Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|009010
Gene name
Locationscaffold_1:2120668..2121139
Strand+
Gene length (bp)471
Transcript length (bp)420
Coding sequence length (bp)420
Protein length (aa) 140

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05047 L51_S25_CI-B8 Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain 1.1E-08 42 90

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUC8|RM51_SCHPO 54S ribosomal protein L51, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrpl51 PE=3 SV=1 11 130 2.0E-20
sp|Q06090|RM51_YEAST 54S ribosomal protein L51, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPL51 PE=1 SV=1 15 134 3.0E-15
sp|Q758S3|RM51_ASHGO 54S ribosomal protein L51, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRPL51 PE=3 SV=1 15 135 2.0E-14
sp|Q95KE5|RM43_BOVIN 39S ribosomal protein L43, mitochondrial OS=Bos taurus GN=MRPL43 PE=2 SV=2 15 129 3.0E-07
sp|Q99N89|RM43_MOUSE 39S ribosomal protein L43, mitochondrial OS=Mus musculus GN=Mrpl43 PE=1 SV=1 15 130 1.0E-06

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2734 0.157 0.0159 0.1036 0.9593 0.0243 0.0297 0.044 0.0428 0.0093

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup3246
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|009010
Agaricus bisporus var bisporus H97 AgabiH97|009010 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|42_49

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|009010
MQPLLRAALRSRPANGHTTFLPQIRKLVFEYCDKWPSSHNTRTFLCTRLQDLARENPHLELVVKQRNHKEPIVRG
FYVNNRDKVVPLNSLEVTAIQQKIRLLLDASGAKIKPLKRRPVESTTESPRGIWSGLHADRPIL*
Coding >AgabiH97|009010
ATGCAGCCCCTCCTCCGCGCCGCCCTCCGCTCAAGGCCCGCCAACGGCCACACCACTTTCCTACCCCAGATCAGG
AAACTCGTCTTTGAGTATTGCGACAAGTGGCCCTCCTCCCACAACACCCGCACCTTTCTCTGCACCCGCCTCCAG
GACCTTGCCCGCGAAAACCCCCATCTCGAGCTTGTCGTCAAACAGCGCAATCACAAGGAGCCCATCGTCCGCGGT
TTCTATGTCAACAACCGCGATAAAGTCGTCCCCCTCAACAGCCTAGAAGTCACCGCAATCCAACAAAAAATCCGC
CTCTTACTCGACGCGTCGGGCGCAAAAATTAAACCCCTCAAGCGCAGACCCGTAGAGAGCACTACAGAATCCCCC
AGAGGCATATGGAGTGGTCTCCACGCCGACCGGCCTATTCTATGA
Transcript >AgabiH97|009010
ATGCAGCCCCTCCTCCGCGCCGCCCTCCGCTCAAGGCCCGCCAACGGCCACACCACTTTCCTACCCCAGATCAGG
AAACTCGTCTTTGAGTATTGCGACAAGTGGCCCTCCTCCCACAACACCCGCACCTTTCTCTGCACCCGCCTCCAG
GACCTTGCCCGCGAAAACCCCCATCTCGAGCTTGTCGTCAAACAGCGCAATCACAAGGAGCCCATCGTCCGCGGT
TTCTATGTCAACAACCGCGATAAAGTCGTCCCCCTCAACAGCCTAGAAGTCACCGCAATCCAACAAAAAATCCGC
CTCTTACTCGACGCGTCGGGCGCAAAAATTAAACCCCTCAAGCGCAGACCCGTAGAGAGCACTACAGAATCCCCC
AGAGGCATATGGAGTGGTCTCCACGCCGACCGGCCTATTCTATGA
Gene >AgabiH97|009010
ATGCAGCCCCTCCTCCGCGCCGCCCTCCGCTCAAGGCCCGCCAACGGCCACACCACTTTCCTACCCCAGATCAGG
AAACTCGTCTTTGAGTATTGCGACAAGTGGCCCTCCTCCCACAACACCCGCACCTTTCTCTGCACCCGCCTCCAG
GACCTTGCCCGCGAAAACCCCCATCTCGAGCTTGTCGTCAAACAGCGCAATCACAAGGAGCCCATCGTCCGCGGT
TTCTATGGCGCGTACTTTTCATTTGTTGCACATATCATCACGCTCATCCCCGCCTCAGTCAACAACCGCGATAAA
GTCGTCCCCCTCAACAGCCTAGAAGTCACCGCAATCCAACAAAAAATCCGCCTCTTACTCGACGCGTCGGGCGCA
AAAATTAAACCCCTCAAGCGCAGACCCGTAGAGAGCACTACAGAATCCCCCAGAGGCATATGGAGTGGTCTCCAC
GCCGACCGGCCTATTCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail