Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009260
Gene name
Locationscaffold_1:2184268..2186134
Strand-
Gene length (bp)1866
Transcript length (bp)1563
Coding sequence length (bp)1563
Protein length (aa) 521

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07156 Prenylcys_lyase Prenylcysteine lyase 1.4E-62 158 489
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.7E-09 53 124
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 1.1E-06 74 326

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P57681|PCYOX_ARATH Farnesylcysteine lyase OS=Arabidopsis thaliana GN=FLCY PE=1 SV=1 40 487 8.0E-46
sp|Q9CQF9|PCYOX_MOUSE Prenylcysteine oxidase OS=Mus musculus GN=Pcyox1 PE=1 SV=1 45 481 1.0E-26
sp|Q95KC9|PCYOX_MACFA Prenylcysteine oxidase OS=Macaca fascicularis GN=PCYOX1 PE=2 SV=1 45 481 6.0E-25
sp|Q99ML5|PCYOX_RAT Prenylcysteine oxidase OS=Rattus norvegicus GN=Pcyox1 PE=1 SV=1 45 481 9.0E-23
sp|Q9UHG3|PCYOX_HUMAN Prenylcysteine oxidase 1 OS=Homo sapiens GN=PCYOX1 PE=1 SV=3 61 481 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P57681|PCYOX_ARATH Farnesylcysteine lyase OS=Arabidopsis thaliana GN=FLCY PE=1 SV=1 40 487 8.0E-46
sp|Q9CQF9|PCYOX_MOUSE Prenylcysteine oxidase OS=Mus musculus GN=Pcyox1 PE=1 SV=1 45 481 1.0E-26
sp|Q95KC9|PCYOX_MACFA Prenylcysteine oxidase OS=Macaca fascicularis GN=PCYOX1 PE=2 SV=1 45 481 6.0E-25
sp|Q99ML5|PCYOX_RAT Prenylcysteine oxidase OS=Rattus norvegicus GN=Pcyox1 PE=1 SV=1 45 481 9.0E-23
sp|Q9UHG3|PCYOX_HUMAN Prenylcysteine oxidase 1 OS=Homo sapiens GN=PCYOX1 PE=1 SV=3 61 481 1.0E-19
sp|Q5R748|PCYOX_PONAB Prenylcysteine oxidase OS=Pongo abelii GN=PCYOX1 PE=2 SV=1 61 481 2.0E-19
sp|Q8NBM8|PCYXL_HUMAN Prenylcysteine oxidase-like OS=Homo sapiens GN=PCYOX1L PE=1 SV=2 50 485 5.0E-17
sp|Q8C7K6|PCYXL_MOUSE Prenylcysteine oxidase-like OS=Mus musculus GN=Pcyox1l PE=1 SV=1 43 485 5.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor Yes
GO:0030328 prenylcysteine catabolic process Yes
GO:0016491 oxidoreductase activity Yes
GO:0006575 cellular modified amino acid metabolic process No
GO:0042219 cellular modified amino acid catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0009056 catabolic process No
GO:0008152 metabolic process No
GO:1901575 organic substance catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0030329 prenylcysteine metabolic process No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009260
MRYAALLLLATSVYAFEIPFFVPDFLKNHVLPPSTPIVEVKDDPPPTVPRIAIVGAGAGGSSAAFWISKAKSRSG
LDVEVDVYDRNNYIGGRSTVVHPYNDTTLPELELGASIFVRANKNLWRASEEFNLTRRDFTEENYVVGLWDGQDV
RFTFEGGWWGTLKVLWRYGMTSPKRVQGIVTEMLKTYVGLYSKDTPKWNNITRLSEKYGWTELTASSTMEYLVRK
NVSPRYISELVEAATRTNYGQNADYIHALEGMCSLATDGAAGISGGNYRIFEQFLQRSDAFVHLNANVNSILPST
DSKNWTVATSKGTQDYAAVILAAPFHFTDITVPHSISEQISNHPYVHLHVTLLTTTSEYPNPAYFNLPSSSKPAR
MMLTTDEGVRHGGLEPEFNSLSYHGLVRPGEWAAKIFSKSRISDQLLDNIFNGQVKWVYRKEWDSYPKLPPMESY
PPVKLGQGFYYVNSFEPFISTMETETLSSRNIVDLLLDDLFNASICGPQITDLTNITTADKNDYVYGWDC*
Coding >AgabiH97|009260
ATGAGGTATGCGGCATTGTTATTGCTTGCTACCAGCGTATACGCCTTCGAGATACCCTTCTTTGTTCCTGACTTC
CTCAAGAATCACGTTTTACCCCCGTCTACGCCAATAGTTGAAGTCAAAGACGACCCTCCACCCACTGTTCCTAGG
ATAGCGATTGTTGGCGCCGGTGCCGGAGGTAGCTCAGCGGCGTTTTGGATTTCCAAAGCCAAATCCCGCTCTGGC
CTAGATGTCGAAGTCGATGTTTACGACCGAAACAACTACATCGGTGGACGGTCCACTGTCGTCCATCCTTATAAT
GATACAACTCTCCCAGAGTTAGAATTGGGGGCGTCTATATTTGTTCGAGCAAACAAGAACCTCTGGCGAGCATCA
GAAGAGTTCAATCTGACCCGCCGGGATTTCACAGAGGAGAACTATGTGGTTGGCTTGTGGGATGGTCAGGATGTT
AGATTTACGTTTGAAGGAGGCTGGTGGGGAACTCTCAAAGTACTTTGGCGTTATGGGATGACATCTCCTAAGCGG
GTTCAGGGCATCGTTACCGAGATGCTCAAGACATACGTCGGTTTGTACTCAAAGGATACGCCCAAGTGGAATAAC
ATCACCCGTCTATCTGAAAAGTATGGTTGGACGGAGTTAACTGCAAGTTCCACAATGGAGTACCTTGTTCGAAAG
AATGTTTCTCCGCGCTATATTTCTGAACTTGTTGAGGCGGCAACCAGAACCAATTATGGTCAGAATGCTGACTAT
ATACATGCATTGGAAGGCATGTGCTCGCTTGCCACAGACGGTGCTGCAGGAATCTCAGGAGGGAACTATCGGATC
TTTGAGCAATTCCTCCAACGCTCTGACGCATTTGTTCACTTGAACGCCAACGTCAACAGTATCCTTCCCAGCACA
GATTCAAAAAATTGGACAGTTGCTACTTCCAAAGGAACCCAAGACTATGCTGCCGTTATTTTGGCGGCGCCTTTC
CATTTCACTGACATTACTGTACCTCATTCAATATCTGAGCAGATTTCCAACCATCCTTACGTGCATCTCCATGTC
ACTCTGTTGACGACCACTTCAGAATATCCTAACCCGGCATATTTTAATTTACCTTCGTCTTCTAAACCTGCGCGT
ATGATGCTCACAACTGACGAGGGTGTGCGTCACGGCGGATTAGAACCCGAGTTTAATTCCCTTTCATATCATGGG
CTTGTACGCCCCGGCGAGTGGGCGGCCAAAATTTTCTCTAAAAGTCGTATCAGTGATCAGTTGCTTGATAATATT
TTCAATGGTCAGGTGAAGTGGGTTTACAGGAAGGAGTGGGATTCCTATCCTAAATTGCCACCAATGGAATCTTAT
CCTCCTGTCAAACTCGGACAGGGTTTCTATTATGTCAACTCTTTCGAGCCATTCATCTCAACAATGGAGACGGAA
ACTTTGTCTTCACGCAACATTGTGGATCTGCTCCTCGATGATCTATTCAACGCCAGTATCTGTGGACCTCAGATT
ACAGATCTTACAAACATTACCACCGCAGATAAGAATGACTATGTATATGGTTGGGACTGTTGA
Transcript >AgabiH97|009260
ATGAGGTATGCGGCATTGTTATTGCTTGCTACCAGCGTATACGCCTTCGAGATACCCTTCTTTGTTCCTGACTTC
CTCAAGAATCACGTTTTACCCCCGTCTACGCCAATAGTTGAAGTCAAAGACGACCCTCCACCCACTGTTCCTAGG
ATAGCGATTGTTGGCGCCGGTGCCGGAGGTAGCTCAGCGGCGTTTTGGATTTCCAAAGCCAAATCCCGCTCTGGC
CTAGATGTCGAAGTCGATGTTTACGACCGAAACAACTACATCGGTGGACGGTCCACTGTCGTCCATCCTTATAAT
GATACAACTCTCCCAGAGTTAGAATTGGGGGCGTCTATATTTGTTCGAGCAAACAAGAACCTCTGGCGAGCATCA
GAAGAGTTCAATCTGACCCGCCGGGATTTCACAGAGGAGAACTATGTGGTTGGCTTGTGGGATGGTCAGGATGTT
AGATTTACGTTTGAAGGAGGCTGGTGGGGAACTCTCAAAGTACTTTGGCGTTATGGGATGACATCTCCTAAGCGG
GTTCAGGGCATCGTTACCGAGATGCTCAAGACATACGTCGGTTTGTACTCAAAGGATACGCCCAAGTGGAATAAC
ATCACCCGTCTATCTGAAAAGTATGGTTGGACGGAGTTAACTGCAAGTTCCACAATGGAGTACCTTGTTCGAAAG
AATGTTTCTCCGCGCTATATTTCTGAACTTGTTGAGGCGGCAACCAGAACCAATTATGGTCAGAATGCTGACTAT
ATACATGCATTGGAAGGCATGTGCTCGCTTGCCACAGACGGTGCTGCAGGAATCTCAGGAGGGAACTATCGGATC
TTTGAGCAATTCCTCCAACGCTCTGACGCATTTGTTCACTTGAACGCCAACGTCAACAGTATCCTTCCCAGCACA
GATTCAAAAAATTGGACAGTTGCTACTTCCAAAGGAACCCAAGACTATGCTGCCGTTATTTTGGCGGCGCCTTTC
CATTTCACTGACATTACTGTACCTCATTCAATATCTGAGCAGATTTCCAACCATCCTTACGTGCATCTCCATGTC
ACTCTGTTGACGACCACTTCAGAATATCCTAACCCGGCATATTTTAATTTACCTTCGTCTTCTAAACCTGCGCGT
ATGATGCTCACAACTGACGAGGGTGTGCGTCACGGCGGATTAGAACCCGAGTTTAATTCCCTTTCATATCATGGG
CTTGTACGCCCCGGCGAGTGGGCGGCCAAAATTTTCTCTAAAAGTCGTATCAGTGATCAGTTGCTTGATAATATT
TTCAATGGTCAGGTGAAGTGGGTTTACAGGAAGGAGTGGGATTCCTATCCTAAATTGCCACCAATGGAATCTTAT
CCTCCTGTCAAACTCGGACAGGGTTTCTATTATGTCAACTCTTTCGAGCCATTCATCTCAACAATGGAGACGGAA
ACTTTGTCTTCACGCAACATTGTGGATCTGCTCCTCGATGATCTATTCAACGCCAGTATCTGTGGACCTCAGATT
ACAGATCTTACAAACATTACCACCGCAGATAAGAATGACTATGTATATGGTTGGGACTGTTGA
Gene >AgabiH97|009260
ATGAGGTATGCGGCATTGTTATTGCTTGCTACCAGCGTATACGCCTTCGAGATACCCTTCTTTGTTCCTGACTTC
CTCAAGAATCACGTTTTACCCCCGTCTACGCCAATAGTTGAAGTCAAAGACGACCCTCCACCCACTGTTCCTAGG
ATAGCGATTGTTGGCGCCGGTGCCGGAGGTAGCTCAGCGGCGTTTTGGATTTCCAAAGCCAAATCCCGCTCTGGC
CTAGATGTCGAAGTCGATGTTTACGACCGAAACAACTACATCGGTGGACGTAGGTCATTCAACGGGTCACTGCAG
CATTTTCACAAACTTTCTTTCCAGGGTCCACTGTCGTCCATCCTTATAATGATACAACTCTCCCAGAGTTAGAAT
TGGGGGCGTCTATATTTGTTCGAGCAAACAAGAACCTCTGGCGAGCATCAGAAGAGTTCAATCTGACCCGCCGGG
ATTTCACAGAGGAGAACTATGTGGTTGGCTTGTGGGATGGTCAGGATGTTAGATTTACGGTAAGGTTCTTTTGTC
CATGATGCAAACATGCTTCATCTTGGTATAGTTTGAAGGAGGCTGGTGGGGAACTCTCAAAGTACTTTGGCGTTA
TGGGATGACATCTCCTAAGCGGGTTCAGGGCATGTATGTCATCCTCAACTTCATTTCCCGGATAATTTCATGGTA
ATAACGAGTGTTTAGCGTTACCGAGATGCTCAAGACATACGTCGGTTTGTACTCAAAGGATACGCCCAAGTGGAA
TAACATCACCCGTCTATCTGAAAAGTATGGTTGGACGGAGTTAACTGCAAGTTCCACAATGGAGTACCTTGTTCG
AAAGAATGTTTCTCCGCGCTATATTTCTGAACTTGTTGAGGCGGCAACCAGAACCAATTATGGTCAGGTCTGTCA
AATTTTTATCTCGCGATTCAACGGTTAGCTGAGAGCAGCCCAGAATGCTGACTATATACATGCATTGGAAGGCAT
GTGCTCGCTTGCCACAGACGGTGCTGCAGGAATCTCAGGAGGGAACTATCGGATCTTTGAGCAATTCCTCCAACG
CTCTGACGCATTTGTTCACTTGAACGCCAACGTCAACAGTATCCTTCCCAGCACAGATTCAAAAAATTGGACAGT
TGCTACTTCCAAAGGAACCCAAGACTATGCTGCCGTTATTTTGGCGGCGCCTTTCCATTTCACTGACATTACTGT
ACCTCATTCAATATCTGAGCAGATTTCCAACCATCCTTACGTGCATCTCCATGTCACTCTGTTGACGACCACTTC
AGAATATCCTAACCCGGCATATTTTAATTTACCTTCGTCTTCTAAACCTGCGCGTATGATGCTCACAACTGACGA
GGGTGTGCGTCACGGCGGATTAGAACCCGAGTTTAATTCCCTTTCATATCATGGGCTTGTACGCCCCGGCGAGTG
GGCGGCCAAAATTTTCTCTAAAAGTCGTATCAGTGATCAGTTGCTTGATAATATTTTCAATGGTCAGGTGAAGTG
GGTTTACAGGAAGGAGGTGCGAGTCTTTTCGCCCAGATCAGATTGAGACTGAACATTTATCAGTGGGATTCCTAT
CCTAAATTGCCACCAATGGAATCTTATCCTCCTGTCAAACTCGGACAGGGTTTCTATTATGTCAACTCTTTCGAG
CCGTGCGTTACTCTACTCCCGATATTTGCCTTGCCTTGACTCAGTTCTCTAAGATTCATCTCAACAATGGAGACG
GAAACTTTGTCTTCACGCAACATTGTGGATCTGCTCCTCGATGATCTATTCAACGCCAGTATCTGTGGACCTCAG
ATTACAGATCTTACAAACATTACCACCGCAGATAAGAATGACTATGTATATGGTTGGGACTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail