Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008990
Gene name
Locationscaffold_1:2116831..2118019
Strand-
Gene length (bp)1188
Transcript length (bp)1074
Coding sequence length (bp)1074
Protein length (aa) 358

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00288 GHMP_kinases_N GHMP kinases N terminal domain 1.3E-08 93 153

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P17423|KHSE_YEAST Homoserine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THR1 PE=1 SV=4 5 354 2.0E-135
sp|Q92209|KHSE_CANAL Homoserine kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=THR1 PE=3 SV=2 5 345 4.0E-126
sp|O43056|KHSE_SCHPO Probable homoserine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4C3.03 PE=3 SV=1 4 343 3.0E-113
sp|Q02AL5|KHSE_SOLUE Homoserine kinase OS=Solibacter usitatus (strain Ellin6076) GN=thrB PE=3 SV=1 5 332 3.0E-47
sp|B8CW89|KHSE_HALOH Homoserine kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=thrB PE=3 SV=1 5 325 3.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P17423|KHSE_YEAST Homoserine kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THR1 PE=1 SV=4 5 354 2.0E-135
sp|Q92209|KHSE_CANAL Homoserine kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=THR1 PE=3 SV=2 5 345 4.0E-126
sp|O43056|KHSE_SCHPO Probable homoserine kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4C3.03 PE=3 SV=1 4 343 3.0E-113
sp|Q02AL5|KHSE_SOLUE Homoserine kinase OS=Solibacter usitatus (strain Ellin6076) GN=thrB PE=3 SV=1 5 332 3.0E-47
sp|B8CW89|KHSE_HALOH Homoserine kinase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=thrB PE=3 SV=1 5 325 3.0E-47
sp|O67332|KHSE_AQUAE Homoserine kinase OS=Aquifex aeolicus (strain VF5) GN=thrB PE=3 SV=1 7 330 2.0E-44
sp|A5I2A9|KHSE_CLOBH Homoserine kinase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=thrB PE=3 SV=1 7 351 4.0E-44
sp|A7FUE5|KHSE_CLOB1 Homoserine kinase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=thrB PE=3 SV=1 7 351 4.0E-44
sp|C0QQC5|KHSE_PERMH Homoserine kinase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=thrB PE=3 SV=1 7 345 6.0E-44
sp|Q67LA5|KHSE_SYMTH Homoserine kinase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=thrB PE=3 SV=1 7 332 2.0E-43
sp|A7GDW6|KHSE_CLOBL Homoserine kinase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=thrB PE=3 SV=1 7 315 3.0E-43
sp|B1ILR0|KHSE_CLOBK Homoserine kinase OS=Clostridium botulinum (strain Okra / Type B1) GN=thrB PE=3 SV=1 7 315 5.0E-43
sp|A4XI71|KHSE_CALS8 Homoserine kinase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=thrB PE=3 SV=1 6 343 2.0E-42
sp|C1FNA5|KHSE_CLOBJ Homoserine kinase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=thrB PE=3 SV=1 7 315 2.0E-42
sp|B1KS25|KHSE_CLOBM Homoserine kinase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=thrB PE=3 SV=1 7 315 1.0E-41
sp|C3KW44|KHSE_CLOB6 Homoserine kinase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=thrB PE=3 SV=1 7 315 1.0E-41
sp|B9ML57|KHSE_CALBD Homoserine kinase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=thrB PE=3 SV=1 6 343 8.0E-41
sp|Q117D0|KHSE_TRIEI Homoserine kinase OS=Trichodesmium erythraeum (strain IMS101) GN=thrB PE=3 SV=1 6 315 4.0E-40
sp|P04947|KHSE_MICDP Homoserine kinase OS=Microchaete diplosiphon GN=thrB PE=3 SV=1 10 354 5.0E-40
sp|Q3M9C9|KHSE_ANAVT Homoserine kinase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=thrB PE=3 SV=1 10 315 1.0E-39
sp|B1XLE7|KHSE_SYNP2 Homoserine kinase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=thrB PE=3 SV=1 7 317 2.0E-39
sp|B2J7E8|KHSE_NOSP7 Homoserine kinase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=thrB PE=3 SV=1 6 335 6.0E-39
sp|Q2RIX1|KHSE_MOOTA Homoserine kinase OS=Moorella thermoacetica (strain ATCC 39073) GN=thrB PE=3 SV=1 7 343 1.0E-38
sp|B2UX33|KHSE_CLOBA Homoserine kinase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=thrB PE=3 SV=1 7 345 2.0E-38
sp|Q7VBM6|KHSE_PROMA Homoserine kinase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=thrB PE=3 SV=1 4 318 3.0E-38
sp|Q5N5W2|KHSE_SYNP6 Homoserine kinase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=thrB PE=3 SV=1 4 357 4.0E-38
sp|Q31N99|KHSE_SYNE7 Homoserine kinase OS=Synechococcus elongatus (strain PCC 7942) GN=thrB PE=3 SV=1 4 357 4.0E-38
sp|A9BGN7|KHSE_PETMO Homoserine kinase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=thrB PE=3 SV=1 7 331 4.0E-38
sp|P73646|KHSE_SYNY3 Homoserine kinase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=thrB PE=3 SV=1 4 316 5.0E-38
sp|A4QDE5|KHSE_CORGB Homoserine kinase OS=Corynebacterium glutamicum (strain R) GN=thrB PE=3 SV=1 4 328 5.0E-38
sp|Q8FQ44|KHSE_COREF Homoserine kinase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=thrB PE=3 SV=1 4 328 6.0E-38
sp|P07128|KHSE_CORGL Homoserine kinase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=thrB PE=1 SV=4 4 328 8.0E-38
sp|B2TPC7|KHSE_CLOBB Homoserine kinase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=thrB PE=3 SV=1 7 345 2.0E-37
sp|A6LSZ4|KHSE_CLOB8 Homoserine kinase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=thrB PE=3 SV=1 6 353 3.0E-37
sp|A5CQ46|KHSE_CLAM3 Homoserine kinase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=thrB PE=3 SV=1 4 317 7.0E-37
sp|B8FU92|KHSE_DESHD Homoserine kinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=thrB PE=3 SV=1 7 325 2.0E-36
sp|Q46LV5|KHSE_PROMT Homoserine kinase OS=Prochlorococcus marinus (strain NATL2A) GN=thrB PE=3 SV=1 7 321 2.0E-36
sp|Q0AXC8|KHSE_SYNWW Homoserine kinase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=thrB PE=3 SV=1 5 343 4.0E-36
sp|Q4JUI5|KHSE_CORJK Homoserine kinase OS=Corynebacterium jeikeium (strain K411) GN=thrB PE=3 SV=1 4 328 5.0E-36
sp|Q24XU1|KHSE_DESHY Homoserine kinase OS=Desulfitobacterium hafniense (strain Y51) GN=thrB PE=3 SV=1 7 325 5.0E-36
sp|A2C153|KHSE_PROM1 Homoserine kinase OS=Prochlorococcus marinus (strain NATL1A) GN=thrB PE=3 SV=1 7 321 5.0E-36
sp|Q8R711|KHSE_CALS4 Homoserine kinase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=thrB PE=3 SV=1 7 317 7.0E-36
sp|Q6AG73|KHSE_LEIXX Homoserine kinase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=thrB PE=3 SV=1 7 333 2.0E-35
sp|A8EWD5|KHSE_ARCB4 Homoserine kinase OS=Arcobacter butzleri (strain RM4018) GN=thrB PE=3 SV=1 7 316 2.0E-35
sp|B1WP79|KHSE_CYAA5 Homoserine kinase OS=Cyanothece sp. (strain ATCC 51142) GN=thrB PE=3 SV=1 15 351 3.0E-35
sp|C3PFP1|KHSE_CORA7 Homoserine kinase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=thrB PE=3 SV=1 3 328 5.0E-35
sp|Q6NHU3|KHSE_CORDI Homoserine kinase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=thrB PE=3 SV=1 4 328 9.0E-35
sp|B1VFW6|KHSE_CORU7 Homoserine kinase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=thrB PE=3 SV=1 4 328 1.0E-34
sp|Q7NLJ6|KHSE_GLOVI Homoserine kinase OS=Gloeobacter violaceus (strain PCC 7421) GN=thrB PE=3 SV=1 6 318 1.0E-34
sp|Q8DI27|KHSE_THEEB Homoserine kinase OS=Thermosynechococcus elongatus (strain BP-1) GN=thrB PE=3 SV=1 7 345 1.0E-34
sp|Q7U659|KHSE_SYNPX Homoserine kinase OS=Synechococcus sp. (strain WH8102) GN=thrB PE=3 SV=1 4 318 2.0E-34
sp|Q3AAV5|KHSE_CARHZ Homoserine kinase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=thrB PE=3 SV=1 1 319 2.0E-34
sp|A2BVQ8|KHSE_PROM5 Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9515) GN=thrB PE=3 SV=1 4 329 2.0E-34
sp|Q891L4|KHSE_CLOTE Homoserine kinase OS=Clostridium tetani (strain Massachusetts / E88) GN=thrB PE=3 SV=2 7 355 3.0E-34
sp|A8G3W1|KHSE_PROM2 Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9215) GN=thrB PE=3 SV=1 4 318 4.0E-34
sp|A5GSI7|KHSE_SYNR3 Homoserine kinase OS=Synechococcus sp. (strain RCC307) GN=thrB PE=3 SV=1 7 337 5.0E-34
sp|A6TKS7|KHSE_ALKMQ Homoserine kinase OS=Alkaliphilus metalliredigens (strain QYMF) GN=thrB PE=3 SV=1 7 347 5.0E-34
sp|Q3AKU3|KHSE_SYNSC Homoserine kinase OS=Synechococcus sp. (strain CC9605) GN=thrB PE=3 SV=1 4 315 7.0E-34
sp|Q8YZV9|KHSE_NOSS1 Homoserine kinase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=thrB PE=3 SV=2 10 334 8.0E-34
sp|Q30SS8|KHSE_SULDN Homoserine kinase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=thrB PE=3 SV=1 6 315 1.0E-33
sp|C4LJM9|KHSE_CORK4 Homoserine kinase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=thrB PE=3 SV=1 6 322 1.0E-33
sp|A3PBW9|KHSE_PROM0 Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9301) GN=thrB PE=3 SV=1 4 315 1.0E-33
sp|A5GJT4|KHSE_SYNPW Homoserine kinase OS=Synechococcus sp. (strain WH7803) GN=thrB PE=3 SV=1 7 318 1.0E-33
sp|Q0I8Z9|KHSE_SYNS3 Homoserine kinase OS=Synechococcus sp. (strain CC9311) GN=thrB PE=3 SV=1 7 318 1.0E-33
sp|Q7M7X6|KHSE_WOLSU Homoserine kinase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=thrB PE=3 SV=1 6 327 2.0E-33
sp|Q3AYC9|KHSE_SYNS9 Homoserine kinase OS=Synechococcus sp. (strain CC9902) GN=thrB PE=3 SV=1 4 318 2.0E-33
sp|A5N6I0|KHSE_CLOK5 Homoserine kinase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=thrB PE=3 SV=1 4 315 3.0E-33
sp|Q31BT9|KHSE_PROM9 Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9312) GN=thrB PE=3 SV=1 4 315 3.0E-33
sp|C1AW13|KHSE_RHOOB Homoserine kinase OS=Rhodococcus opacus (strain B4) GN=thrB PE=3 SV=1 6 320 3.0E-33
sp|Q7V289|KHSE_PROMP Homoserine kinase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=thrB PE=3 SV=1 4 318 5.0E-33
sp|A7GNV5|KHSE_BACCN Homoserine kinase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=thrB PE=3 SV=1 5 351 8.0E-33
sp|Q97JN8|KHSE_CLOAB Homoserine kinase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=thrB PE=3 SV=1 7 345 3.0E-32
sp|B7HNB7|KHSE_BACC7 Homoserine kinase OS=Bacillus cereus (strain AH187) GN=thrB PE=3 SV=1 6 346 5.0E-32
sp|B1MYF2|KHSE_LEUCK Homoserine kinase OS=Leuconostoc citreum (strain KM20) GN=thrB PE=3 SV=1 7 316 5.0E-32
sp|Q9RRU5|KHSE_DEIRA Homoserine kinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=thrB PE=3 SV=1 5 315 6.0E-32
sp|B7HJ93|KHSE_BACC4 Homoserine kinase OS=Bacillus cereus (strain B4264) GN=thrB PE=3 SV=1 5 341 9.0E-32
sp|Q9K7E4|KHSE_BACHD Homoserine kinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=thrB PE=3 SV=1 1 338 1.0E-31
sp|Q7V8D0|KHSE_PROMM Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9313) GN=thrB PE=3 SV=1 4 315 2.0E-31
sp|Q63CI8|KHSE_BACCZ Homoserine kinase OS=Bacillus cereus (strain ZK / E33L) GN=thrB PE=3 SV=1 6 346 2.0E-31
sp|A8MI61|KHSE_ALKOO Homoserine kinase OS=Alkaliphilus oremlandii (strain OhILAs) GN=thrB PE=3 SV=1 7 340 2.0E-31
sp|C1A1Z3|KHSE_RHOE4 Homoserine kinase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=thrB PE=3 SV=1 4 328 2.0E-31
sp|Q81EK4|KHSE_BACCR Homoserine kinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=thrB PE=3 SV=1 6 341 3.0E-31
sp|A2CAU0|KHSE_PROM3 Homoserine kinase OS=Prochlorococcus marinus (strain MIT 9303) GN=thrB PE=3 SV=1 4 315 3.0E-31
