE=1 SV=1 3 485 9.0E-104
sp|P0C956|GEL4_ASPFU 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel4 PE=3 SV=1 3 485 9.0E-104
sp|O13318|PHR2_CANAL pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHR2 PE=2 SV=2 31 488 6.0E-94
sp|P22146|GAS1_YEAST 1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS1 PE=1 SV=2 7 485 2.0E-92
sp|Q9P378|GAS1_SCHPO 1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas1 PE=1 SV=1 10 496 9.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0XVI5|GEL4_ASPFC 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel4 PE=1 SV=1 3 485 9.0E-104
sp|P0C956|GEL4_ASPFU 1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel4 PE=3 SV=1 3 485 9.0E-104
sp|O13318|PHR2_CANAL pH-responsive protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHR2 PE=2 SV=2 31 488 6.0E-94
sp|P22146|GAS1_YEAST 1,3-beta-glucanosyltransferase GAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS1 PE=1 SV=2 7 485 2.0E-92
sp|Q9P378|GAS1_SCHPO 1,3-beta-glucanosyltransferase gas1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas1 PE=1 SV=1 10 496 9.0E-92
sp|P0C955|GEL3_ASPFU 1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel3 PE=3 SV=1 4 501 3.0E-90
sp|B0XT09|GEL3_ASPFC 1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel3 PE=1 SV=1 4 501 3.0E-90
sp|Q59VW6|PGA5_CANAL 1,3-beta-glucanosyltransferase PGA5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA5 PE=1 SV=1 38 473 1.0E-88
sp|P56092|EPD1_CANMA Protein EPD1 OS=Candida maltosa GN=EPD1 PE=3 SV=1 31 473 1.0E-88
sp|P43076|PHR1_CANAL pH-responsive protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PHR1 PE=2 SV=3 31 491 6.0E-87
sp|D4ATC3|GAS1_ARTBC 1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07487 PE=1 SV=1 31 508 1.0E-84
sp|O74137|EPD2_CANMA Protein EPD2 OS=Candida maltosa GN=EPD2 PE=3 SV=1 31 474 7.0E-83
sp|Q06135|GAS2_YEAST 1,3-beta-glucanosyltransferase GAS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS2 PE=1 SV=1 31 455 1.0E-74
sp|Q9USU5|GAS2_SCHPO 1,3-beta-glucanosyltransferase gas2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas2 PE=2 SV=1 8 475 2.0E-73
sp|Q08193|GAS5_YEAST 1,3-beta-glucanosyltransferase GAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS5 PE=1 SV=1 8 378 9.0E-61
sp|Q5AJY5|PGA4_CANAL 1,3-beta-glucanosyltransferase PGA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PGA4 PE=1 SV=1 9 378 4.0E-60
sp|Q9Y7Y7|GAS4_SCHPO 1,3-beta-glucanosyltransferase gas4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gas4 PE=1 SV=1 4 379 4.0E-55
sp|Q08271|GAS4_YEAST 1,3-beta-glucanosyltransferase GAS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS4 PE=1 SV=1 9 374 2.0E-54
sp|P0C954|GEL2_ASPFU 1,3-beta-glucanosyltransferase gel2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel2 PE=3 SV=1 7 378 6.0E-54
sp|B0Y8H9|GEL2_ASPFC 1,3-beta-glucanosyltransferase gel2 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel2 PE=1 SV=1 7 378 6.0E-54
sp|B0XT72|GEL1_ASPFC 1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=gel1 PE=1 SV=1 11 345 5.0E-53
sp|P0C7S9|GEL1_ASPFU 1,3-beta-glucanosyltransferase gel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gel1 PE=3 SV=1 11 345 3.0E-52
sp|Q03655|GAS3_YEAST Probable 1,3-beta-glucanosyltransferase GAS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAS3 PE=1 SV=1 4 378 6.0E-43
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009390
MPPLRAARLLTALALFSCGAQAISQVTRNGRYLYNADGSRFYIKGIAYQPQGFVIASDDNAFGEPTGFEDPLAQP
DDCKRDIPFLQELSVNVIRAYSVNSSLNHDECMSALSNAGIYTIIDLSLPMNGSVDRSAPSWSGNLLDQYLETID
VFSKYDNVLAYNVGNEAITSNTTSVAPFIKAAARDVKAYLNSKSSSSLVAYAQIDGAENFRENVADYLSCDPTGQ
NSPSTAIDLFGLNNYEWCGDSTFEGSYAGLTSQFADYNVVAYFSECGCVSQPPRLWTEMDAIFSSQMSDVWSGSI
AFSYFPAESVDGQYGMVTISSDGSTVQTSEDFDRLKQHYTAVSPPNSPSKDSAGASSYPSCPSSSDTFAASTTLP
PTPDFAACSCLENALSCQFRPATSNYSAIVGELLDESCSLLGQSGGNCDELGANGQTGTYGRVSSCDPTIKLSYA
MTSYYELNNRDAQACSFAGNGTVNSGSPASSASAAASSCITNAAAVFTPTLPAGGSNPGGSSGNGNGNGNGNGGG
SSGNGDDTEPNSALVDAKPLLGVAAMIITSVVGGILTVV*
Coding >AgabiH97|009390
ATGCCCCCCCTTCGAGCTGCCCGCCTTCTGACTGCCCTCGCCCTCTTCTCGTGTGGCGCACAGGCCATATCACAG
GTCACTCGCAATGGTCGATACCTTTACAATGCAGACGGTAGTCGGTTCTATATAAAGGGAATAGCCTACCAACCC
CAAGGCTTTGTCATTGCCAGCGATGATAATGCCTTTGGAGAGCCTACGGGCTTTGAAGACCCTCTCGCCCAACCC
GATGATTGCAAACGTGATATCCCCTTCCTCCAAGAGCTCTCTGTCAACGTCATTCGTGCTTACAGCGTCAATTCG
TCCCTCAATCACGATGAGTGCATGTCCGCTCTCAGTAACGCAGGAATTTATACCATTATTGATCTTTCTCTCCCA
ATGAACGGGTCCGTTGATCGGTCGGCCCCCTCGTGGTCAGGCAATCTTCTTGATCAATACCTTGAAACCATTGAC
GTATTTTCTAAATACGACAACGTGCTCGCCTACAACGTCGGTAATGAAGCCATTACTTCTAATACCACTTCGGTT
GCCCCTTTCATCAAGGCTGCTGCTCGCGATGTCAAGGCTTATCTAAATTCAAAAAGTTCATCCAGTCTCGTCGCT
TATGCTCAGATTGACGGCGCGGAGAATTTCAGAGAGAACGTGGCCGACTACTTGTCTTGTGATCCTACCGGTCAA
AACTCCCCGTCGACCGCTATCGACCTTTTCGGGCTGAACAACTACGAGTGGTGTGGTGATTCAACTTTCGAGGGT
TCTTATGCTGGTCTCACTAGTCAGTTTGCTGACTATAACGTCGTCGCCTACTTCAGCGAATGTGGATGCGTCTCT
CAGCCTCCACGTCTTTGGACGGAAATGGATGCAATCTTCAGTTCACAAATGTCTGACGTTTGGAGTGGATCCATT
GCGTTTTCCTATTTCCCGGCTGAAAGCGTTGACGGCCAGTATGGTATGGTCACCATCTCCTCTGATGGGTCGACT
GTCCAGACTAGCGAAGATTTTGATCGACTGAAGCAACATTACACTGCCGTCTCTCCACCCAACAGCCCTTCGAAA
GACTCTGCTGGTGCTAGTAGCTATCCTTCCTGCCCATCAAGTAGTGATACCTTTGCCGCTTCCACCACTCTCCCG
CCCACTCCAGACTTTGCCGCCTGTAGTTGCCTCGAGAATGCCTTGAGTTGTCAGTTTAGACCTGCGACATCCAAT
TACAGTGCCATCGTTGGTGAACTACTCGATGAAAGTTGCAGTCTACTTGGTCAGAGCGGTGGAAACTGTGACGAG
CTCGGCGCCAACGGGCAGACTGGCACATATGGAAGAGTCTCTTCATGTGATCCTACTATCAAGTTGTCGTATGCT
ATGACTAGTTACTACGAGCTCAACAACCGCGACGCACAGGCTTGTAGTTTCGCTGGTAATGGTACTGTGAACTCT
GGATCGCCAGCCTCGAGTGCTAGCGCTGCCGCGTCCTCTTGTATTACAAATGCGGCCGCTGTCTTCACTCCTACT
CTCCCCGCAGGGGGAAGCAATCCCGGTGGTTCTTCCGGAAATGGAAATGGAAATGGAAATGGAAATGGTGGTGGT
AGTTCAGGCAACGGCGACGACACGGAGCCTAACAGCGCCTTGGTTGACGCCAAGCCACTCCTTGGAGTTGCCGCT
ATGATCATCACAAGTGTTGTTGGTGGTATCCTGACTGTTGTTTGA
Transcript >AgabiH97|009390
ATGCCCCCCCTTCGAGCTGCCCGCCTTCTGACTGCCCTCGCCCTCTTCTCGTGTGGCGCACAGGCCATATCACAG
GTCACTCGCAATGGTCGATACCTTTACAATGCAGACGGTAGTCGGTTCTATATAAAGGGAATAGCCTACCAACCC
CAAGGCTTTGTCATTGCCAGCGATGATAATGCCTTTGGAGAGCCTACGGGCTTTGAAGACCCTCTCGCCCAACCC
GATGATTGCAAACGTGATATCCCCTTCCTCCAAGAGCTCTCTGTCAACGTCATTCGTGCTTACAGCGTCAATTCG
TCCCTCAATCACGATGAGTGCATGTCCGCTCTCAGTAACGCAGGAATTTATACCATTATTGATCTTTCTCTCCCA
ATGAACGGGTCCGTTGATCGGTCGGCCCCCTCGTGGTCAGGCAATCTTCTTGATCAATACCTTGAAACCATTGAC
GTATTTTCTAAATACGACAACGTGCTCGCCTACAACGTCGGTAATGAAGCCATTACTTCTAATACCACTTCGGTT
GCCCCTTTCATCAAGGCTGCTGCTCGCGATGTCAAGGCTTATCTAAATTCAAAAAGTTCATCCAGTCTCGTCGCT
TATGCTCAGATTGACGGCGCGGAGAATTTCAGAGAGAACGTGGCCGACTACTTGTCTTGTGATCCTACCGGTCAA
AACTCCCCGTCGACCGCTATCGACCTTTTCGGGCTGAACAACTACGAGTGGTGTGGTGATTCAACTTTCGAGGGT
TCTTATGCTGGTCTCACTAGTCAGTTTGCTGACTATAACGTCGTCGCCTACTTCAGCGAATGTGGATGCGTCTCT
CAGCCTCCACGTCTTTGGACGGAAATGGATGCAATCTTCAGTTCACAAATGTCTGACGTTTGGAGTGGATCCATT
GCGTTTTCCTATTTCCCGGCTGAAAGCGTTGACGGCCAGTATGGTATGGTCACCATCTCCTCTGATGGGTCGACT
GTCCAGACTAGCGAAGATTTTGATCGACTGAAGCAACATTACACTGCCGTCTCTCCACCCAACAGCCCTTCGAAA
GACTCTGCTGGTGCTAGTAGCTATCCTTCCTGCCCATCAAGTAGTGATACCTTTGCCGCTTCCACCACTCTCCCG
CCCACTCCAGACTTTGCCGCCTGTAGTTGCCTCGAGAATGCCTTGAGTTGTCAGTTTAGACCTGCGACATCCAAT
TACAGTGCCATCGTTGGTGAACTACTCGATGAAAGTTGCAGTCTACTTGGTCAGAGCGGTGGAAACTGTGACGAG
CTCGGCGCCAACGGGCAGACTGGCACATATGGAAGAGTCTCTTCATGTGATCCTACTATCAAGTTGTCGTATGCT
ATGACTAGTTACTACGAGCTCAACAACCGCGACGCACAGGCTTGTAGTTTCGCTGGTAATGGTACTGTGAACTCT
GGATCGCCAGCCTCGAGTGCTAGCGCTGCCGCGTCCTCTTGTATTACAAATGCGGCCGCTGTCTTCACTCCTACT
CTCCCCGCAGGGGGAAGCAATCCCGGTGGTTCTTCCGGAAATGGAAATGGAAATGGAAATGGAAATGGTGGTGGT
AGTTCAGGCAACGGCGACGACACGGAGCCTAACAGCGCCTTGGTTGACGCCAAGCCACTCCTTGGAGTTGCCGCT
ATGATCATCACAAGTGTTGTTGGTGGTATCCTGACTGTTGTTTGA
Gene >AgabiH97|009390
ATGCCCCCCCTTCGAGCTGCCCGCCTTCTGACTGCCCTCGCCCTCTTCTCGTGTGGCGCACAGGCCATATCACAG
GTCACTCGCAATGGTCGATACCTTTACAATGCAGACGGTAGTCGGTTCTATATAAAGGGAATAGCCTACCAACCC
CAAGGCATGCTTCCATGTTCTTTCTCCAAACTACTTCTCATCTCCCTTGTCAGGCTTTGTCATTGCCAGCGATGA
TAATGCCTTTGGAGAGCCTACGGGCTTTGAAGACCCTCTCGCCCAACCCGATGATTGCAAACGTGATATCCCCTT
CCTCCAAGAGCTCTCTGTCAACGTCATTCGTGCTTACAGCGTCAATTCGTCCCTCAATCACGATGAGTGCATGTC
CGCTCTCAGTAACGCAGGAATTTATACCATGTAAGTCATGAACGGGTGCAATGAGTCTTTAGCCGCTGACAGCGA
CCAGTATTGATCTTTCTCTCCCAATGAACGGGTCCGTTGATCGGTCGGCCCCCTCGTGGTCAGGCAATCTTCTTG
ATCAATACCTTGAAACCATTGACGTATTTTCTAAATACGACAACGTGCTCGCCTACAACGTCGGTAATGAAGCCA
TTACTTCTAATACCACTTCGGTTGCCCCTTTCATCAAGGCTGCTGCTCGCGATGTCAAGGCTTATCTAAATTCAA
AAAGTTCATCCAGTCTCGTCGCTTATGCTCAGATTGACGGCGCGGAGAATTTCAGAGAGAACGTGGCCGACTACT
TGTCTTGTGATCCTACCGGTCAAAACTCCCCGTCGACCGCTATCGACCTTTTCGGGCTGAACAACTAGTAAGCAC
ATTTTCCAACTCTTTATCTTGACTCAGGCTGATATCGTACAGCGAGTGGTGTGGTGATTCAACTTTCGAGGGTTC
TTATGCTGGTCTCACTAGTCAGTTTGCTGACTATAACGTCGTCGCCTACTTCAGCGAATGTGGATGCGTCTCTCA
GCCTCCACGTCTTTGGACGGAAATGGATGCAATCTTCAGTTCACAAATGTCTGACGTTTGGAGTGGATCCATTGC
GTTTTCCTATTTCCCGGCTGAAAGCGTTGACGGCCAGTATGGTATGGTCACCATCTCCTCTGATGGGTCGACTGT
CCAGACTAGCGAAGATTTTGATCGACTGAAGCAACATTACACTGCCGTCTCTCCACCCAACAGCCCTTCGAAAGA
CTCTGCTGGTGCTAGTAGCTATCCTTCCTGCCCATCAAGTAGTGATACCTTTGCCGCTTCCACCACTCTCCCGCC
CACTCCAGACTTTGCCGCCTGTAGTTGCCTCGAGAATGCCTTGAGTTGTCAGTTTAGACCTGCGACATCCAATTA
CAGTGCCATCGTTGGTGAACTACTCGATGAAAGTTGCAGTCTACTTGGTCAGAGCGGTGGAAACTGTGACGAGCT
CGGCGCCAACGGGCAGACTGGCACATATGGAAGAGTCTCTTCATGTGATCCTAGTAAGTTTCCCCATACATTGAG
ACGGTTTCATGTAGAACTGATTTATTACTTTTAGCTATCAAGTTGTCGTATGCTATGACTAGTTACTACGAGCTC
AACAACCGCGACGCACAGGCTTGTAGTTTCGCTGGTAATGGTACTGTGAACTCTGGATCGCCAGCCTCGAGTGCT
AGCGCTGCCGCGTCCTCTTGTATTACAAATGCGGCCGCTGTCTTCACTCCTACTCTCCCCGCAGGGGGAAGCAAT
CCCGGTGGTTCTTCCGGAAATGGAAATGGAAATGGAAATGGAAATGGTGGTGGTAGTTCAGGCAACGGCGACGAC
ACGGAGCCTAACAGCGCCTTGGTTGACGCCAAGCCACTCCTTGGAGTTGCCGCTATGATCATCACAAGTGTTGTT
GGTGGTATCCTGACTGTTGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail