© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|008990 |
| Gene name | |
| Location | scaffold_1:2116831..2118019 |
| Strand | - |
| Gene length (bp) | 1188 |
| Transcript length (bp) | 1074 |
| Coding sequence length (bp) | 1074 |
| Protein length (aa) | 358 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00288 | GHMP_kinases_N | GHMP kinases N terminal domain | 1.3E-08 | 93 | 153 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P17423|KHSE_YEAST | Homoserine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THR1 PE=1 SV=4 | 5 | 354 | 2.0E-135 |
| sp|Q92209|KHSE_CANAL | Homoserine kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=THR1 PE=3 SV=2 | 5 | 345 | 4.0E-126 |
| sp|O43056|KHSE_SCHPO | Probable homoserine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4C3.03 PE=3 SV=1 | 4 | 343 | 3.0E-113 |
| sp|Q02AL5|KHSE_SOLUE | Homoserine kinase OS=Solibacter usitatus (strain Ellin6076) GN=thrB PE=3 SV=1 | 5 | 332 | 3.0E-47 |
| sp|B8CW89|KHSE_HALOH | Homoserine kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=thrB PE=3 SV=1 | 5 | 325 | 3.0E-47 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P17423|KHSE_YEAST | Homoserine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THR1 PE=1 SV=4 | 5 | 354 | 2.0E-135 |
| sp|Q92209|KHSE_CANAL | Homoserine kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=THR1 PE=3 SV=2 | 5 | 345 | 4.0E-126 |
| sp|O43056|KHSE_SCHPO | Probable homoserine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4C3.03 PE=3 SV=1 | 4 | 343 | 3.0E-113 |
| sp|Q02AL5|KHSE_SOLUE | Homoserine kinase OS=Solibacter usitatus (strain Ellin6076) GN=thrB PE=3 SV=1 | 5 | 332 | 3.0E-47 |
| sp|B8CW89|KHSE_HALOH | Homoserine kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=thrB PE=3 SV=1 | 5 | 325 | 3.0E-47 |
| sp|O67332|KHSE_AQUAE | Homoserine kinase OS=Aquifex aeolicus (strain VF5) GN=thrB PE=3 SV=1 | 7 | 330 | 2.0E-44 |
| sp|A5I2A9|KHSE_CLOBH | Homoserine kinase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thrB PE=3 SV=1 | 7 | 351 | 4.0E-44 |
| sp|A7FUE5|KHSE_CLOB1 | Homoserine kinase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thrB PE=3 SV=1 | 7 | 351 | 4.0E-44 |
| sp|C0QQC5|KHSE_PERMH | Homoserine kinase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=thrB PE=3 SV=1 | 7 | 345 | 6.0E-44 |
| sp|Q67LA5|KHSE_SYMTH | Homoserine kinase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=thrB PE=3 SV=1 | 7 | 332 | 2.0E-43 |
| sp|A7GDW6|KHSE_CLOBL | Homoserine kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thrB PE=3 SV=1 | 7 | 315 | 3.0E-43 |
| sp|B1ILR0|KHSE_CLOBK | Homoserine kinase OS=Clostridium botulinum (strain Okra / Type B1) GN=thrB PE=3 SV=1 | 7 | 315 | 5.0E-43 |
| sp|A4XI71|KHSE_CALS8 | Homoserine kinase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=thrB PE=3 SV=1 | 6 | 343 | 2.0E-42 |
| sp|C1FNA5|KHSE_CLOBJ | Homoserine kinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thrB PE=3 SV=1 | 7 | 315 | 2.0E-42 |
| sp|B1KS25|KHSE_CLOBM | Homoserine kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thrB PE=3 SV=1 | 7 | 315 | 1.0E-41 |
| sp|C3KW44|KHSE_CLOB6 | Homoserine kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thrB PE=3 SV=1 | 7 | 315 | 1.0E-41 |
| sp|B9ML57|KHSE_CALBD | Homoserine kinase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=thrB PE=3 SV=1 | 6 | 343 | 8.0E-41 |
| sp|Q117D0|KHSE_TRIEI | Homoserine kinase OS=Trichodesmium erythraeum (strain IMS101) GN=thrB PE=3 SV=1 | 6 | 315 | 4.0E-40 |
| sp|P04947|KHSE_MICDP | Homoserine kinase OS=Microchaete diplosiphon GN=thrB PE=3 SV=1 | 10 | 354 | 5.0E-40 |
| sp|Q3M9C9|KHSE_ANAVT | Homoserine kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=thrB PE=3 SV=1 | 10 | 315 | 1.0E-39 |
| sp|B1XLE7|KHSE_SYNP2 | Homoserine kinase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=thrB PE=3 SV=1 | 7 | 317 | 2.0E-39 |
| sp|B2J7E8|KHSE_NOSP7 | Homoserine kinase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=thrB PE=3 SV=1 | 6 | 335 | 6.0E-39 |
| sp|Q2RIX1|KHSE_MOOTA | Homoserine kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=thrB PE=3 SV=1 | 7 | 343 | 1.0E-38 |
| sp|B2UX33|KHSE_CLOBA | Homoserine kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=thrB PE=3 SV=1 | 7 | 345 | 2.0E-38 |
| sp|Q7VBM6|KHSE_PROMA | Homoserine kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=thrB PE=3 SV=1 | 4 | 318 | 3.0E-38 |
| sp|Q5N5W2|KHSE_SYNP6 | Homoserine kinase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=thrB PE=3 SV=1 | 4 | 357 | 4.0E-38 |
| sp|Q31N99|KHSE_SYNE7 | Homoserine kinase OS=Synechococcus elongatus (strain PCC 7942) GN=thrB PE=3 SV=1 | 4 | 357 | 4.0E-38 |
| sp|A9BGN7|KHSE_PETMO | Homoserine kinase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=thrB PE=3 SV=1 | 7 | 331 | 4.0E-38 |
| sp|P73646|KHSE_SYNY3 | Homoserine kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=thrB PE=3 SV=1 | 4 | 316 | 5.0E-38 |
| sp|A4QDE5|KHSE_CORGB | Homoserine kinase OS=Corynebacterium glutamicum (strain R) GN=thrB PE=3 SV=1 | 4 | 328 | 5.0E-38 |
| sp|Q8FQ44|KHSE_COREF | Homoserine kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thrB PE=3 SV=1 | 4 | 328 | 6.0E-38 |
| sp|P07128|KHSE_CORGL | Homoserine kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=thrB PE=1 SV=4 | 4 | 328 | 8.0E-38 |
| sp|B2TPC7|KHSE_CLOBB | Homoserine kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=thrB PE=3 SV=1 | 7 | 345 | 2.0E-37 |
| sp|A6LSZ4|KHSE_CLOB8 | Homoserine kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=thrB PE=3 SV=1 | 6 | 353 | 3.0E-37 |
| sp|A5CQ46|KHSE_CLAM3 | Homoserine kinase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=thrB PE=3 SV=1 | 4 | 317 | 7.0E-37 |
| sp|B8FU92|KHSE_DESHD | Homoserine kinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=thrB PE=3 SV=1 | 7 | 325 | 2.0E-36 |
| sp|Q46LV5|KHSE_PROMT | Homoserine kinase OS=Prochlorococcus marinus (strain NATL2A) GN=thrB PE=3 SV=1 | 7 | 321 | 2.0E-36 |
| sp|Q0AXC8|KHSE_SYNWW | Homoserine kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=thrB PE=3 SV=1 | 5 | 343 | 4.0E-36 |
| sp|Q4JUI5|KHSE_CORJK | Homoserine kinase OS=Corynebacterium jeikeium (strain K411) GN=thrB PE=3 SV=1 | 4 | 328 | 5.0E-36 |
| sp|Q24XU1|KHSE_DESHY | Homoserine kinase OS=Desulfitobacterium hafniense (strain Y51) GN=thrB PE=3 SV=1 | 7 | 325 | 5.0E-36 |
| sp|A2C153|KHSE_PROM1 | Homoserine kinase OS=Prochlorococcus marinus (strain NATL1A) GN=thrB PE=3 SV=1 | 7 | 321 | 5.0E-36 |
| sp|Q8R711|KHSE_CALS4 | Homoserine kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=thrB PE=3 SV=1 | 7 | 317 | 7.0E-36 |
| sp|Q6AG73|KHSE_LEIXX | Homoserine kinase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=thrB PE=3 SV=1 | 7 | 333 | 2.0E-35 |
| sp|A8EWD5|KHSE_ARCB4 | Homoserine kinase OS=Arcobacter butzleri (strain RM4018) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-35 |
| sp|B1WP79|KHSE_CYAA5 | Homoserine kinase OS=Cyanothece sp. (strain ATCC 51142) GN=thrB PE=3 SV=1 | 15 | 351 | 3.0E-35 |
| sp|C3PFP1|KHSE_CORA7 | Homoserine kinase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=thrB PE=3 SV=1 | 3 | 328 | 5.0E-35 |
| sp|Q6NHU3|KHSE_CORDI | Homoserine kinase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=thrB PE=3 SV=1 | 4 | 328 | 9.0E-35 |
| sp|B1VFW6|KHSE_CORU7 | Homoserine kinase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=thrB PE=3 SV=1 | 4 | 328 | 1.0E-34 |
| sp|Q7NLJ6|KHSE_GLOVI | Homoserine kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=thrB PE=3 SV=1 | 6 | 318 | 1.0E-34 |
| sp|Q8DI27|KHSE_THEEB | Homoserine kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=thrB PE=3 SV=1 | 7 | 345 | 1.0E-34 |
| sp|Q7U659|KHSE_SYNPX | Homoserine kinase OS=Synechococcus sp. (strain WH8102) GN=thrB PE=3 SV=1 | 4 | 318 | 2.0E-34 |
| sp|Q3AAV5|KHSE_CARHZ | Homoserine kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=thrB PE=3 SV=1 | 1 | 319 | 2.0E-34 |
| sp|A2BVQ8|KHSE_PROM5 | Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9515) GN=thrB PE=3 SV=1 | 4 | 329 | 2.0E-34 |
| sp|Q891L4|KHSE_CLOTE | Homoserine kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=thrB PE=3 SV=2 | 7 | 355 | 3.0E-34 |
| sp|A8G3W1|KHSE_PROM2 | Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9215) GN=thrB PE=3 SV=1 | 4 | 318 | 4.0E-34 |
| sp|A5GSI7|KHSE_SYNR3 | Homoserine kinase OS=Synechococcus sp. (strain RCC307) GN=thrB PE=3 SV=1 | 7 | 337 | 5.0E-34 |
| sp|A6TKS7|KHSE_ALKMQ | Homoserine kinase OS=Alkaliphilus metalliredigens (strain QYMF) GN=thrB PE=3 SV=1 | 7 | 347 | 5.0E-34 |
| sp|Q3AKU3|KHSE_SYNSC | Homoserine kinase OS=Synechococcus sp. (strain CC9605) GN=thrB PE=3 SV=1 | 4 | 315 | 7.0E-34 |
| sp|Q8YZV9|KHSE_NOSS1 | Homoserine kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=thrB PE=3 SV=2 | 10 | 334 | 8.0E-34 |
| sp|Q30SS8|KHSE_SULDN | Homoserine kinase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=thrB PE=3 SV=1 | 6 | 315 | 1.0E-33 |
| sp|C4LJM9|KHSE_CORK4 | Homoserine kinase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=thrB PE=3 SV=1 | 6 | 322 | 1.0E-33 |
| sp|A3PBW9|KHSE_PROM0 | Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9301) GN=thrB PE=3 SV=1 | 4 | 315 | 1.0E-33 |
| sp|A5GJT4|KHSE_SYNPW | Homoserine kinase OS=Synechococcus sp. (strain WH7803) GN=thrB PE=3 SV=1 | 7 | 318 | 1.0E-33 |
| sp|Q0I8Z9|KHSE_SYNS3 | Homoserine kinase OS=Synechococcus sp. (strain CC9311) GN=thrB PE=3 SV=1 | 7 | 318 | 1.0E-33 |
| sp|Q7M7X6|KHSE_WOLSU | Homoserine kinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=thrB PE=3 SV=1 | 6 | 327 | 2.0E-33 |
| sp|Q3AYC9|KHSE_SYNS9 | Homoserine kinase OS=Synechococcus sp. (strain CC9902) GN=thrB PE=3 SV=1 | 4 | 318 | 2.0E-33 |
| sp|A5N6I0|KHSE_CLOK5 | Homoserine kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=thrB PE=3 SV=1 | 4 | 315 | 3.0E-33 |
| sp|Q31BT9|KHSE_PROM9 | Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9312) GN=thrB PE=3 SV=1 | 4 | 315 | 3.0E-33 |
| sp|C1AW13|KHSE_RHOOB | Homoserine kinase OS=Rhodococcus opacus (strain B4) GN=thrB PE=3 SV=1 | 6 | 320 | 3.0E-33 |
| sp|Q7V289|KHSE_PROMP | Homoserine kinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=thrB PE=3 SV=1 | 4 | 318 | 5.0E-33 |
| sp|A7GNV5|KHSE_BACCN | Homoserine kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=thrB PE=3 SV=1 | 5 | 351 | 8.0E-33 |
| sp|Q97JN8|KHSE_CLOAB | Homoserine kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thrB PE=3 SV=1 | 7 | 345 | 3.0E-32 |
| sp|B7HNB7|KHSE_BACC7 | Homoserine kinase OS=Bacillus cereus (strain AH187) GN=thrB PE=3 SV=1 | 6 | 346 | 5.0E-32 |
| sp|B1MYF2|KHSE_LEUCK | Homoserine kinase OS=Leuconostoc citreum (strain KM20) GN=thrB PE=3 SV=1 | 7 | 316 | 5.0E-32 |
| sp|Q9RRU5|KHSE_DEIRA | Homoserine kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=thrB PE=3 SV=1 | 5 | 315 | 6.0E-32 |
| sp|B7HJ93|KHSE_BACC4 | Homoserine kinase OS=Bacillus cereus (strain B4264) GN=thrB PE=3 SV=1 | 5 | 341 | 9.0E-32 |
| sp|Q9K7E4|KHSE_BACHD | Homoserine kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thrB PE=3 SV=1 | 1 | 338 | 1.0E-31 |
| sp|Q7V8D0|KHSE_PROMM | Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9313) GN=thrB PE=3 SV=1 | 4 | 315 | 2.0E-31 |
| sp|Q63CI8|KHSE_BACCZ | Homoserine kinase OS=Bacillus cereus (strain ZK / E33L) GN=thrB PE=3 SV=1 | 6 | 346 | 2.0E-31 |
| sp|A8MI61|KHSE_ALKOO | Homoserine kinase OS=Alkaliphilus oremlandii (strain OhILAs) GN=thrB PE=3 SV=1 | 7 | 340 | 2.0E-31 |
| sp|C1A1Z3|KHSE_RHOE4 | Homoserine kinase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=thrB PE=3 SV=1 | 4 | 328 | 2.0E-31 |
| sp|Q81EK4|KHSE_BACCR | Homoserine kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=thrB PE=3 SV=1 | 6 | 341 | 3.0E-31 |
| sp|A2CAU0|KHSE_PROM3 | Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9303) GN=thrB PE=3 SV=1 | 4 | 315 | 3.0E-31 |
| sp|Q7VHF4|KHSE_HELHP | Homoserine kinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=thrB PE=3 SV=1 | 6 | 288 | 5.0E-31 |
| sp|A9VQT3|KHSE_BACWK | Homoserine kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=thrB PE=3 SV=1 | 7 | 346 | 6.0E-31 |
| sp|C1ER94|KHSE_BACC3 | Homoserine kinase OS=Bacillus cereus (strain 03BB102) GN=thrB PE=3 SV=1 | 6 | 346 | 6.0E-31 |
| sp|A0RCX4|KHSE_BACAH | Homoserine kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=thrB PE=3 SV=1 | 6 | 346 | 6.0E-31 |
| sp|B9IXW1|KHSE_BACCQ | Homoserine kinase OS=Bacillus cereus (strain Q1) GN=thrB PE=3 SV=1 | 6 | 346 | 1.0E-30 |
| sp|Q8ET01|KHSE_OCEIH | Homoserine kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=thrB PE=3 SV=1 | 5 | 319 | 2.0E-30 |
| sp|A0ALN0|KHSE_LISW6 | Homoserine kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=thrB PE=3 SV=1 | 7 | 347 | 2.0E-30 |
| sp|Q6HJZ3|KHSE_BACHK | Homoserine kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=thrB PE=3 SV=1 | 6 | 346 | 2.0E-30 |
| sp|B7JKG2|KHSE_BACC0 | Homoserine kinase OS=Bacillus cereus (strain AH820) GN=thrB PE=3 SV=1 | 6 | 346 | 2.0E-30 |
| sp|B1HYT4|KHSE_LYSSC | Homoserine kinase OS=Lysinibacillus sphaericus (strain C3-41) GN=thrB PE=3 SV=1 | 1 | 315 | 3.0E-30 |
| sp|Q81RS0|KHSE_BACAN | Homoserine kinase OS=Bacillus anthracis GN=thrB PE=3 SV=1 | 6 | 346 | 4.0E-30 |
| sp|C3L5M2|KHSE_BACAC | Homoserine kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=thrB PE=3 SV=1 | 6 | 346 | 4.0E-30 |
| sp|C3P7F5|KHSE_BACAA | Homoserine kinase OS=Bacillus anthracis (strain A0248) GN=thrB PE=3 SV=1 | 6 | 346 | 4.0E-30 |
| sp|B7IT85|KHSE_BACC2 | Homoserine kinase OS=Bacillus cereus (strain G9842) GN=thrB PE=3 SV=1 | 6 | 341 | 5.0E-30 |
| sp|Q739T5|KHSE_BACC1 | Homoserine kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=thrB PE=3 SV=1 | 6 | 339 | 5.0E-30 |
| sp|Q8DZI2|KHSE_STRA5 | Homoserine kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=thrB PE=3 SV=1 | 7 | 321 | 6.0E-30 |
| sp|Q8Y4A6|KHSE_LISMO | Homoserine kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=thrB PE=1 SV=1 | 7 | 347 | 8.0E-30 |
| sp|Q88Z08|KHSE_LACPL | Homoserine kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=thrB PE=3 SV=1 | 6 | 319 | 8.0E-30 |
| sp|Q5WDT6|KHSE_BACSK | Homoserine kinase OS=Bacillus clausii (strain KSM-K16) GN=thrB PE=3 SV=1 | 5 | 319 | 9.0E-30 |
| sp|A8AWE1|KHSE_STRGC | Homoserine kinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=thrB PE=3 SV=1 | 7 | 316 | 1.0E-29 |
| sp|Q927U8|KHSE_LISIN | Homoserine kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=thrB PE=3 SV=1 | 7 | 347 | 1.0E-29 |
| sp|B8DBG4|KHSE_LISMH | Homoserine kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=thrB PE=3 SV=1 | 7 | 347 | 2.0E-29 |
| sp|Q82J66|KHSE_STRAW | Homoserine kinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-29 |
| sp|A7ZC67|KHSE_CAMC1 | Homoserine kinase OS=Campylobacter concisus (strain 13826) GN=thrB PE=3 SV=1 | 6 | 316 | 2.0E-29 |
| sp|B9DP91|KHSE_STACT | Homoserine kinase OS=Staphylococcus carnosus (strain TM300) GN=thrB PE=3 SV=1 | 1 | 315 | 2.0E-29 |
| sp|A0Q3H1|KHSE_CLONN | Homoserine kinase OS=Clostridium novyi (strain NT) GN=thrB PE=3 SV=1 | 7 | 315 | 2.0E-29 |
| sp|Q8E546|KHSE_STRA3 | Homoserine kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=thrB PE=3 SV=1 | 7 | 321 | 3.0E-29 |
| sp|Q3K0X8|KHSE_STRA1 | Homoserine kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=thrB PE=3 SV=1 | 7 | 321 | 3.0E-29 |
| sp|Q71WN3|KHSE_LISMF | Homoserine kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=thrB PE=3 SV=1 | 7 | 347 | 3.0E-29 |
| sp|B2A8C9|KHSE_NATTJ | Homoserine kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=thrB PE=3 SV=1 | 7 | 312 | 3.0E-29 |
| sp|C1KYW2|KHSE_LISMC | Homoserine kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=thrB PE=3 SV=1 | 7 | 347 | 4.0E-29 |
| sp|Q9ZM48|KHSE_HELPJ | Homoserine kinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=thrB PE=3 SV=1 | 7 | 316 | 1.0E-28 |
| sp|A6QBQ7|KHSE_SULNB | Homoserine kinase OS=Sulfurovum sp. (strain NBC37-1) GN=thrB PE=3 SV=1 | 7 | 333 | 2.0E-28 |
| sp|O25690|KHSE_HELPY | Homoserine kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=thrB PE=3 SV=1 | 7 | 316 | 5.0E-28 |
| sp|B1MLU6|KHSE_MYCA9 | Homoserine kinase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=thrB PE=3 SV=1 | 6 | 317 | 6.0E-28 |
| sp|Q2YXT6|KHSE_STAAB | Homoserine kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=thrB PE=3 SV=1 | 7 | 316 | 7.0E-28 |
| sp|Q02Z13|KHSE_LACLS | Homoserine kinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=thrB PE=3 SV=1 | 7 | 315 | 1.0E-27 |
| sp|A8Z213|KHSE_STAAT | Homoserine kinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-27 |
| sp|A6QGN2|KHSE_STAAE | Homoserine kinase OS=Staphylococcus aureus (strain Newman) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-27 |
| sp|Q5HG90|KHSE_STAAC | Homoserine kinase OS=Staphylococcus aureus (strain COL) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-27 |
| sp|Q2FYV2|KHSE_STAA8 | Homoserine kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-27 |
| sp|Q2FHA3|KHSE_STAA3 | Homoserine kinase OS=Staphylococcus aureus (strain USA300) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-27 |
| sp|Q6A8B2|KHSE_PROAC | Homoserine kinase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=thrB PE=3 SV=1 | 1 | 317 | 4.0E-27 |
| sp|Q8NWV8|KHSE_STAAW | Homoserine kinase OS=Staphylococcus aureus (strain MW2) GN=thrB PE=3 SV=1 | 7 | 316 | 6.0E-27 |
| sp|Q6G9M8|KHSE_STAAS | Homoserine kinase OS=Staphylococcus aureus (strain MSSA476) GN=thrB PE=3 SV=1 | 7 | 316 | 6.0E-27 |
| sp|Q6GH76|KHSE_STAAR | Homoserine kinase OS=Staphylococcus aureus (strain MRSA252) GN=thrB PE=3 SV=1 | 7 | 316 | 6.0E-27 |
| sp|A7I3V2|KHSE_CAMHC | Homoserine kinase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=thrB PE=3 SV=1 | 7 | 288 | 7.0E-27 |
| sp|Q5Z0Z5|KHSE_NOCFA | Homoserine kinase OS=Nocardia farcinica (strain IFM 10152) GN=thrB PE=3 SV=1 | 6 | 322 | 8.0E-27 |
| sp|Q9ADB2|KHSE_STRCO | Homoserine kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=thrB PE=3 SV=1 | 7 | 316 | 9.0E-27 |
| sp|Q49XB7|KHSE_STAS1 | Homoserine kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=thrB PE=3 SV=1 | 7 | 315 | 1.0E-26 |
| sp|A6Q225|KHSE_NITSB | Homoserine kinase OS=Nitratiruptor sp. (strain SB155-2) GN=thrB PE=3 SV=1 | 7 | 354 | 2.0E-26 |
| sp|A3CMQ4|KHSE_STRSV | Homoserine kinase OS=Streptococcus sanguinis (strain SK36) GN=thrB PE=3 SV=1 | 7 | 325 | 2.0E-26 |
| sp|B9L6E6|KHSE_NAUPA | Homoserine kinase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-26 |
| sp|A2RKV6|KHSE_LACLM | Homoserine kinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=thrB PE=3 SV=1 | 7 | 345 | 2.0E-26 |
| sp|P52991|KHSE_LACLC | Homoserine kinase OS=Lactococcus lactis subsp. cremoris GN=thrB PE=3 SV=1 | 7 | 345 | 2.0E-26 |
| sp|Q8DUG4|KHSE_STRMU | Homoserine kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=thrB PE=3 SV=1 | 7 | 353 | 3.0E-26 |
| sp|P65229|KHSE_STAAN | Homoserine kinase OS=Staphylococcus aureus (strain N315) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-26 |
| sp|P65228|KHSE_STAAM | Homoserine kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-26 |
| sp|A5ISL2|KHSE_STAA9 | Homoserine kinase OS=Staphylococcus aureus (strain JH9) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-26 |
| sp|A6U1F0|KHSE_STAA2 | Homoserine kinase OS=Staphylococcus aureus (strain JH1) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-26 |
| sp|A7X1Y2|KHSE_STAA1 | Homoserine kinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-26 |
| sp|Q03Y28|KHSE_LEUMM | Homoserine kinase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=thrB PE=3 SV=1 | 7 | 317 | 3.0E-26 |
| sp|Q9CGD7|KHSE_LACLA | Homoserine kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=thrB PE=3 SV=1 | 7 | 315 | 4.0E-26 |
| sp|Q72IV3|KHSE_THET2 | Homoserine kinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=thrB PE=3 SV=1 | 7 | 322 | 5.0E-26 |
| sp|Q043C5|KHSE_LACGA | Homoserine kinase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=thrB PE=3 SV=1 | 7 | 319 | 6.0E-26 |
| sp|Q4L639|KHSE_STAHJ | Homoserine kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=thrB PE=3 SV=1 | 1 | 316 | 7.0E-26 |
| sp|Q5SIH5|KHSE_THET8 | Homoserine kinase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=thrB PE=3 SV=1 | 7 | 322 | 9.0E-26 |
| sp|Q5M5K5|KHSE_STRT2 | Homoserine kinase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=thrB PE=3 SV=1 | 7 | 315 | 1.0E-25 |
| sp|Q5M117|KHSE_STRT1 | Homoserine kinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=thrB PE=3 SV=1 | 7 | 315 | 1.0E-25 |
| sp|Q5HPL2|KHSE_STAEQ | Homoserine kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=thrB PE=3 SV=1 | 7 | 316 | 1.0E-25 |
| sp|Q65FC4|KHSE_BACLD | Homoserine kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=thrB PE=3 SV=1 | 5 | 319 | 2.0E-25 |
| sp|Q8CSQ2|KHSE_STAES | Homoserine kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-25 |
| sp|A0PUL4|KHSE_MYCUA | Homoserine kinase OS=Mycobacterium ulcerans (strain Agy99) GN=thrB PE=3 SV=1 | 15 | 318 | 3.0E-25 |
| sp|B2GCV0|KHSE_LACF3 | Homoserine kinase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=thrB PE=3 SV=1 | 7 | 315 | 5.0E-25 |
| sp|Q03LY7|KHSE_STRTD | Homoserine kinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=thrB PE=3 SV=1 | 7 | 315 | 5.0E-25 |
| sp|A8FJT9|KHSE_CAMJ8 | Homoserine kinase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=thrB PE=3 SV=1 | 7 | 288 | 1.0E-24 |
| sp|C1CQZ4|KHSE_STRZT | Homoserine kinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=thrB PE=3 SV=1 | 7 | 345 | 1.0E-24 |
| sp|B9KEU8|KHSE_CAMLR | Homoserine kinase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=thrB PE=3 SV=1 | 7 | 316 | 1.0E-24 |
| sp|Q5HX32|KHSE_CAMJR | Homoserine kinase OS=Campylobacter jejuni (strain RM1221) GN=thrB PE=3 SV=1 | 7 | 288 | 2.0E-24 |
| sp|A1VXL7|KHSE_CAMJJ | Homoserine kinase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=thrB PE=3 SV=1 | 7 | 288 | 2.0E-24 |
| sp|P04948|KHSE_BACSU | Homoserine kinase OS=Bacillus subtilis (strain 168) GN=thrB PE=3 SV=2 | 5 | 319 | 2.0E-24 |
| sp|Q831T0|KHSE_ENTFA | Homoserine kinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-24 |
| sp|C1CL69|KHSE_STRZP | Homoserine kinase OS=Streptococcus pneumoniae (strain P1031) GN=thrB PE=3 SV=1 | 7 | 318 | 3.0E-24 |
| sp|C1CEU9|KHSE_STRZJ | Homoserine kinase OS=Streptococcus pneumoniae (strain JJA) GN=thrB PE=3 SV=1 | 7 | 318 | 3.0E-24 |
| sp|P0A3L8|KHSE_STRR6 | Homoserine kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thrB PE=3 SV=1 | 7 | 318 | 3.0E-24 |
| sp|B2IQH7|KHSE_STRPS | Homoserine kinase OS=Streptococcus pneumoniae (strain CGSP14) GN=thrB PE=3 SV=1 | 7 | 318 | 3.0E-24 |
| sp|P0A3L7|KHSE_STRPN | Homoserine kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thrB PE=3 SV=1 | 7 | 318 | 3.0E-24 |
| sp|B8ZKK9|KHSE_STRPJ | Homoserine kinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=thrB PE=3 SV=1 | 7 | 318 | 3.0E-24 |
| sp|B1ICG1|KHSE_STRPI | Homoserine kinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=thrB PE=3 SV=1 | 7 | 318 | 3.0E-24 |
| sp|C1C7W1|KHSE_STRP7 | Homoserine kinase OS=Streptococcus pneumoniae (strain 70585) GN=thrB PE=3 SV=1 | 7 | 318 | 3.0E-24 |
| sp|B5E5F6|KHSE_STRP4 | Homoserine kinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=thrB PE=3 SV=1 | 7 | 318 | 3.0E-24 |
| sp|Q04JY7|KHSE_STRP2 | Homoserine kinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=thrB PE=3 SV=1 | 7 | 318 | 3.0E-24 |
| sp|P45836|KHSE_MYCLE | Homoserine kinase OS=Mycobacterium leprae (strain TN) GN=thrB PE=3 SV=2 | 15 | 318 | 5.0E-24 |
| sp|B8ZR28|KHSE_MYCLB | Homoserine kinase OS=Mycobacterium leprae (strain Br4923) GN=thrB PE=3 SV=1 | 15 | 318 | 5.0E-24 |
| sp|A7H1L3|KHSE_CAMJD | Homoserine kinase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=thrB PE=3 SV=1 | 7 | 288 | 5.0E-24 |
| sp|A7Z8E0|KHSE_BACMF | Homoserine kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=thrB PE=3 SV=1 | 5 | 319 | 5.0E-24 |
| sp|Q5FJS7|KHSE_LACAC | Homoserine kinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=thrB PE=3 SV=1 | 7 | 313 | 2.0E-23 |
| sp|B9DRZ0|KHSE_STRU0 | Homoserine kinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=thrB PE=3 SV=1 | 7 | 345 | 2.0E-23 |
| sp|Q9PIZ3|KHSE_CAMJE | Homoserine kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=thrB PE=3 SV=1 | 7 | 288 | 2.0E-23 |
| sp|A4VUI0|KHSE_STRSY | Homoserine kinase OS=Streptococcus suis (strain 05ZYH33) GN=thrB PE=3 SV=1 | 7 | 352 | 2.0E-23 |
| sp|A4W0S2|KHSE_STRS2 | Homoserine kinase OS=Streptococcus suis (strain 98HAH33) GN=thrB PE=3 SV=1 | 7 | 352 | 2.0E-23 |
| sp|Q73X44|KHSE_MYCPA | Homoserine kinase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=thrB PE=3 SV=1 | 15 | 317 | 1.0E-22 |
| sp|C0MEX3|KHSE_STRS7 | Homoserine kinase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=thrB PE=3 SV=1 | 7 | 315 | 4.0E-21 |
| sp|A0RQZ6|KHSE_CAMFF | Homoserine kinase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=thrB PE=3 SV=1 | 7 | 316 | 4.0E-21 |
| sp|A3Q3C9|KHSE_MYCSJ | Homoserine kinase OS=Mycobacterium sp. (strain JLS) GN=thrB PE=3 SV=1 | 6 | 318 | 5.0E-21 |
| sp|A0R219|KHSE_MYCS2 | Homoserine kinase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=thrB PE=3 SV=1 | 6 | 318 | 6.0E-21 |
| sp|A8FH24|KHSE_BACP2 | Homoserine kinase OS=Bacillus pumilus (strain SAFR-032) GN=thrB PE=3 SV=1 | 5 | 319 | 6.0E-21 |
| sp|C0MA57|KHSE_STRE4 | Homoserine kinase OS=Streptococcus equi subsp. equi (strain 4047) GN=thrB PE=3 SV=1 | 7 | 325 | 2.0E-20 |
| sp|C4K7E6|KHSE_HAMD5 | Homoserine kinase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=thrB PE=3 SV=1 | 10 | 316 | 5.0E-20 |
| sp|P9WKE7|KHSE_MYCTU | Homoserine kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=thrB PE=1 SV=1 | 15 | 317 | 7.0E-20 |
| sp|P9WKE6|KHSE_MYCTO | Homoserine kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=thrB PE=3 SV=1 | 15 | 317 | 7.0E-20 |
| sp|P65225|KHSE_MYCBO | Homoserine kinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=thrB PE=3 SV=1 | 15 | 317 | 7.0E-20 |
| sp|Q8FLD8|KHSE_ECOL6 | Homoserine kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thrB PE=3 SV=1 | 7 | 316 | 1.0E-19 |
| sp|B5YY97|KHSE_ECO5E | Homoserine kinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=thrB PE=3 SV=1 | 7 | 316 | 1.0E-19 |
| sp|Q8XA82|KHSE_ECO57 | Homoserine kinase OS=Escherichia coli O157:H7 GN=thrB PE=3 SV=1 | 7 | 316 | 1.0E-19 |
| sp|B1LFT4|KHSE_ECOSM | Homoserine kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|Q83MH9|KHSE_SHIFL | Homoserine kinase OS=Shigella flexneri GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|Q0T8I5|KHSE_SHIF8 | Homoserine kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|B7N7M8|KHSE_ECOLU | Homoserine kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|P00547|KHSE_ECOLI | Homoserine kinase OS=Escherichia coli (strain K12) GN=thrB PE=1 SV=2 | 7 | 316 | 2.0E-19 |
| sp|B1XBC8|KHSE_ECODH | Homoserine kinase OS=Escherichia coli (strain K12 / DH10B) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|C4ZPT0|KHSE_ECOBW | Homoserine kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|Q32KB5|KHSE_SHIDS | Homoserine kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|Q326L9|KHSE_SHIBS | Homoserine kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|B2U219|KHSE_SHIB3 | Homoserine kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|Q1RGK1|KHSE_ECOUT | Homoserine kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|B1IRH0|KHSE_ECOLC | Homoserine kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|A1A756|KHSE_ECOK1 | Homoserine kinase OS=Escherichia coli O1:K1 / APEC GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|A7ZVW2|KHSE_ECOHS | Homoserine kinase OS=Escherichia coli O9:H4 (strain HS) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|B7M0A0|KHSE_ECO8A | Homoserine kinase OS=Escherichia coli O8 (strain IAI1) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|B7NHA6|KHSE_ECO7I | Homoserine kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|B7L4C8|KHSE_ECO55 | Homoserine kinase OS=Escherichia coli (strain 55989 / EAEC) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|B7M9R6|KHSE_ECO45 | Homoserine kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|B7UI48|KHSE_ECO27 | Homoserine kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|A7ZH92|KHSE_ECO24 | Homoserine kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|B7N2U2|KHSE_ECO81 | Homoserine kinase OS=Escherichia coli O81 (strain ED1a) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-19 |
| sp|A7MIJ7|KHSE_CROS8 | Homoserine kinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=thrB PE=3 SV=1 | 7 | 316 | 5.0E-19 |
| sp|Q3Z611|KHSE_SHISS | Homoserine kinase OS=Shigella sonnei (strain Ss046) GN=thrB PE=3 SV=1 | 7 | 316 | 8.0E-19 |
| sp|B6HZ00|KHSE_ECOSE | Homoserine kinase OS=Escherichia coli (strain SE11) GN=thrB PE=3 SV=1 | 7 | 316 | 8.0E-19 |
| sp|Q1B535|KHSE_MYCSS | Homoserine kinase OS=Mycobacterium sp. (strain MCS) GN=thrB PE=3 SV=1 | 15 | 318 | 1.0E-18 |
| sp|A1UK02|KHSE_MYCSK | Homoserine kinase OS=Mycobacterium sp. (strain KMS) GN=thrB PE=3 SV=1 | 15 | 318 | 1.0E-18 |
| sp|Q0W2X4|KHSE_METAR | Homoserine kinase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=thrB PE=3 SV=1 | 6 | 315 | 1.0E-18 |
| sp|A1TD73|KHSE_MYCVP | Homoserine kinase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=thrB PE=3 SV=1 | 15 | 317 | 1.0E-18 |
| sp|P27722|KHSE_SERMA | Homoserine kinase OS=Serratia marcescens GN=thrB PE=3 SV=1 | 7 | 346 | 5.0E-18 |
| sp|Q0TLY6|KHSE_ECOL5 | Homoserine kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thrB PE=3 SV=1 | 7 | 316 | 6.0E-18 |
| sp|A8ALV4|KHSE_CITK8 | Homoserine kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=thrB PE=3 SV=1 | 7 | 316 | 7.0E-18 |
| sp|O58814|KHSE_PYRHO | Homoserine kinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=thrB PE=3 SV=2 | 3 | 318 | 7.0E-18 |
| sp|B5FH97|KHSE_SALDC | Homoserine kinase OS=Salmonella dublin (strain CT_02021853) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-17 |
| sp|A9MR86|KHSE_SALAR | Homoserine kinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-17 |
| sp|P65226|KHSE_SALTY | Homoserine kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|P65227|KHSE_SALTI | Homoserine kinase OS=Salmonella typhi GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|B4TVY5|KHSE_SALSV | Homoserine kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|B5BLG9|KHSE_SALPK | Homoserine kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|C0Q4E3|KHSE_SALPC | Homoserine kinase OS=Salmonella paratyphi C (strain RKS4594) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|Q5PDM3|KHSE_SALPA | Homoserine kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|B4T6C6|KHSE_SALNS | Homoserine kinase OS=Salmonella newport (strain SL254) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|B4TIA4|KHSE_SALHS | Homoserine kinase OS=Salmonella heidelberg (strain SL476) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|B5REZ9|KHSE_SALG2 | Homoserine kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|B5R5H5|KHSE_SALEP | Homoserine kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|Q57TQ2|KHSE_SALCH | Homoserine kinase OS=Salmonella choleraesuis (strain SC-B67) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|B5F6C2|KHSE_SALA4 | Homoserine kinase OS=Salmonella agona (strain SL483) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-17 |
| sp|Q9WZ15|KHSE_THEMA | Homoserine kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=thrB PE=3 SV=1 | 9 | 323 | 3.0E-17 |
| sp|A8G9K0|KHSE_SERP5 | Homoserine kinase OS=Serratia proteamaculans (strain 568) GN=thrB PE=3 SV=1 | 7 | 322 | 4.0E-17 |
| sp|A6T4E3|KHSE_KLEP7 | Homoserine kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=thrB PE=3 SV=1 | 7 | 316 | 5.0E-17 |
| sp|A6URT1|KHSE_METVS | Homoserine kinase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=thrB PE=3 SV=1 | 4 | 333 | 6.0E-17 |
| sp|Q65RV1|KHSE_MANSM | Homoserine kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=thrB PE=3 SV=1 | 7 | 316 | 6.0E-17 |
| sp|A9MXH1|KHSE_SALPB | Homoserine kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=thrB PE=3 SV=1 | 7 | 316 | 9.0E-17 |
| sp|A5IJN0|KHSE_THEP1 | Homoserine kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=thrB PE=3 SV=1 | 9 | 323 | 9.0E-17 |
| sp|P44504|KHSE_HAEIN | Homoserine kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thrB PE=3 SV=1 | 7 | 316 | 1.0E-16 |
| sp|A5UFQ1|KHSE_HAEIG | Homoserine kinase OS=Haemophilus influenzae (strain PittGG) GN=thrB PE=3 SV=1 | 7 | 316 | 1.0E-16 |
| sp|A5UB54|KHSE_HAEIE | Homoserine kinase OS=Haemophilus influenzae (strain PittEE) GN=thrB PE=3 SV=1 | 7 | 316 | 1.0E-16 |
| sp|B5Y254|KHSE_KLEP3 | Homoserine kinase OS=Klebsiella pneumoniae (strain 342) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-16 |
| sp|Q7N8Z5|KHSE_PHOLL | Homoserine kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=thrB PE=3 SV=1 | 7 | 335 | 2.0E-16 |
| sp|Q4QP96|KHSE_HAEI8 | Homoserine kinase OS=Haemophilus influenzae (strain 86-028NP) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-16 |
| sp|B1JL13|KHSE_YERPY | Homoserine kinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=thrB PE=3 SV=1 | 7 | 317 | 3.0E-16 |
| sp|Q66ET8|KHSE_YERPS | Homoserine kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=thrB PE=3 SV=1 | 7 | 317 | 3.0E-16 |
| sp|A4TQG9|KHSE_YERPP | Homoserine kinase OS=Yersinia pestis (strain Pestoides F) GN=thrB PE=3 SV=1 | 7 | 317 | 3.0E-16 |
| sp|Q1CMW6|KHSE_YERPN | Homoserine kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=thrB PE=1 SV=1 | 7 | 317 | 3.0E-16 |
| sp|A9R025|KHSE_YERPG | Homoserine kinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=thrB PE=3 SV=1 | 7 | 317 | 3.0E-16 |
| sp|Q8ZIN5|KHSE_YERPE | Homoserine kinase OS=Yersinia pestis GN=thrB PE=3 SV=1 | 7 | 317 | 3.0E-16 |
| sp|B2K3L2|KHSE_YERPB | Homoserine kinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=thrB PE=3 SV=1 | 7 | 317 | 3.0E-16 |
| sp|Q1C0K9|KHSE_YERPA | Homoserine kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=thrB PE=3 SV=1 | 7 | 317 | 3.0E-16 |
| sp|A7FMF2|KHSE_YERP3 | Homoserine kinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=thrB PE=3 SV=1 | 7 | 317 | 3.0E-16 |
| sp|C3LQD5|KHSE_VIBCM | Homoserine kinase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=thrB PE=3 SV=1 | 6 | 337 | 4.0E-16 |
| sp|Q9KPK4|KHSE_VIBCH | Homoserine kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thrB PE=3 SV=1 | 6 | 337 | 4.0E-16 |
| sp|A6UV93|KHSE_META3 | Homoserine kinase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=thrB PE=3 SV=1 | 10 | 333 | 6.0E-16 |
| sp|Q87SC9|KHSE_VIBPA | Homoserine kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thrB PE=3 SV=1 | 6 | 346 | 1.0E-15 |
| sp|Q9CPD3|KHSE_PASMU | Homoserine kinase OS=Pasteurella multocida (strain Pm70) GN=thrB PE=3 SV=1 | 7 | 316 | 2.0E-15 |
| sp|B2VH20|KHSE_ERWT9 | Homoserine kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=thrB PE=3 SV=1 | 7 | 318 | 2.0E-15 |
| sp|Q8K9V0|KHSE_BUCAP | Homoserine kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-15 |
| sp|A4SGN0|KHSE_CHLPM | Homoserine kinase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=thrB PE=3 SV=1 | 11 | 316 | 3.0E-15 |
| sp|Q0I3T3|KHSE_HAES1 | Homoserine kinase OS=Haemophilus somnus (strain 129Pt) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-15 |
| sp|Q6D0A9|KHSE_PECAS | Homoserine kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thrB PE=3 SV=1 | 7 | 317 | 3.0E-15 |
| sp|A1JJC7|KHSE_YERE8 | Homoserine kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=thrB PE=3 SV=1 | 7 | 317 | 4.0E-15 |
| sp|B7LWR1|KHSE_ESCF3 | Homoserine kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=thrB PE=3 SV=1 | 7 | 316 | 6.0E-15 |
| sp|A9A802|KHSE_METM6 | Homoserine kinase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=thrB PE=3 SV=1 | 4 | 315 | 6.0E-15 |
| sp|B0UWP6|KHSE_HISS2 | Homoserine kinase OS=Histophilus somni (strain 2336) GN=thrB PE=3 SV=1 | 7 | 316 | 6.0E-15 |
| sp|B7VJ36|KHSE_VIBTL | Homoserine kinase OS=Vibrio tasmaniensis (strain LGP32) GN=thrB PE=3 SV=1 | 6 | 346 | 7.0E-15 |
| sp|C6DF18|KHSE_PECCP | Homoserine kinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=thrB PE=3 SV=1 | 7 | 317 | 2.0E-14 |
| sp|C5B7K5|KHSE_EDWI9 | Homoserine kinase OS=Edwardsiella ictaluri (strain 93-146) GN=thrB PE=3 SV=1 | 7 | 316 | 3.0E-14 |
| sp|P59568|KHSE_BUCBP | Homoserine kinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=thrB PE=3 SV=1 | 7 | 316 | 4.0E-14 |
| sp|B9LS04|KHSE_HALLT | Homoserine kinase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=thrB PE=3 SV=1 | 6 | 354 | 4.0E-14 |
| sp|Q6LUP9|KHSE_PHOPR | Homoserine kinase OS=Photobacterium profundum GN=thrB PE=3 SV=1 | 6 | 317 | 5.0E-14 |
| sp|B5FAK1|KHSE_VIBFM | Homoserine kinase OS=Vibrio fischeri (strain MJ11) GN=thrB PE=3 SV=1 | 6 | 317 | 7.0E-14 |
| sp|A4FZP2|KHSE_METM5 | Homoserine kinase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=thrB PE=3 SV=1 | 4 | 315 | 8.0E-14 |
| sp|Q2NVZ5|KHSE_SODGM | Homoserine kinase OS=Sodalis glossinidius (strain morsitans) GN=thrB PE=3 SV=1 | 7 | 316 | 8.0E-14 |
| sp|Q6M0H5|KHSE_METMP | Homoserine kinase OS=Methanococcus maripaludis (strain S2 / LL) GN=thrB PE=1 SV=1 | 4 | 315 | 1.0E-13 |
| sp|Q975A7|KHSE_SULTO | Homoserine kinase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thrB PE=3 SV=1 | 7 | 351 | 1.0E-13 |
| sp|A6VIT5|KHSE_METM7 | Homoserine kinase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=thrB PE=3 SV=1 | 4 | 315 | 1.0E-13 |
| sp|B6EKY7|KHSE_ALISL | Homoserine kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=thrB PE=3 SV=1 | 6 | 346 | 2.0E-13 |
| sp|Q5E2Y4|KHSE_VIBF1 | Homoserine kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=thrB PE=3 SV=1 | 6 | 316 | 2.0E-13 |
| sp|A5F5R9|KHSE_VIBC3 | Homoserine kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=thrB PE=3 SV=1 | 6 | 337 | 4.0E-13 |
| sp|Q7MNR4|KHSE_VIBVY | Homoserine kinase OS=Vibrio vulnificus (strain YJ016) GN=thrB PE=3 SV=2 | 6 | 316 | 5.0E-13 |
| sp|Q8DEP3|KHSE_VIBVU | Homoserine kinase OS=Vibrio vulnificus (strain CMCP6) GN=thrB PE=3 SV=1 | 6 | 316 | 5.0E-13 |
| sp|Q8ZZX3|KHSE_PYRAE | Homoserine kinase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=thrB PE=3 SV=1 | 7 | 349 | 2.0E-12 |
| sp|Q3INF0|KHSE_NATPD | Homoserine kinase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=thrB PE=3 SV=1 | 6 | 337 | 2.0E-12 |
| sp|A1BJF6|KHSE_CHLPD | Homoserine kinase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=thrB PE=3 SV=1 | 11 | 317 | 4.0E-12 |
| sp|Q5UXG4|KHSE_HALMA | Homoserine kinase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=thrB PE=3 SV=2 | 6 | 351 | 2.0E-11 |
| sp|Q8U1Z9|KHSE_PYRFU | Homoserine kinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=thrB PE=3 SV=1 | 10 | 350 | 2.0E-10 |
| sp|Q057U7|KHSE_BUCCC | Homoserine kinase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=thrB PE=3 SV=1 | 7 | 337 | 7.0E-10 |
| sp|Q58504|KHSE_METJA | Homoserine kinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=thrB PE=1 SV=2 | 4 | 320 | 1.0E-09 |
| sp|Q8L7R2|KHSE_ARATH | Homoserine kinase OS=Arabidopsis thaliana GN=HSK PE=1 SV=1 | 10 | 351 | 2.0E-09 |
| sp|C3MU21|KHSE_SULIM | Homoserine kinase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=thrB PE=3 SV=1 | 1 | 148 | 4.0E-09 |
| sp|C3MK52|KHSE_SULIL | Homoserine kinase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=thrB PE=3 SV=1 | 1 | 148 | 4.0E-09 |
| sp|C4KK76|KHSE_SULIK | Homoserine kinase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=thrB PE=3 SV=1 | 1 | 148 | 4.0E-09 |
| sp|C3N0N3|KHSE_SULIA | Homoserine kinase OS=Sulfolobus islandicus (strain M.16.27) GN=thrB PE=3 SV=1 | 1 | 148 | 4.0E-09 |
| sp|C3N8M1|KHSE_SULIY | Homoserine kinase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=thrB PE=3 SV=1 | 1 | 148 | 4.0E-09 |
| sp|C3NM92|KHSE_SULIN | Homoserine kinase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=thrB PE=3 SV=1 | 1 | 148 | 4.0E-09 |
| sp|Q18F42|KHSE_HALWD | Homoserine kinase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=thrB PE=3 SV=2 | 6 | 315 | 5.0E-09 |
| sp|B3EL38|KHSE_CHLPB | Homoserine kinase OS=Chlorobium phaeobacteroides (strain BS1) GN=thrB PE=3 SV=1 | 11 | 317 | 8.0E-09 |
| sp|Q6L1U1|KHSE_PICTO | Homoserine kinase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=thrB PE=3 SV=1 | 11 | 315 | 1.0E-08 |
| sp|B3QWX6|KHSE_CHLT3 | Homoserine kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=thrB PE=3 SV=1 | 10 | 340 | 3.0E-08 |
| sp|Q8KAW7|KHSE_CHLTE | Homoserine kinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=thrB PE=3 SV=1 | 11 | 317 | 6.0E-08 |
| sp|Q8TYG6|KHSE_METKA | Homoserine kinase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=thrB PE=3 SV=1 | 2 | 333 | 9.0E-08 |
| sp|Q979X5|KHSE_THEVO | Homoserine kinase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=thrB PE=3 SV=1 | 1 | 321 | 3.0E-07 |
| sp|Q87C24|KHSE_XYLFT | Homoserine kinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=thrB PE=3 SV=1 | 10 | 314 | 3.0E-07 |
| sp|B0U3B8|KHSE_XYLFM | Homoserine kinase OS=Xylella fastidiosa (strain M12) GN=thrB PE=3 SV=1 | 10 | 314 | 3.0E-07 |
| sp|B2I5Y6|KHSE_XYLF2 | Homoserine kinase OS=Xylella fastidiosa (strain M23) GN=thrB PE=3 SV=1 | 10 | 314 | 3.0E-07 |
| sp|C5A1P1|KHSE_THEGJ | Homoserine kinase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=thrB PE=3 SV=1 | 215 | 339 | 6.0E-07 |
| sp|A1RQK6|KHSE_PYRIL | Homoserine kinase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=thrB PE=3 SV=1 | 218 | 315 | 6.0E-07 |
| sp|Q9PBC0|KHSE_XYLFA | Homoserine kinase OS=Xylella fastidiosa (strain 9a5c) GN=thrB PE=3 SV=1 | 10 | 314 | 1.0E-06 |
| sp|Q5JH53|KHSE_THEKO | Homoserine kinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thrB PE=3 SV=1 | 215 | 340 | 3.0E-06 |
| sp|Q9HP55|KHSE_HALSA | Homoserine kinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thrB PE=3 SV=1 | 6 | 315 | 5.0E-06 |
| sp|B0R6D7|KHSE_HALS3 | Homoserine kinase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=thrB PE=3 SV=1 | 6 | 315 | 5.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005524 | ATP binding | Yes |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0036094 | small molecule binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0032559 | adenyl ribonucleotide binding | No |
| GO:0030554 | adenyl nucleotide binding | No |
| GO:0043168 | anion binding | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:0003674 | molecular_function | No |
| GO:0000166 | nucleotide binding | No |
| Localizations | Signals | Cytoplasm | Nucleus | Extracellular | Cell membrane | Mitochondrion | Plastid | Endoplasmic reticulum | Lysosome vacuole | Golgi apparatus | Peroxisome |
|---|---|---|---|---|---|---|---|---|---|---|---|
| Cytoplasm | 0.5326 | 0.3892 | 0.0042 | 0.3002 | 0.316 | 0.009 | 0.2772 | 0.2884 | 0.1566 | 0.1193 |
| Orthofinder run ID | 1 |
| Orthogroup | 3245 |
| Change Orthofinder run |
| Species | Protein ID |
|---|---|
| Agaricus bisporus var bisporus H39 | AgabiH39|008990 |
| Agaricus bisporus var bisporus H97 | AgabiH97|008990 (this protein) |
| Rhodonia placenta FPRL280 | RhoplFPRL280|42_29 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|008990 MPCKYTIKVPATSANIGPGFDVVGLSLSLLLTLTVTIDTPSTSTTPYIHPKITYSGEGADEVPLDAYKNLTTRVA LYVLRCHDINRFPSHLSIHAHNEIPFGRGLGSSGAAVIAGVLLGNILGNLTLSTERLLDFALMVERHPDNVTAAL VGGFVGSYLKELDDAASLAASVPLSEVLPEYPDDAGEEWGLNPPRPPLGIGHYVKFGWSEGIKAVAIIPRFELST AKARSVLPTEYSRKDLVFNMQRLAVLTTALAQTPPDPDLIYDAMKDRVHQPYRKTLIPGLPEVTSQITPATHPGL LGICLSGAGPTILALATHGFEAIAEDARVIFKQKDIEIDWKLLQVTGGCSVIQEVYE* |
| Coding | >AgabiH97|008990 ATGCCTTGCAAGTATACAATCAAAGTACCAGCCACATCGGCCAACATCGGGCCCGGATTCGATGTCGTTGGACTC TCTCTCTCTCTGCTCCTTACCCTCACCGTCACCATCGACACTCCATCCACATCCACCACCCCTTATATCCACCCT AAAATCACCTACTCTGGCGAAGGGGCCGACGAAGTCCCTTTGGATGCCTACAAAAACCTCACCACGCGTGTAGCT CTCTACGTTCTTCGATGTCACGACATCAACCGATTCCCCTCCCACCTCTCCATCCACGCCCACAATGAAATCCCC TTTGGCAGAGGCCTAGGATCATCCGGAGCAGCAGTCATAGCAGGAGTCCTCCTCGGCAACATTTTAGGAAACCTC ACCCTCTCAACCGAGAGATTACTCGATTTCGCATTGATGGTCGAACGTCATCCAGATAATGTGACTGCAGCTTTA GTAGGTGGATTTGTAGGATCGTATTTGAAGGAATTGGATGATGCGGCGAGTTTGGCTGCGAGTGTACCTTTGAGT GAGGTTTTACCGGAATATCCGGATGATGCTGGAGAAGAGTGGGGGTTGAATCCGCCTAGACCGCCTTTGGGGATT GGACATTATGTGAAGTTTGGTTGGTCGGAGGGGATTAAGGCTGTTGCTATCATTCCTCGGTTTGAATTGAGTACG GCTAAAGCGAGAAGTGTACTACCTACTGAATATTCAAGAAAAGATCTGGTTTTTAACATGCAAAGATTGGCTGTA CTCACCACCGCCCTTGCTCAAACACCACCTGATCCTGATCTCATTTACGACGCAATGAAAGATCGTGTACACCAG CCCTACAGAAAAACCCTTATTCCGGGACTGCCAGAAGTGACATCTCAGATCACTCCTGCCACCCACCCTGGTTTA CTAGGTATCTGCCTTTCTGGCGCTGGCCCTACTATTCTCGCCCTCGCCACTCACGGCTTCGAAGCCATTGCCGAA GACGCTCGCGTCATTTTCAAACAAAAAGATATTGAGATAGATTGGAAATTACTTCAAGTTACGGGTGGTTGTAGC GTTATACAAGAGGTCTATGAATAA |
| Transcript | >AgabiH97|008990 ATGCCTTGCAAGTATACAATCAAAGTACCAGCCACATCGGCCAACATCGGGCCCGGATTCGATGTCGTTGGACTC TCTCTCTCTCTGCTCCTTACCCTCACCGTCACCATCGACACTCCATCCACATCCACCACCCCTTATATCCACCCT AAAATCACCTACTCTGGCGAAGGGGCCGACGAAGTCCCTTTGGATGCCTACAAAAACCTCACCACGCGTGTAGCT CTCTACGTTCTTCGATGTCACGACATCAACCGATTCCCCTCCCACCTCTCCATCCACGCCCACAATGAAATCCCC TTTGGCAGAGGCCTAGGATCATCCGGAGCAGCAGTCATAGCAGGAGTCCTCCTCGGCAACATTTTAGGAAACCTC ACCCTCTCAACCGAGAGATTACTCGATTTCGCATTGATGGTCGAACGTCATCCAGATAATGTGACTGCAGCTTTA GTAGGTGGATTTGTAGGATCGTATTTGAAGGAATTGGATGATGCGGCGAGTTTGGCTGCGAGTGTACCTTTGAGT GAGGTTTTACCGGAATATCCGGATGATGCTGGAGAAGAGTGGGGGTTGAATCCGCCTAGACCGCCTTTGGGGATT GGACATTATGTGAAGTTTGGTTGGTCGGAGGGGATTAAGGCTGTTGCTATCATTCCTCGGTTTGAATTGAGTACG GCTAAAGCGAGAAGTGTACTACCTACTGAATATTCAAGAAAAGATCTGGTTTTTAACATGCAAAGATTGGCTGTA CTCACCACCGCCCTTGCTCAAACACCACCTGATCCTGATCTCATTTACGACGCAATGAAAGATCGTGTACACCAG CCCTACAGAAAAACCCTTATTCCGGGACTGCCAGAAGTGACATCTCAGATCACTCCTGCCACCCACCCTGGTTTA CTAGGTATCTGCCTTTCTGGCGCTGGCCCTACTATTCTCGCCCTCGCCACTCACGGCTTCGAAGCCATTGCCGAA GACGCTCGCGTCATTTTCAAACAAAAAGATATTGAGATAGATTGGAAATTACTTCAAGTTACGGGTGGTTGTAGC GTTATACAAGAGGTCTATGAATAA |
| Gene | >AgabiH97|008990 ATGCCTTGCAAGTATACAATCAAAGTACCAGCCACATCGGCCAACATCGGGCCCGGATTCGATGTCGTTGGACTC TCTCTCTCTCTGCTCCTTACCCTCACCGTCACCATCGACACTCCATCCACATCCACCACCCCTTATATCCACCCT AAAATCACCTACTCTGGCGAAGGGGCCGACGAAGTCCCTTTGGATGCCTACAAAAACCTCACCACGCGTGTAGCT CTCTACGTTCTTCGATGTCACGACATCAACCGATTCCCCTCCCACCTCTCCATCCACGCCCACAATGAAATCCCC TTTGGCAGAGGCCTAGGATCATCCGGAGCAGCAGTCATAGCAGGAGTCCTCCTCGGCAACATTTTAGGAAACCTC ACCCTCTCAACCGAGAGATTACTCGATTTCGCATTGATGGTCGAACGTCATCCAGATAATGTGACTGCAGCTTTA GTAGGTGGATTTGTAGGATCGTATTTGAAGGAATTGGATGATGCGGCGAGTTTGGCTGCGAGTGTACCTTTGAGT GAGGTTTTACCGGAATATCCGGATGATGCTGGAGAAGAGTGGGGGTTGAATCCGCCTAGACCGCCTTTGGGGATT GGACATTATGTGAAGTTTGGTTGGTCGGAGGGGATTAAGGCTGTTGCTATCATTCCTCGGTTTGAATTGAGTACG GCTAAAGCGAGAAGTGTACTACCTACTGAATATTCAAGAAAAGATCTGGTCAGTCATCACTTATTATTATTATCA GAATCCATTTAATTCATTTTTTTTTTGTGTACCAGGTTTTTAACATGCAAAGATTGGCTGTACTCACCACCGCCC TTGCTCAAACACCACCTGATCCTGATCTCATTTACGACGCAATGAAAGATCGTGTACACCAGCCCTACAGAAAAA CCCTTGTATGTAAATCCTTCTCCTCCACATCTTTTTTACTCAAGAAACCCTTTCTAGATTCCGGGACTGCCAGAA GTGACATCTCAGATCACTCCTGCCACCCACCCTGGTTTACTAGGTATCTGCCTTTCTGGCGCTGGCCCTACTATT CTCGCCCTCGCCACTCACGGCTTCGAAGCCATTGCCGAAGACGCTCGCGTCATTTTCAAACAAAAAGATATTGAG ATAGATTGGAAATTACTTCAAGTTACGGGTGGTTGTAGCGTTATACAAGAGGTCTATGAATAA |