sp|Q7VHF4|KHSE_HELHP Homoserine kinase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=thrB PE=3 SV=1 6 288 5.0E-31
sp|A9VQT3|KHSE_BACWK Homoserine kinase OS=Bacillus weihenstephanensis (strain KBAB4) GN=thrB PE=3 SV=1 7 346 6.0E-31
sp|C1ER94|KHSE_BACC3 Homoserine kinase OS=Bacillus cereus (strain 03BB102) GN=thrB PE=3 SV=1 6 346 6.0E-31
sp|A0RCX4|KHSE_BACAH Homoserine kinase OS=Bacillus thuringiensis (strain Al Hakam) GN=thrB PE=3 SV=1 6 346 6.0E-31
sp|B9IXW1|KHSE_BACCQ Homoserine kinase OS=Bacillus cereus (strain Q1) GN=thrB PE=3 SV=1 6 346 1.0E-30
sp|Q8ET01|KHSE_OCEIH Homoserine kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=thrB PE=3 SV=1 5 319 2.0E-30
sp|A0ALN0|KHSE_LISW6 Homoserine kinase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=thrB PE=3 SV=1 7 347 2.0E-30
sp|Q6HJZ3|KHSE_BACHK Homoserine kinase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=thrB PE=3 SV=1 6 346 2.0E-30
sp|B7JKG2|KHSE_BACC0 Homoserine kinase OS=Bacillus cereus (strain AH820) GN=thrB PE=3 SV=1 6 346 2.0E-30
sp|B1HYT4|KHSE_LYSSC Homoserine kinase OS=Lysinibacillus sphaericus (strain C3-41) GN=thrB PE=3 SV=1 1 315 3.0E-30
sp|Q81RS0|KHSE_BACAN Homoserine kinase OS=Bacillus anthracis GN=thrB PE=3 SV=1 6 346 4.0E-30
sp|C3L5M2|KHSE_BACAC Homoserine kinase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=thrB PE=3 SV=1 6 346 4.0E-30
sp|C3P7F5|KHSE_BACAA Homoserine kinase OS=Bacillus anthracis (strain A0248) GN=thrB PE=3 SV=1 6 346 4.0E-30
sp|B7IT85|KHSE_BACC2 Homoserine kinase OS=Bacillus cereus (strain G9842) GN=thrB PE=3 SV=1 6 341 5.0E-30
sp|Q739T5|KHSE_BACC1 Homoserine kinase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=thrB PE=3 SV=1 6 339 5.0E-30
sp|Q8DZI2|KHSE_STRA5 Homoserine kinase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=thrB PE=3 SV=1 7 321 6.0E-30
sp|Q8Y4A6|KHSE_LISMO Homoserine kinase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=thrB PE=1 SV=1 7 347 8.0E-30
sp|Q88Z08|KHSE_LACPL Homoserine kinase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=thrB PE=3 SV=1 6 319 8.0E-30
sp|Q5WDT6|KHSE_BACSK Homoserine kinase OS=Bacillus clausii (strain KSM-K16) GN=thrB PE=3 SV=1 5 319 9.0E-30
sp|A8AWE1|KHSE_STRGC Homoserine kinase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=thrB PE=3 SV=1 7 316 1.0E-29
sp|Q927U8|KHSE_LISIN Homoserine kinase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=thrB PE=3 SV=1 7 347 1.0E-29
sp|B8DBG4|KHSE_LISMH Homoserine kinase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=thrB PE=3 SV=1 7 347 2.0E-29
sp|Q82J66|KHSE_STRAW Homoserine kinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=thrB PE=3 SV=1 7 316 2.0E-29
sp|A7ZC67|KHSE_CAMC1 Homoserine kinase OS=Campylobacter concisus (strain 13826) GN=thrB PE=3 SV=1 6 316 2.0E-29
sp|B9DP91|KHSE_STACT Homoserine kinase OS=Staphylococcus carnosus (strain TM300) GN=thrB PE=3 SV=1 1 315 2.0E-29
sp|A0Q3H1|KHSE_CLONN Homoserine kinase OS=Clostridium novyi (strain NT) GN=thrB PE=3 SV=1 7 315 2.0E-29
sp|Q8E546|KHSE_STRA3 Homoserine kinase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=thrB PE=3 SV=1 7 321 3.0E-29
sp|Q3K0X8|KHSE_STRA1 Homoserine kinase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=thrB PE=3 SV=1 7 321 3.0E-29
sp|Q71WN3|KHSE_LISMF Homoserine kinase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=thrB PE=3 SV=1 7 347 3.0E-29
sp|B2A8C9|KHSE_NATTJ Homoserine kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=thrB PE=3 SV=1 7 312 3.0E-29
sp|C1KYW2|KHSE_LISMC Homoserine kinase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=thrB PE=3 SV=1 7 347 4.0E-29
sp|Q9ZM48|KHSE_HELPJ Homoserine kinase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=thrB PE=3 SV=1 7 316 1.0E-28
sp|A6QBQ7|KHSE_SULNB Homoserine kinase OS=Sulfurovum sp. (strain NBC37-1) GN=thrB PE=3 SV=1 7 333 2.0E-28
sp|O25690|KHSE_HELPY Homoserine kinase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=thrB PE=3 SV=1 7 316 5.0E-28
sp|B1MLU6|KHSE_MYCA9 Homoserine kinase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=thrB PE=3 SV=1 6 317 6.0E-28
sp|Q2YXT6|KHSE_STAAB Homoserine kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=thrB PE=3 SV=1 7 316 7.0E-28
sp|Q02Z13|KHSE_LACLS Homoserine kinase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=thrB PE=3 SV=1 7 315 1.0E-27
sp|A8Z213|KHSE_STAAT Homoserine kinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=thrB PE=3 SV=1 7 316 3.0E-27
sp|A6QGN2|KHSE_STAAE Homoserine kinase OS=Staphylococcus aureus (strain Newman) GN=thrB PE=3 SV=1 7 316 3.0E-27
sp|Q5HG90|KHSE_STAAC Homoserine kinase OS=Staphylococcus aureus (strain COL) GN=thrB PE=3 SV=1 7 316 3.0E-27
sp|Q2FYV2|KHSE_STAA8 Homoserine kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=thrB PE=3 SV=1 7 316 3.0E-27
sp|Q2FHA3|KHSE_STAA3 Homoserine kinase OS=Staphylococcus aureus (strain USA300) GN=thrB PE=3 SV=1 7 316 3.0E-27
sp|Q6A8B2|KHSE_PROAC Homoserine kinase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=thrB PE=3 SV=1 1 317 4.0E-27
sp|Q8NWV8|KHSE_STAAW Homoserine kinase OS=Staphylococcus aureus (strain MW2) GN=thrB PE=3 SV=1 7 316 6.0E-27
sp|Q6G9M8|KHSE_STAAS Homoserine kinase OS=Staphylococcus aureus (strain MSSA476) GN=thrB PE=3 SV=1 7 316 6.0E-27
sp|Q6GH76|KHSE_STAAR Homoserine kinase OS=Staphylococcus aureus (strain MRSA252) GN=thrB PE=3 SV=1 7 316 6.0E-27
sp|A7I3V2|KHSE_CAMHC Homoserine kinase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=thrB PE=3 SV=1 7 288 7.0E-27
sp|Q5Z0Z5|KHSE_NOCFA Homoserine kinase OS=Nocardia farcinica (strain IFM 10152) GN=thrB PE=3 SV=1 6 322 8.0E-27
sp|Q9ADB2|KHSE_STRCO Homoserine kinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=thrB PE=3 SV=1 7 316 9.0E-27
sp|Q49XB7|KHSE_STAS1 Homoserine kinase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=thrB PE=3 SV=1 7 315 1.0E-26
sp|A6Q225|KHSE_NITSB Homoserine kinase OS=Nitratiruptor sp. (strain SB155-2) GN=thrB PE=3 SV=1 7 354 2.0E-26
sp|A3CMQ4|KHSE_STRSV Homoserine kinase OS=Streptococcus sanguinis (strain SK36) GN=thrB PE=3 SV=1 7 325 2.0E-26
sp|B9L6E6|KHSE_NAUPA Homoserine kinase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=thrB PE=3 SV=1 7 316 2.0E-26
sp|A2RKV6|KHSE_LACLM Homoserine kinase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=thrB PE=3 SV=1 7 345 2.0E-26
sp|P52991|KHSE_LACLC Homoserine kinase OS=Lactococcus lactis subsp. cremoris GN=thrB PE=3 SV=1 7 345 2.0E-26
sp|Q8DUG4|KHSE_STRMU Homoserine kinase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=thrB PE=3 SV=1 7 353 3.0E-26
sp|P65229|KHSE_STAAN Homoserine kinase OS=Staphylococcus aureus (strain N315) GN=thrB PE=3 SV=1 7 316 3.0E-26
sp|P65228|KHSE_STAAM Homoserine kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=thrB PE=3 SV=1 7 316 3.0E-26
sp|A5ISL2|KHSE_STAA9 Homoserine kinase OS=Staphylococcus aureus (strain JH9) GN=thrB PE=3 SV=1 7 316 3.0E-26
sp|A6U1F0|KHSE_STAA2 Homoserine kinase OS=Staphylococcus aureus (strain JH1) GN=thrB PE=3 SV=1 7 316 3.0E-26
sp|A7X1Y2|KHSE_STAA1 Homoserine kinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=thrB PE=3 SV=1 7 316 3.0E-26
sp|Q03Y28|KHSE_LEUMM Homoserine kinase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=thrB PE=3 SV=1 7 317 3.0E-26
sp|Q9CGD7|KHSE_LACLA Homoserine kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=thrB PE=3 SV=1 7 315 4.0E-26
sp|Q72IV3|KHSE_THET2 Homoserine kinase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=thrB PE=3 SV=1 7 322 5.0E-26
sp|Q043C5|KHSE_LACGA Homoserine kinase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=thrB PE=3 SV=1 7 319 6.0E-26
sp|Q4L639|KHSE_STAHJ Homoserine kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=thrB PE=3 SV=1 1 316 7.0E-26
sp|Q5SIH5|KHSE_THET8 Homoserine kinase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=thrB PE=3 SV=1 7 322 9.0E-26
sp|Q5M5K5|KHSE_STRT2 Homoserine kinase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=thrB PE=3 SV=1 7 315 1.0E-25
sp|Q5M117|KHSE_STRT1 Homoserine kinase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=thrB PE=3 SV=1 7 315 1.0E-25
sp|Q5HPL2|KHSE_STAEQ Homoserine kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=thrB PE=3 SV=1 7 316 1.0E-25
sp|Q65FC4|KHSE_BACLD Homoserine kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=thrB PE=3 SV=1 5 319 2.0E-25
sp|Q8CSQ2|KHSE_STAES Homoserine kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=thrB PE=3 SV=1 7 316 3.0E-25
sp|A0PUL4|KHSE_MYCUA Homoserine kinase OS=Mycobacterium ulcerans (strain Agy99) GN=thrB PE=3 SV=1 15 318 3.0E-25
sp|B2GCV0|KHSE_LACF3 Homoserine kinase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=thrB PE=3 SV=1 7 315 5.0E-25
sp|Q03LY7|KHSE_STRTD Homoserine kinase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=thrB PE=3 SV=1 7 315 5.0E-25
sp|A8FJT9|KHSE_CAMJ8 Homoserine kinase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=thrB PE=3 SV=1 7 288 1.0E-24
sp|C1CQZ4|KHSE_STRZT Homoserine kinase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=thrB PE=3 SV=1 7 345 1.0E-24
sp|B9KEU8|KHSE_CAMLR Homoserine kinase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=thrB PE=3 SV=1 7 316 1.0E-24
sp|Q5HX32|KHSE_CAMJR Homoserine kinase OS=Campylobacter jejuni (strain RM1221) GN=thrB PE=3 SV=1 7 288 2.0E-24
sp|A1VXL7|KHSE_CAMJJ Homoserine kinase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=thrB PE=3 SV=1 7 288 2.0E-24
sp|P04948|KHSE_BACSU Homoserine kinase OS=Bacillus subtilis (strain 168) GN=thrB PE=3 SV=2 5 319 2.0E-24
sp|Q831T0|KHSE_ENTFA Homoserine kinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=thrB PE=3 SV=1 7 316 2.0E-24
sp|C1CL69|KHSE_STRZP Homoserine kinase OS=Streptococcus pneumoniae (strain P1031) GN=thrB PE=3 SV=1 7 318 3.0E-24
sp|C1CEU9|KHSE_STRZJ Homoserine kinase OS=Streptococcus pneumoniae (strain JJA) GN=thrB PE=3 SV=1 7 318 3.0E-24
sp|P0A3L8|KHSE_STRR6 Homoserine kinase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=thrB PE=3 SV=1 7 318 3.0E-24
sp|B2IQH7|KHSE_STRPS Homoserine kinase OS=Streptococcus pneumoniae (strain CGSP14) GN=thrB PE=3 SV=1 7 318 3.0E-24
sp|P0A3L7|KHSE_STRPN Homoserine kinase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=thrB PE=3 SV=1 7 318 3.0E-24
sp|B8ZKK9|KHSE_STRPJ Homoserine kinase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=thrB PE=3 SV=1 7 318 3.0E-24
sp|B1ICG1|KHSE_STRPI Homoserine kinase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=thrB PE=3 SV=1 7 318 3.0E-24
sp|C1C7W1|KHSE_STRP7 Homoserine kinase OS=Streptococcus pneumoniae (strain 70585) GN=thrB PE=3 SV=1 7 318 3.0E-24
sp|B5E5F6|KHSE_STRP4 Homoserine kinase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=thrB PE=3 SV=1 7 318 3.0E-24
sp|Q04JY7|KHSE_STRP2 Homoserine kinase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=thrB PE=3 SV=1 7 318 3.0E-24
sp|P45836|KHSE_MYCLE Homoserine kinase OS=Mycobacterium leprae (strain TN) GN=thrB PE=3 SV=2 15 318 5.0E-24
sp|B8ZR28|KHSE_MYCLB Homoserine kinase OS=Mycobacterium leprae (strain Br4923) GN=thrB PE=3 SV=1 15 318 5.0E-24
sp|A7H1L3|KHSE_CAMJD Homoserine kinase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=thrB PE=3 SV=1 7 288 5.0E-24
sp|A7Z8E0|KHSE_BACMF Homoserine kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=thrB PE=3 SV=1 5 319 5.0E-24
sp|Q5FJS7|KHSE_LACAC Homoserine kinase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=thrB PE=3 SV=1 7 313 2.0E-23
sp|B9DRZ0|KHSE_STRU0 Homoserine kinase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=thrB PE=3 SV=1 7 345 2.0E-23
sp|Q9PIZ3|KHSE_CAMJE Homoserine kinase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=thrB PE=3 SV=1 7 288 2.0E-23
sp|A4VUI0|KHSE_STRSY Homoserine kinase OS=Streptococcus suis (strain 05ZYH33) GN=thrB PE=3 SV=1 7 352 2.0E-23
sp|A4W0S2|KHSE_STRS2 Homoserine kinase OS=Streptococcus suis (strain 98HAH33) GN=thrB PE=3 SV=1 7 352 2.0E-23
sp|Q73X44|KHSE_MYCPA Homoserine kinase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=thrB PE=3 SV=1 15 317 1.0E-22
sp|C0MEX3|KHSE_STRS7 Homoserine kinase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=thrB PE=3 SV=1 7 315 4.0E-21
sp|A0RQZ6|KHSE_CAMFF Homoserine kinase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=thrB PE=3 SV=1 7 316 4.0E-21
sp|A3Q3C9|KHSE_MYCSJ Homoserine kinase OS=Mycobacterium sp. (strain JLS) GN=thrB PE=3 SV=1 6 318 5.0E-21
sp|A0R219|KHSE_MYCS2 Homoserine kinase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=thrB PE=3 SV=1 6 318 6.0E-21
sp|A8FH24|KHSE_BACP2 Homoserine kinase OS=Bacillus pumilus (strain SAFR-032) GN=thrB PE=3 SV=1 5 319 6.0E-21
sp|C0MA57|KHSE_STRE4 Homoserine kinase OS=Streptococcus equi subsp. equi (strain 4047) GN=thrB PE=3 SV=1 7 325 2.0E-20
sp|C4K7E6|KHSE_HAMD5 Homoserine kinase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=thrB PE=3 SV=1 10 316 5.0E-20
sp|P9WKE7|KHSE_MYCTU Homoserine kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=thrB PE=1 SV=1 15 317 7.0E-20
sp|P9WKE6|KHSE_MYCTO Homoserine kinase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=thrB PE=3 SV=1 15 317 7.0E-20
sp|P65225|KHSE_MYCBO Homoserine kinase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=thrB PE=3 SV=1 15 317 7.0E-20
sp|Q8FLD8|KHSE_ECOL6 Homoserine kinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thrB PE=3 SV=1 7 316 1.0E-19
sp|B5YY97|KHSE_ECO5E Homoserine kinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=thrB PE=3 SV=1 7 316 1.0E-19
sp|Q8XA82|KHSE_ECO57 Homoserine kinase OS=Escherichia coli O157:H7 GN=thrB PE=3 SV=1 7 316 1.0E-19
sp|B1LFT4|KHSE_ECOSM Homoserine kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|Q83MH9|KHSE_SHIFL Homoserine kinase OS=Shigella flexneri GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|Q0T8I5|KHSE_SHIF8 Homoserine kinase OS=Shigella flexneri serotype 5b (strain 8401) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|B7N7M8|KHSE_ECOLU Homoserine kinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|P00547|KHSE_ECOLI Homoserine kinase OS=Escherichia coli (strain K12) GN=thrB PE=1 SV=2 7 316 2.0E-19
sp|B1XBC8|KHSE_ECODH Homoserine kinase OS=Escherichia coli (strain K12 / DH10B) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|C4ZPT0|KHSE_ECOBW Homoserine kinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|Q32KB5|KHSE_SHIDS Homoserine kinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|Q326L9|KHSE_SHIBS Homoserine kinase OS=Shigella boydii serotype 4 (strain Sb227) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|B2U219|KHSE_SHIB3 Homoserine kinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|Q1RGK1|KHSE_ECOUT Homoserine kinase OS=Escherichia coli (strain UTI89 / UPEC) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|B1IRH0|KHSE_ECOLC Homoserine kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|A1A756|KHSE_ECOK1 Homoserine kinase OS=Escherichia coli O1:K1 / APEC GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|A7ZVW2|KHSE_ECOHS Homoserine kinase OS=Escherichia coli O9:H4 (strain HS) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|B7M0A0|KHSE_ECO8A Homoserine kinase OS=Escherichia coli O8 (strain IAI1) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|B7NHA6|KHSE_ECO7I Homoserine kinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|B7L4C8|KHSE_ECO55 Homoserine kinase OS=Escherichia coli (strain 55989 / EAEC) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|B7M9R6|KHSE_ECO45 Homoserine kinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|B7UI48|KHSE_ECO27 Homoserine kinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|A7ZH92|KHSE_ECO24 Homoserine kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|B7N2U2|KHSE_ECO81 Homoserine kinase OS=Escherichia coli O81 (strain ED1a) GN=thrB PE=3 SV=1 7 316 2.0E-19
sp|A7MIJ7|KHSE_CROS8 Homoserine kinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=thrB PE=3 SV=1 7 316 5.0E-19
sp|Q3Z611|KHSE_SHISS Homoserine kinase OS=Shigella sonnei (strain Ss046) GN=thrB PE=3 SV=1 7 316 8.0E-19
sp|B6HZ00|KHSE_ECOSE Homoserine kinase OS=Escherichia coli (strain SE11) GN=thrB PE=3 SV=1 7 316 8.0E-19
sp|Q1B535|KHSE_MYCSS Homoserine kinase OS=Mycobacterium sp. (strain MCS) GN=thrB PE=3 SV=1 15 318 1.0E-18
sp|A1UK02|KHSE_MYCSK Homoserine kinase OS=Mycobacterium sp. (strain KMS) GN=thrB PE=3 SV=1 15 318 1.0E-18
sp|Q0W2X4|KHSE_METAR Homoserine kinase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=thrB PE=3 SV=1 6 315 1.0E-18
sp|A1TD73|KHSE_MYCVP Homoserine kinase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=thrB PE=3 SV=1 15 317 1.0E-18
sp|P27722|KHSE_SERMA Homoserine kinase OS=Serratia marcescens GN=thrB PE=3 SV=1 7 346 5.0E-18
sp|Q0TLY6|KHSE_ECOL5 Homoserine kinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thrB PE=3 SV=1 7 316 6.0E-18
sp|A8ALV4|KHSE_CITK8 Homoserine kinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=thrB PE=3 SV=1 7 316 7.0E-18
sp|O58814|KHSE_PYRHO Homoserine kinase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=thrB PE=3 SV=2 3 318 7.0E-18
sp|B5FH97|KHSE_SALDC Homoserine kinase OS=Salmonella dublin (strain CT_02021853) GN=thrB PE=3 SV=1 7 316 2.0E-17
sp|A9MR86|KHSE_SALAR Homoserine kinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=thrB PE=3 SV=1 7 316 2.0E-17
sp|P65226|KHSE_SALTY Homoserine kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|P65227|KHSE_SALTI Homoserine kinase OS=Salmonella typhi GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|B4TVY5|KHSE_SALSV Homoserine kinase OS=Salmonella schwarzengrund (strain CVM19633) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|B5BLG9|KHSE_SALPK Homoserine kinase OS=Salmonella paratyphi A (strain AKU_12601) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|C0Q4E3|KHSE_SALPC Homoserine kinase OS=Salmonella paratyphi C (strain RKS4594) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|Q5PDM3|KHSE_SALPA Homoserine kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|B4T6C6|KHSE_SALNS Homoserine kinase OS=Salmonella newport (strain SL254) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|B4TIA4|KHSE_SALHS Homoserine kinase OS=Salmonella heidelberg (strain SL476) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|B5REZ9|KHSE_SALG2 Homoserine kinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|B5R5H5|KHSE_SALEP Homoserine kinase OS=Salmonella enteritidis PT4 (strain P125109) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|Q57TQ2|KHSE_SALCH Homoserine kinase OS=Salmonella choleraesuis (strain SC-B67) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|B5F6C2|KHSE_SALA4 Homoserine kinase OS=Salmonella agona (strain SL483) GN=thrB PE=3 SV=1 7 316 3.0E-17
sp|Q9WZ15|KHSE_THEMA Homoserine kinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=thrB PE=3 SV=1 9 323 3.0E-17
sp|A8G9K0|KHSE_SERP5 Homoserine kinase OS=Serratia proteamaculans (strain 568) GN=thrB PE=3 SV=1 7 322 4.0E-17
sp|A6T4E3|KHSE_KLEP7 Homoserine kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=thrB PE=3 SV=1 7 316 5.0E-17
sp|A6URT1|KHSE_METVS Homoserine kinase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=thrB PE=3 SV=1 4 333 6.0E-17
sp|Q65RV1|KHSE_MANSM Homoserine kinase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=thrB PE=3 SV=1 7 316 6.0E-17
sp|A9MXH1|KHSE_SALPB Homoserine kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=thrB PE=3 SV=1 7 316 9.0E-17
sp|A5IJN0|KHSE_THEP1 Homoserine kinase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=thrB PE=3 SV=1 9 323 9.0E-17
sp|P44504|KHSE_HAEIN Homoserine kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thrB PE=3 SV=1 7 316 1.0E-16
sp|A5UFQ1|KHSE_HAEIG Homoserine kinase OS=Haemophilus influenzae (strain PittGG) GN=thrB PE=3 SV=1 7 316 1.0E-16
sp|A5UB54|KHSE_HAEIE Homoserine kinase OS=Haemophilus influenzae (strain PittEE) GN=thrB PE=3 SV=1 7 316 1.0E-16
sp|B5Y254|KHSE_KLEP3 Homoserine kinase OS=Klebsiella pneumoniae (strain 342) GN=thrB PE=3 SV=1 7 316 2.0E-16
sp|Q7N8Z5|KHSE_PHOLL Homoserine kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=thrB PE=3 SV=1 7 335 2.0E-16
sp|Q4QP96|KHSE_HAEI8 Homoserine kinase OS=Haemophilus influenzae (strain 86-028NP) GN=thrB PE=3 SV=1 7 316 3.0E-16
sp|B1JL13|KHSE_YERPY Homoserine kinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=thrB PE=3 SV=1 7 317 3.0E-16
sp|Q66ET8|KHSE_YERPS Homoserine kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=thrB PE=3 SV=1 7 317 3.0E-16
sp|A4TQG9|KHSE_YERPP Homoserine kinase OS=Yersinia pestis (strain Pestoides F) GN=thrB PE=3 SV=1 7 317 3.0E-16
sp|Q1CMW6|KHSE_YERPN Homoserine kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=thrB PE=1 SV=1 7 317 3.0E-16
sp|A9R025|KHSE_YERPG Homoserine kinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=thrB PE=3 SV=1 7 317 3.0E-16
sp|Q8ZIN5|KHSE_YERPE Homoserine kinase OS=Yersinia pestis GN=thrB PE=3 SV=1 7 317 3.0E-16
sp|B2K3L2|KHSE_YERPB Homoserine kinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=thrB PE=3 SV=1 7 317 3.0E-16
sp|Q1C0K9|KHSE_YERPA Homoserine kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=thrB PE=3 SV=1 7 317 3.0E-16
sp|A7FMF2|KHSE_YERP3 Homoserine kinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=thrB PE=3 SV=1 7 317 3.0E-16
sp|C3LQD5|KHSE_VIBCM Homoserine kinase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=thrB PE=3 SV=1 6 337 4.0E-16
sp|Q9KPK4|KHSE_VIBCH Homoserine kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thrB PE=3 SV=1 6 337 4.0E-16
sp|A6UV93|KHSE_META3 Homoserine kinase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=thrB PE=3 SV=1 10 333 6.0E-16
sp|Q87SC9|KHSE_VIBPA Homoserine kinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thrB PE=3 SV=1 6 346 1.0E-15
sp|Q9CPD3|KHSE_PASMU Homoserine kinase OS=Pasteurella multocida (strain Pm70) GN=thrB PE=3 SV=1 7 316 2.0E-15
sp|B2VH20|KHSE_ERWT9 Homoserine kinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=thrB PE=3 SV=1 7 318 2.0E-15
sp|Q8K9V0|KHSE_BUCAP Homoserine kinase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=thrB PE=3 SV=1 7 316 3.0E-15
sp|A4SGN0|KHSE_CHLPM Homoserine kinase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=thrB PE=3 SV=1 11 316 3.0E-15
sp|Q0I3T3|KHSE_HAES1 Homoserine kinase OS=Haemophilus somnus (strain 129Pt) GN=thrB PE=3 SV=1 7 316 3.0E-15
sp|Q6D0A9|KHSE_PECAS Homoserine kinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=thrB PE=3 SV=1 7 317 3.0E-15
sp|A1JJC7|KHSE_YERE8 Homoserine kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=thrB PE=3 SV=1 7 317 4.0E-15
sp|B7LWR1|KHSE_ESCF3 Homoserine kinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=thrB PE=3 SV=1 7 316 6.0E-15
sp|A9A802|KHSE_METM6 Homoserine kinase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=thrB PE=3 SV=1 4 315 6.0E-15
sp|B0UWP6|KHSE_HISS2 Homoserine kinase OS=Histophilus somni (strain 2336) GN=thrB PE=3 SV=1 7 316 6.0E-15
sp|B7VJ36|KHSE_VIBTL Homoserine kinase OS=Vibrio tasmaniensis (strain LGP32) GN=thrB PE=3 SV=1 6 346 7.0E-15
sp|C6DF18|KHSE_PECCP Homoserine kinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=thrB PE=3 SV=1 7 317 2.0E-14
sp|C5B7K5|KHSE_EDWI9 Homoserine kinase OS=Edwardsiella ictaluri (strain 93-146) GN=thrB PE=3 SV=1 7 316 3.0E-14
sp|P59568|KHSE_BUCBP Homoserine kinase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=thrB PE=3 SV=1 7 316 4.0E-14
sp|B9LS04|KHSE_HALLT Homoserine kinase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=thrB PE=3 SV=1 6 354 4.0E-14
sp|Q6LUP9|KHSE_PHOPR Homoserine kinase OS=Photobacterium profundum GN=thrB PE=3 SV=1 6 317 5.0E-14
sp|B5FAK1|KHSE_VIBFM Homoserine kinase OS=Vibrio fischeri (strain MJ11) GN=thrB PE=3 SV=1 6 317 7.0E-14
sp|A4FZP2|KHSE_METM5 Homoserine kinase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=thrB PE=3 SV=1 4 315 8.0E-14
sp|Q2NVZ5|KHSE_SODGM Homoserine kinase OS=Sodalis glossinidius (strain morsitans) GN=thrB PE=3 SV=1 7 316 8.0E-14
sp|Q6M0H5|KHSE_METMP Homoserine kinase OS=Methanococcus maripaludis (strain S2 / LL) GN=thrB PE=1 SV=1 4 315 1.0E-13
sp|Q975A7|KHSE_SULTO Homoserine kinase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=thrB PE=3 SV=1 7 351 1.0E-13
sp|A6VIT5|KHSE_METM7 Homoserine kinase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=thrB PE=3 SV=1 4 315 1.0E-13
sp|B6EKY7|KHSE_ALISL Homoserine kinase OS=Aliivibrio salmonicida (strain LFI1238) GN=thrB PE=3 SV=1 6 346 2.0E-13
sp|Q5E2Y4|KHSE_VIBF1 Homoserine kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=thrB PE=3 SV=1 6 316 2.0E-13
sp|A5F5R9|KHSE_VIBC3 Homoserine kinase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=thrB PE=3 SV=1 6 337 4.0E-13
sp|Q7MNR4|KHSE_VIBVY Homoserine kinase OS=Vibrio vulnificus (strain YJ016) GN=thrB PE=3 SV=2 6 316 5.0E-13
sp|Q8DEP3|KHSE_VIBVU Homoserine kinase OS=Vibrio vulnificus (strain CMCP6) GN=thrB PE=3 SV=1 6 316 5.0E-13
sp|Q8ZZX3|KHSE_PYRAE Homoserine kinase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=thrB PE=3 SV=1 7 349 2.0E-12
sp|Q3INF0|KHSE_NATPD Homoserine kinase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=thrB PE=3 SV=1 6 337 2.0E-12
sp|A1BJF6|KHSE_CHLPD Homoserine kinase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=thrB PE=3 SV=1 11 317 4.0E-12
sp|Q5UXG4|KHSE_HALMA Homoserine kinase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=thrB PE=3 SV=2 6 351 2.0E-11
sp|Q8U1Z9|KHSE_PYRFU Homoserine kinase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=thrB PE=3 SV=1 10 350 2.0E-10
sp|Q057U7|KHSE_BUCCC Homoserine kinase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=thrB PE=3 SV=1 7 337 7.0E-10
sp|Q58504|KHSE_METJA Homoserine kinase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=thrB PE=1 SV=2 4 320 1.0E-09
sp|Q8L7R2|KHSE_ARATH Homoserine kinase OS=Arabidopsis thaliana GN=HSK PE=1 SV=1 10 351 2.0E-09
sp|C3MU21|KHSE_SULIM Homoserine kinase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=thrB PE=3 SV=1 1 148 4.0E-09
sp|C3MK52|KHSE_SULIL Homoserine kinase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=thrB PE=3 SV=1 1 148 4.0E-09
sp|C4KK76|KHSE_SULIK Homoserine kinase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=thrB PE=3 SV=1 1 148 4.0E-09
sp|C3N0N3|KHSE_SULIA Homoserine kinase OS=Sulfolobus islandicus (strain M.16.27) GN=thrB PE=3 SV=1 1 148 4.0E-09
sp|C3N8M1|KHSE_SULIY Homoserine kinase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=thrB PE=3 SV=1 1 148 4.0E-09
sp|C3NM92|KHSE_SULIN Homoserine kinase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=thrB PE=3 SV=1 1 148 4.0E-09
sp|Q18F42|KHSE_HALWD Homoserine kinase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=thrB PE=3 SV=2 6 315 5.0E-09
sp|B3EL38|KHSE_CHLPB Homoserine kinase OS=Chlorobium phaeobacteroides (strain BS1) GN=thrB PE=3 SV=1 11 317 8.0E-09
sp|Q6L1U1|KHSE_PICTO Homoserine kinase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=thrB PE=3 SV=1 11 315 1.0E-08
sp|B3QWX6|KHSE_CHLT3 Homoserine kinase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=thrB PE=3 SV=1 10 340 3.0E-08
sp|Q8KAW7|KHSE_CHLTE Homoserine kinase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=thrB PE=3 SV=1 11 317 6.0E-08
sp|Q8TYG6|KHSE_METKA Homoserine kinase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=thrB PE=3 SV=1 2 333 9.0E-08
sp|Q979X5|KHSE_THEVO Homoserine kinase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=thrB PE=3 SV=1 1 321 3.0E-07
sp|Q87C24|KHSE_XYLFT Homoserine kinase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=thrB PE=3 SV=1 10 314 3.0E-07
sp|B0U3B8|KHSE_XYLFM Homoserine kinase OS=Xylella fastidiosa (strain M12) GN=thrB PE=3 SV=1 10 314 3.0E-07
sp|B2I5Y6|KHSE_XYLF2 Homoserine kinase OS=Xylella fastidiosa (strain M23) GN=thrB PE=3 SV=1 10 314 3.0E-07
sp|C5A1P1|KHSE_THEGJ Homoserine kinase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=thrB PE=3 SV=1 215 339 6.0E-07
sp|A1RQK6|KHSE_PYRIL Homoserine kinase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=thrB PE=3 SV=1 218 315 6.0E-07
sp|Q9PBC0|KHSE_XYLFA Homoserine kinase OS=Xylella fastidiosa (strain 9a5c) GN=thrB PE=3 SV=1 10 314 1.0E-06
sp|Q5JH53|KHSE_THEKO Homoserine kinase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=thrB PE=3 SV=1 215 340 3.0E-06
sp|Q9HP55|KHSE_HALSA Homoserine kinase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=thrB PE=3 SV=1 6 315 5.0E-06
sp|B0R6D7|KHSE_HALS3 Homoserine kinase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=thrB PE=3 SV=1 6 315 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:1901265 nucleoside phosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008990
MPCKYTIKVPATSANIGPGFDVVGLSLSLLLTLTVTIDTPSTSTTPYIHPKITYSGEGADEVPLDAYKNLTTRVA
LYVLRCHDINRFPSHLSIHAHNEIPFGRGLGSSGAAVIAGVLLGNILGNLTLSTERLLDFALMVERHPDNVTAAL
VGGFVGSYLKELDDAASLAASVPLSEVLPEYPDDAGEEWGLNPPRPPLGIGHYVKFGWSEGIKAVAIIPRFELST
AKARSVLPTEYSRKDLVFNMQRLAVLTTALAQTPPDPDLIYDAMKDRVHQPYRKTLIPGLPEVTSQITPATHPGL
LGICLSGAGPTILALATHGFEAIAEDARVIFKQKDIEIDWKLLQVTGGCSVIQEVYE*
Coding >AgabiH97|008990
ATGCCTTGCAAGTATACAATCAAAGTACCAGCCACATCGGCCAACATCGGGCCCGGATTCGATGTCGTTGGACTC
TCTCTCTCTCTGCTCCTTACCCTCACCGTCACCATCGACACTCCATCCACATCCACCACCCCTTATATCCACCCT
AAAATCACCTACTCTGGCGAAGGGGCCGACGAAGTCCCTTTGGATGCCTACAAAAACCTCACCACGCGTGTAGCT
CTCTACGTTCTTCGATGTCACGACATCAACCGATTCCCCTCCCACCTCTCCATCCACGCCCACAATGAAATCCCC
TTTGGCAGAGGCCTAGGATCATCCGGAGCAGCAGTCATAGCAGGAGTCCTCCTCGGCAACATTTTAGGAAACCTC
ACCCTCTCAACCGAGAGATTACTCGATTTCGCATTGATGGTCGAACGTCATCCAGATAATGTGACTGCAGCTTTA
GTAGGTGGATTTGTAGGATCGTATTTGAAGGAATTGGATGATGCGGCGAGTTTGGCTGCGAGTGTACCTTTGAGT
GAGGTTTTACCGGAATATCCGGATGATGCTGGAGAAGAGTGGGGGTTGAATCCGCCTAGACCGCCTTTGGGGATT
GGACATTATGTGAAGTTTGGTTGGTCGGAGGGGATTAAGGCTGTTGCTATCATTCCTCGGTTTGAATTGAGTACG
GCTAAAGCGAGAAGTGTACTACCTACTGAATATTCAAGAAAAGATCTGGTTTTTAACATGCAAAGATTGGCTGTA
CTCACCACCGCCCTTGCTCAAACACCACCTGATCCTGATCTCATTTACGACGCAATGAAAGATCGTGTACACCAG
CCCTACAGAAAAACCCTTATTCCGGGACTGCCAGAAGTGACATCTCAGATCACTCCTGCCACCCACCCTGGTTTA
CTAGGTATCTGCCTTTCTGGCGCTGGCCCTACTATTCTCGCCCTCGCCACTCACGGCTTCGAAGCCATTGCCGAA
GACGCTCGCGTCATTTTCAAACAAAAAGATATTGAGATAGATTGGAAATTACTTCAAGTTACGGGTGGTTGTAGC
GTTATACAAGAGGTCTATGAATAA
Transcript >AgabiH97|008990
ATGCCTTGCAAGTATACAATCAAAGTACCAGCCACATCGGCCAACATCGGGCCCGGATTCGATGTCGTTGGACTC
TCTCTCTCTCTGCTCCTTACCCTCACCGTCACCATCGACACTCCATCCACATCCACCACCCCTTATATCCACCCT
AAAATCACCTACTCTGGCGAAGGGGCCGACGAAGTCCCTTTGGATGCCTACAAAAACCTCACCACGCGTGTAGCT
CTCTACGTTCTTCGATGTCACGACATCAACCGATTCCCCTCCCACCTCTCCATCCACGCCCACAATGAAATCCCC
TTTGGCAGAGGCCTAGGATCATCCGGAGCAGCAGTCATAGCAGGAGTCCTCCTCGGCAACATTTTAGGAAACCTC
ACCCTCTCAACCGAGAGATTACTCGATTTCGCATTGATGGTCGAACGTCATCCAGATAATGTGACTGCAGCTTTA
GTAGGTGGATTTGTAGGATCGTATTTGAAGGAATTGGATGATGCGGCGAGTTTGGCTGCGAGTGTACCTTTGAGT
GAGGTTTTACCGGAATATCCGGATGATGCTGGAGAAGAGTGGGGGTTGAATCCGCCTAGACCGCCTTTGGGGATT
GGACATTATGTGAAGTTTGGTTGGTCGGAGGGGATTAAGGCTGTTGCTATCATTCCTCGGTTTGAATTGAGTACG
GCTAAAGCGAGAAGTGTACTACCTACTGAATATTCAAGAAAAGATCTGGTTTTTAACATGCAAAGATTGGCTGTA
CTCACCACCGCCCTTGCTCAAACACCACCTGATCCTGATCTCATTTACGACGCAATGAAAGATCGTGTACACCAG
CCCTACAGAAAAACCCTTATTCCGGGACTGCCAGAAGTGACATCTCAGATCACTCCTGCCACCCACCCTGGTTTA
CTAGGTATCTGCCTTTCTGGCGCTGGCCCTACTATTCTCGCCCTCGCCACTCACGGCTTCGAAGCCATTGCCGAA
GACGCTCGCGTCATTTTCAAACAAAAAGATATTGAGATAGATTGGAAATTACTTCAAGTTACGGGTGGTTGTAGC
GTTATACAAGAGGTCTATGAATAA
Gene >AgabiH97|008990
ATGCCTTGCAAGTATACAATCAAAGTACCAGCCACATCGGCCAACATCGGGCCCGGATTCGATGTCGTTGGACTC
TCTCTCTCTCTGCTCCTTACCCTCACCGTCACCATCGACACTCCATCCACATCCACCACCCCTTATATCCACCCT
AAAATCACCTACTCTGGCGAAGGGGCCGACGAAGTCCCTTTGGATGCCTACAAAAACCTCACCACGCGTGTAGCT
CTCTACGTTCTTCGATGTCACGACATCAACCGATTCCCCTCCCACCTCTCCATCCACGCCCACAATGAAATCCCC
TTTGGCAGAGGCCTAGGATCATCCGGAGCAGCAGTCATAGCAGGAGTCCTCCTCGGCAACATTTTAGGAAACCTC
ACCCTCTCAACCGAGAGATTACTCGATTTCGCATTGATGGTCGAACGTCATCCAGATAATGTGACTGCAGCTTTA
GTAGGTGGATTTGTAGGATCGTATTTGAAGGAATTGGATGATGCGGCGAGTTTGGCTGCGAGTGTACCTTTGAGT
GAGGTTTTACCGGAATATCCGGATGATGCTGGAGAAGAGTGGGGGTTGAATCCGCCTAGACCGCCTTTGGGGATT
GGACATTATGTGAAGTTTGGTTGGTCGGAGGGGATTAAGGCTGTTGCTATCATTCCTCGGTTTGAATTGAGTACG
GCTAAAGCGAGAAGTGTACTACCTACTGAATATTCAAGAAAAGATCTGGTCAGTCATCACTTATTATTATTATCA
GAATCCATTTAATTCATTTTTTTTTTGTGTACCAGGTTTTTAACATGCAAAGATTGGCTGTACTCACCACCGCCC
TTGCTCAAACACCACCTGATCCTGATCTCATTTACGACGCAATGAAAGATCGTGTACACCAGCCCTACAGAAAAA
CCCTTGTATGTAAATCCTTCTCCTCCACATCTTTTTTACTCAAGAAACCCTTTCTAGATTCCGGGACTGCCAGAA
GTGACATCTCAGATCACTCCTGCCACCCACCCTGGTTTACTAGGTATCTGCCTTTCTGGCGCTGGCCCTACTATT
CTCGCCCTCGCCACTCACGGCTTCGAAGCCATTGCCGAAGACGCTCGCGTCATTTTCAAACAAAAAGATATTGAG
ATAGATTGGAAATTACTTCAAGTTACGGGTGGTTGTAGCGTTATACAAGAGGTCTATGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail