Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009040
Gene name
Locationscaffold_1:2128156..2130308
Strand-
Gene length (bp)2152
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.4E-30 38 327
PF07690 MFS_1 Major Facilitator Superfamily 2.3E-11 302 450

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74852|YQ92_SCHPO Uncharacterized MFS-type transporter C18.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.02 PE=3 SV=1 24 462 5.0E-30
sp|Q27963|VMAT2_BOVIN Synaptic vesicular amine transporter OS=Bos taurus GN=SLC18A2 PE=1 SV=1 73 443 2.0E-13
sp|P59845|VACHB_DANRE Probable vesicular acetylcholine transporter-B OS=Danio rerio GN=slc18a3b PE=2 SV=1 43 211 5.0E-13
sp|Q01827|VMAT2_RAT Synaptic vesicular amine transporter OS=Rattus norvegicus GN=Slc18a2 PE=1 SV=2 73 449 1.0E-12
sp|Q08C75|VACHA_DANRE Probable vesicular acetylcholine transporter-A OS=Danio rerio GN=slc18a3a PE=2 SV=1 35 222 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74852|YQ92_SCHPO Uncharacterized MFS-type transporter C18.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.02 PE=3 SV=1 24 462 5.0E-30
sp|Q27963|VMAT2_BOVIN Synaptic vesicular amine transporter OS=Bos taurus GN=SLC18A2 PE=1 SV=1 73 443 2.0E-13
sp|P59845|VACHB_DANRE Probable vesicular acetylcholine transporter-B OS=Danio rerio GN=slc18a3b PE=2 SV=1 43 211 5.0E-13
sp|Q01827|VMAT2_RAT Synaptic vesicular amine transporter OS=Rattus norvegicus GN=Slc18a2 PE=1 SV=2 73 449 1.0E-12
sp|Q08C75|VACHA_DANRE Probable vesicular acetylcholine transporter-A OS=Danio rerio GN=slc18a3a PE=2 SV=1 35 222 1.0E-12
sp|Q8BRU6|VMAT2_MOUSE Synaptic vesicular amine transporter OS=Mus musculus GN=Slc18a2 PE=1 SV=1 73 449 2.0E-12
sp|Q05940|VMAT2_HUMAN Synaptic vesicular amine transporter OS=Homo sapiens GN=SLC18A2 PE=1 SV=2 73 449 6.0E-12
sp|P34711|UNC17_CAEEL Vesicular acetylcholine transporter unc-17 OS=Caenorhabditis elegans GN=unc-17 PE=1 SV=1 35 213 1.0E-11
sp|Q62666|VACHT_RAT Vesicular acetylcholine transporter OS=Rattus norvegicus GN=Slc18a3 PE=2 SV=2 101 214 3.0E-11
sp|O35304|VACHT_MOUSE Vesicular acetylcholine transporter OS=Mus musculus GN=Slc18a3 PE=2 SV=1 101 214 5.0E-11
sp|Q16572|VACHT_HUMAN Vesicular acetylcholine transporter OS=Homo sapiens GN=SLC18A3 PE=2 SV=2 101 214 7.0E-11
sp|Q91514|VACHT_TORTO Vesicular acetylcholine transporter OS=Torpedo torpedo PE=2 SV=1 35 211 6.0E-10
sp|P81721|VACHT_TORCA Vesicular acetylcholine transporter OS=Torpedo californica PE=2 SV=2 35 211 6.0E-10
sp|Q91498|VACHT_TORMA Vesicular acetylcholine transporter OS=Torpedo marmorata PE=2 SV=2 35 211 8.0E-10
sp|O17444|VACHT_DROME Vesicular acetylcholine transporter OS=Drosophila melanogaster GN=VAChT PE=2 SV=2 35 216 5.0E-09
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 31 192 6.0E-08
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 31 192 6.0E-08
sp|D3Z5L6|S18B1_MOUSE MFS-type transporter SLC18B1 OS=Mus musculus GN=Slc18b1 PE=2 SV=2 44 193 2.0E-06
sp|Q6GIU7|NORA_STAAR Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MRSA252) GN=norA PE=3 SV=1 30 214 2.0E-06
sp|Q5HHX4|NORA_STAAC Quinolone resistance protein NorA OS=Staphylococcus aureus (strain COL) GN=norA PE=3 SV=1 30 214 3.0E-06
sp|Q6GBD5|NORA_STAAS Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MSSA476) GN=norA PE=3 SV=1 30 214 3.0E-06
sp|P0A0J6|NORA_STAAW Quinolone resistance protein NorA OS=Staphylococcus aureus (strain MW2) GN=norA PE=3 SV=1 30 214 3.0E-06
sp|P0A0J7|NORA_STAAU Quinolone resistance protein NorA OS=Staphylococcus aureus GN=norA PE=3 SV=1 30 214 3.0E-06
sp|P0A0J5|NORA_STAAN Quinolone resistance protein NorA OS=Staphylococcus aureus (strain N315) GN=norA PE=3 SV=1 30 214 3.0E-06
sp|P0A0J4|NORA_STAAM Quinolone resistance protein NorA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=norA PE=3 SV=1 30 214 3.0E-06
sp|P9WJX6|Y191_MYCTO Uncharacterized MFS-type transporter MT0201 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0201 PE=3 SV=1 69 188 4.0E-06
sp|O34724|YCEJ_BACSU Uncharacterized MFS-type transporter YceJ OS=Bacillus subtilis (strain 168) GN=yceJ PE=3 SV=1 69 197 4.0E-06
sp|P9WJX7|Y191_MYCTU Uncharacterized MFS-type transporter Rv0191 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0191 PE=3 SV=1 69 188 4.0E-06
sp|Q6NT16|S18B1_HUMAN MFS-type transporter SLC18B1 OS=Homo sapiens GN=SLC18B1 PE=1 SV=1 5 192 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 34 56 22
2 69 91 22
3 103 125 22
4 130 147 17
5 160 182 22
6 187 209 22
7 332 354 22
8 358 377 19
9 384 406 22
10 421 443 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009040
MASTGSSSPGSVKSHPSRPPWGHRWRSSYWFTTYVVGLGVAVDVIVYSIIIPVIPFQLEHLGYTGISALSGWLLF
AYSGGLLISTIPIALWSEHYNARKYPMIFGLFALAGSQIMFMEAPTYAVMCVARVIQGISSSIVWVVGLAFLCEA
TPPEIIGRQMGIAMAGLSFGLVLAPPIGGVLYSRFGFRGPFVFALSAAFLDGVSRFIVIEPKEAMKWIPVPILRS
ENAELPDEAVQPDSKSGAEGKVQEIDREPDGPSPGSLRSGERNPLAGIEQVVEKPLPLLQVIVKLSRSSRALVAL
AISLVYGLVYSCQEPPLPLHLQSVWGLDAHQVGILLLALSVPMVFSSPLTGWLTDIFGAEWTATFSMLLATPWWG
VLTIDDSLALFGVAFALESFFTSGAISPLTAELAAVSRSMQGVGYAHIYAAFNIAYGIGTSVGPIIGGQMYDHIS
QGCFSLHWRKASTQKIVYCFEIMK*
Coding >AgabiH97|009040
ATGGCTAGCACGGGTTCTTCAAGTCCAGGGAGCGTCAAATCACATCCATCACGTCCACCTTGGGGCCATCGTTGG
AGATCCTCGTACTGGTTCACAACTTACGTCGTTGGCCTAGGAGTGGCGGTTGATGTCATCGTTTATTCTATCATT
ATACCTGTCATTCCGTTTCAATTGGAACATCTTGGATACACTGGTATTTCTGCCCTATCTGGATGGTTATTATTC
GCCTACTCGGGAGGTCTATTAATCTCCACAATTCCAATTGCTCTATGGTCAGAACACTACAATGCTCGTAAATAC
CCTATGATATTCGGTCTCTTTGCTCTTGCAGGCTCTCAAATCATGTTTATGGAAGCACCGACATATGCTGTCATG
TGTGTTGCTCGTGTAATTCAGGGTATCAGTTCTTCTATTGTATGGGTCGTCGGATTGGCCTTCCTCTGTGAAGCA
ACGCCGCCGGAAATAATTGGGAGACAAATGGGGATTGCTATGGCTGGCCTTTCGTTCGGCCTGGTGCTTGCGCCA
CCCATAGGGGGCGTTCTATACAGTCGCTTCGGTTTTCGAGGGCCTTTCGTTTTTGCGCTAAGCGCTGCTTTCCTT
GACGGAGTTTCTCGCTTCATCGTCATTGAACCAAAAGAAGCAATGAAGTGGATTCCGGTCCCCATTCTGCGATCA
GAGAACGCTGAGCTTCCTGATGAAGCAGTTCAACCTGATTCGAAGAGTGGCGCAGAGGGGAAAGTACAAGAGATT
GATCGTGAACCGGATGGTCCGTCCCCTGGGAGTCTCAGGTCTGGGGAAAGGAACCCTCTGGCTGGCATCGAGCAA
GTGGTCGAGAAACCCTTGCCTCTCCTTCAGGTGATCGTGAAGCTTTCGAGATCGTCTCGGGCTCTGGTAGCCCTG
GCTATCTCTCTCGTTTATGGATTAGTGTACAGCTGCCAAGAACCTCCGTTACCCCTCCACCTCCAGTCGGTCTGG
GGGTTGGATGCTCACCAGGTCGGAATTTTGTTGTTGGCCCTTTCCGTACCAATGGTATTTTCTTCCCCCTTGACA
GGGTGGCTGACAGATATTTTTGGAGCAGAATGGACAGCAACCTTCTCGATGCTCCTTGCAACTCCCTGGTGGGGA
GTATTGACCATCGATGACTCGCTCGCTCTATTTGGGGTGGCTTTCGCCTTGGAGAGTTTCTTCACTTCGGGAGCT
ATTTCTCCACTGACTGCCGAACTCGCCGCAGTTTCGAGAAGTATGCAGGGTGTTGGCTATGCTCACATTTACGCC
GCCTTTAACATTGCATACGGCATTGGTACCAGCGTTGGCCCGATCATCGGCGGACAGATGTATGATCACATCTCA
CAGGGCTGCTTTTCCCTTCACTGGAGAAAGGCCTCTACTCAAAAGATTGTGTACTGTTTTGAAATTATGAAGTAA
Transcript >AgabiH97|009040
ATGGCTAGCACGGGTTCTTCAAGTCCAGGGAGCGTCAAATCACATCCATCACGTCCACCTTGGGGCCATCGTTGG
AGATCCTCGTACTGGTTCACAACTTACGTCGTTGGCCTAGGAGTGGCGGTTGATGTCATCGTTTATTCTATCATT
ATACCTGTCATTCCGTTTCAATTGGAACATCTTGGATACACTGGTATTTCTGCCCTATCTGGATGGTTATTATTC
GCCTACTCGGGAGGTCTATTAATCTCCACAATTCCAATTGCTCTATGGTCAGAACACTACAATGCTCGTAAATAC
CCTATGATATTCGGTCTCTTTGCTCTTGCAGGCTCTCAAATCATGTTTATGGAAGCACCGACATATGCTGTCATG
TGTGTTGCTCGTGTAATTCAGGGTATCAGTTCTTCTATTGTATGGGTCGTCGGATTGGCCTTCCTCTGTGAAGCA
ACGCCGCCGGAAATAATTGGGAGACAAATGGGGATTGCTATGGCTGGCCTTTCGTTCGGCCTGGTGCTTGCGCCA
CCCATAGGGGGCGTTCTATACAGTCGCTTCGGTTTTCGAGGGCCTTTCGTTTTTGCGCTAAGCGCTGCTTTCCTT
GACGGAGTTTCTCGCTTCATCGTCATTGAACCAAAAGAAGCAATGAAGTGGATTCCGGTCCCCATTCTGCGATCA
GAGAACGCTGAGCTTCCTGATGAAGCAGTTCAACCTGATTCGAAGAGTGGCGCAGAGGGGAAAGTACAAGAGATT
GATCGTGAACCGGATGGTCCGTCCCCTGGGAGTCTCAGGTCTGGGGAAAGGAACCCTCTGGCTGGCATCGAGCAA
GTGGTCGAGAAACCCTTGCCTCTCCTTCAGGTGATCGTGAAGCTTTCGAGATCGTCTCGGGCTCTGGTAGCCCTG
GCTATCTCTCTCGTTTATGGATTAGTGTACAGCTGCCAAGAACCTCCGTTACCCCTCCACCTCCAGTCGGTCTGG
GGGTTGGATGCTCACCAGGTCGGAATTTTGTTGTTGGCCCTTTCCGTACCAATGGTATTTTCTTCCCCCTTGACA
GGGTGGCTGACAGATATTTTTGGAGCAGAATGGACAGCAACCTTCTCGATGCTCCTTGCAACTCCCTGGTGGGGA
GTATTGACCATCGATGACTCGCTCGCTCTATTTGGGGTGGCTTTCGCCTTGGAGAGTTTCTTCACTTCGGGAGCT
ATTTCTCCACTGACTGCCGAACTCGCCGCAGTTTCGAGAAGTATGCAGGGTGTTGGCTATGCTCACATTTACGCC
GCCTTTAACATTGCATACGGCATTGGTACCAGCGTTGGCCCGATCATCGGCGGACAGATGTATGATCACATCTCA
CAGGGCTGCTTTTCCCTTCACTGGAGAAAGGCCTCTACTCAAAAGATTGTGTACTGTTTTGAAATTATGAAGTAA
Gene >AgabiH97|009040
ATGGCTAGCACGGGTTCTTCAAGTCCAGGGAGCGTCAAATCACATCCATCACGTCCACCTTGGGGCCATCGTTGG
AGATCCTCGTACTGGTTCACAACTTACGTCGTTGGCCTAGGTAGGCATGCTGTACATGATGTACGCCCGACGGTT
ATCGACTGATGATTGCACAAACAGGAGTGGCGGTTGATGTCATCGTTTATTCTATCATTATACCTGTCATTCCGT
TTCAATTGGAACATCTTGGATACACTGGTATTTCTGCCCTATCTGGATGGTTATTATTCGCCTACGTGAATTGCC
TTTTTTCCCTGGCTCCGAGTCATGTTTTCTCATTGTACTCTCTTTGATAAATTAAGTCGGGAGGTCTATTAATCT
GTGAGTGGTCGCCATCGTTTCGTTCCCATTCCGTTGATAGCTCATATAATCGTGTAAGCCACAATTCCAATTGCT
CTATGGTCAGAACACTACAATGCTCGTAAATACCCTATGATATTCGGTCTCTTTGCTCTTGCAGGCTCTCAAATC
ATGTTTATGGAAGCACCGACATATGCTGTCATGTGTGTTGCTCGTGTAATTCAGGGTATCAGTTCTTCTATTGTA
TGGGTCGTCGGATTGGCCTTCCTGTATGTTGCCGATATCGAAGCTGTGAAAGCAGTGCAACTAATAATCCGCACA
GCTGTGAAGCAACGCCGCCGGAAATAATTGGGAGTTCGTCTATTATTACTATCTGTTCTCTTCTTGTCGGCTTGA
CTGTCTGTTTTCAGGACAAATGGGGATTGCTATGGCTGGCCTTTCGTTCGGGTAGGTGAAATCTTCCTTCCCGTT
GCTCCTAGTCTCCTTCGACTTAATGACATGACTATTTCACAGCCTGGTGCTTGCGCCACCCATAGGGGGCGTTCT
ATACAGTCGCTTCGGTTTTCGAGGGCCTTTCGTTTTTGCGCTAAGCGCTGCTTTCCTTGACGGAGTTTCTCGCTT
CATCGTCATTGAACCAAAAGAAGCAATGAAGTGGATTCCGGTCCCCATTCTGCGATCAGAGAACGCTGAGCTTCC
TGATGAAGCAGTTCAACCTGATTCGAAGAGTGGCGCAGAGGGGAAAGTACAAGAGATTGATCGTGAACCGGATGG
TCCGTCCCCTGGGAGTCTCAGGTCTGGGGAAAGGAACCCTCTGGCTGGCATCGAGCAAGTGGTCGAGAAACCCTT
GCCTCTCCTTCAGGTGATCGTGAAGCTTTCGAGATCGTCTCGGGCTCTGGTAGCCCTGGCTATCTCTCTCGTTTA
TGGGTATGTTGCAGGTCGAGAATTTGGACCCGCCTTCTGATACTATGGCAGATTAGTGTACAGCTGCCAAGAACC
TCCGTTACCCCTCCACCTCCAGTCGGTCTGGGGGTTGGATGCTCACCAGGTCGGAATTTTGTTGTTGGCCCTTTC
CGTACCAATGGTATTTTGTAAGTATATTGTGTAGTGCCCGTTTGCGAAATAAACTAAACTTCTGCCCAGCTTCCC
CCTTGACAGGGTGGCTGACAGATATTTTTGGAGCAGAATGGACAGCAACCTTCTCGATGCTCCTTGCAACTCCCT
GGTGGGGAGTATTGACCATCGATGACTCGCTCGCTCTATTTGGGGTGGCTTTCGCCTTGGAGAGTAGGTAATCCT
TAGGTATAGAAGACATCTAATTTACATAGGGCTCTCCAGGTTTCTTCACTTCGGGAGCTATTTCTCCACTGACTG
CCGAACTCGCCGCAGTTTCGAGAAGTATGCAGGGTGTTGGCTGTATGTCTTCCTAGCTGTTGACTTTTCTTCCCA
TAAACTTATTTCATTGTGAAGATGCTCACATTTACGCCGCCTTTAACATTGCATACGGCATTGGTACCAGCGGTG
AGTCCCTGAGGCATCGTAAGATGATCTAAAGGTTGATTTAAATATAATTTTTAGTTGGCCCGATCATCGGCGGAC
AGGTGAGCTGTTTCAGCGTTTCGACAGAAACAAGTTCCCTCAGGTTGCTTTTGAAGATGTATGATCACATCTCAC
AGGGCTGGTTTGCGATATGTATGTTTGACTTAGCGATGTTATTGCTTTCGGTTTTGTTAGCTTTTCCCTTCACTG
GAGAAAGGCCTCTACTCAAAAGATTGTGTACTGTTTTGAAATTATGAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail