Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008920
Gene name
Locationscaffold_1:2097969..2099637
Strand-
Gene length (bp)1668
Transcript length (bp)1389
Coding sequence length (bp)1389
Protein length (aa) 463

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 26.46 14.79 38.13
Initials Initials knots 23.04 12.78 33.31
Pileal_Stipeal_center Stage I stipe center 6.87 3.10 10.64
Pileal_Stipeal_shell Stage I stipe shell 3.03 1.19 4.87
DIF_stipe_center Stage II stipe center 2.96 1.22 4.70
DIF_stipe_shell Stage II stipe shell 4.28 1.87 6.69
DIF_stipe_skin Stage II stipe skin 6.36 2.82 9.90
DIF_cap_skin Stage II cap skin 1.46 0.50 2.41
DIF_cap_tissue Stage II cap tissue 1.80 0.57 3.04
DIF_gill_tissue Stage II gill tissue 2.09 0.78 3.41
YFB_stipe_center Young fruiting body stipe center 56.25 22.90 89.60
YFB_stipe_shell Young fruiting body stipe shell 8.30 3.53 13.06
YFB_stipe_skin Young fruiting body stipe skin 5.82 2.60 9.03
YFB_cap_skin Young fruiting body cap skin 1.45 0.51 2.40
YFB_cap_tissue Young fruiting body cap tissue 0.71 0.16 1.26
YFB_gill_tissue Young fruiting body gill tissue 2.09 0.81 3.37
YFB_veil Young fruiting body veil 2.57 1.04 4.10

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.021322 yes
Casing YFB_stipe_shell 0.001140 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.771994 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.009773 yes
DIF_gill_tissue YFB_cap_skin 0.525018 no
DIF_gill_tissue YFB_cap_tissue 0.022369 yes
DIF_gill_tissue YFB_gill_tissue 0.996078 no
DIF_gill_tissue YFB_veil 0.757433 no
YFB_stipe_center YFB_stipe_shell 0.000613 yes
YFB_stipe_center YFB_stipe_skin 0.000613 yes
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.432990 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.004160 yes
YFB_stipe_skin YFB_veil 0.032978 yes
YFB_cap_skin YFB_cap_tissue 0.159859 no
YFB_cap_skin YFB_gill_tissue 0.508639 no
YFB_cap_skin YFB_veil 0.220912 no
YFB_cap_tissue YFB_gill_tissue 0.016669 yes
YFB_cap_tissue YFB_veil 0.003765 yes
YFB_gill_tissue YFB_veil 0.750817 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.007439 yes
Initials YFB_stipe_shell 0.002084 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.001140 yes
Pileal_Stipeal_center YFB_stipe_center 0.000613 yes
Pileal_Stipeal_center YFB_stipe_shell 0.745186 no
Pileal_Stipeal_center YFB_stipe_skin 0.783101 no
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.007092 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.035993 yes
Pileal_Stipeal_center DIF_stipe_center 0.026461 yes
Pileal_Stipeal_center DIF_stipe_shell 0.273446 no
Pileal_Stipeal_center DIF_stipe_skin 0.914013 no
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.001140 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.507062 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.012274 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.121880 no
Pileal_Stipeal_shell YFB_cap_skin 0.098442 no
Pileal_Stipeal_shell YFB_cap_tissue 0.001625 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.492314 no
Pileal_Stipeal_shell YFB_veil 0.814939 no
Pileal_Stipeal_shell DIF_stipe_center 0.978566 no
Pileal_Stipeal_shell DIF_stipe_shell 0.514242 no
Pileal_Stipeal_shell DIF_stipe_skin 0.068270 no
Pileal_Stipeal_shell DIF_cap_skin 0.096624 no
Pileal_Stipeal_shell DIF_cap_tissue 0.308159 no
DIF_stipe_center DIF_gill_tissue 0.529397 no
DIF_stipe_center YFB_stipe_center 0.000613 yes
DIF_stipe_center YFB_stipe_shell 0.004548 yes
DIF_stipe_center YFB_stipe_skin 0.090496 no
DIF_stipe_center YFB_cap_skin 0.099595 no
DIF_stipe_center YFB_cap_tissue 0.002525 yes
DIF_stipe_center YFB_gill_tissue 0.515837 no
DIF_stipe_center YFB_veil 0.841172 no
DIF_stipe_center DIF_stipe_shell 0.463307 no
DIF_stipe_center DIF_stipe_skin 0.049257 yes
DIF_stipe_center DIF_cap_skin 0.098609 no
DIF_stipe_center DIF_cap_tissue 0.323160 no
DIF_stipe_shell DIF_gill_tissue 0.096296 no
DIF_stipe_shell YFB_stipe_center 0.000613 yes
DIF_stipe_shell YFB_stipe_shell 0.085898 no
DIF_stipe_shell YFB_stipe_skin 0.533046 no
DIF_stipe_shell YFB_cap_skin 0.006742 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.077879 no
DIF_stipe_shell YFB_veil 0.252939 no
DIF_stipe_shell DIF_stipe_skin 0.386575 no
DIF_stipe_shell DIF_cap_skin 0.004548 yes
DIF_stipe_shell DIF_cap_tissue 0.037593 yes
DIF_stipe_skin DIF_gill_tissue 0.002525 yes
DIF_stipe_skin YFB_stipe_center 0.000613 yes
DIF_stipe_skin YFB_stipe_shell 0.597253 no
DIF_stipe_skin YFB_stipe_skin 0.894002 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.001625 yes
DIF_stipe_skin YFB_veil 0.013186 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.001625 yes
DIF_cap_skin DIF_gill_tissue 0.519590 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.994991 no
DIF_cap_skin YFB_cap_tissue 0.155441 no
DIF_cap_skin YFB_gill_tissue 0.504198 no
DIF_cap_skin YFB_veil 0.223485 no
DIF_cap_skin DIF_cap_tissue 0.755490 no
DIF_cap_tissue DIF_gill_tissue 0.848746 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.003765 yes
DIF_cap_tissue YFB_cap_skin 0.756179 no
DIF_cap_tissue YFB_cap_tissue 0.051723 no
DIF_cap_tissue YFB_gill_tissue 0.844077 no
DIF_cap_tissue YFB_veil 0.533287 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008920
MMQLRSALLTLALVLAVSSHPTLDRRASFTLKNGQDAIALNQKFSKLTANSPCQSGENACVDQKFAQCIGGKFVL
QACGPGTTCSALPLVNSPGTSITCTTEADAAARIAATGAQSAGGNTGNNSGSEDNNDDAGGAAGDDSDTGNDGGA
NNAGDGGAAGNDNNTGNNGGANNAGGGAAGNDNNTGNDGGANNAGGGAAGNDNNTGNNGGANNAGGGAAGNDNDT
DNNGGANNAGGGGAAGNNDNSDPQKSSTLDPDVIAKGFANDGQDVPVDGQVASLTSTNNFINFCKDINLPITNGE
QKTGGSCNPTPMGAIPSTSVMPSSKFVFPKNGGTVPANKKFTLKMAIKNVDTGNFVNAQSNYYAAPQHLNAQGII
IGHSHVVVEKLDSMTQTTPTDPNVFAFFKGVNGKADAQGVLNVDVDKGLPAGTYKLSSINAAANHQPVLVAVAQH
GSLDDVVYFTVQ*
Coding >AgabiH97|008920
ATGATGCAACTGCGTTCTGCTCTTCTGACCCTGGCACTTGTTCTTGCAGTATCTTCTCATCCCACTCTGGATCGT
CGTGCTTCCTTCACTCTCAAGAATGGTCAAGATGCAATTGCATTAAATCAAAAGTTTAGCAAGCTTACTGCCAAC
TCCCCCTGCCAGTCGGGGGAAAACGCTTGTGTAGACCAAAAGTTTGCCCAGTGTATCGGCGGGAAATTTGTCCTT
CAAGCATGTGGCCCGGGCACGACTTGTTCAGCACTGCCTCTTGTCAATTCACCAGGAACATCTATTACTTGCACC
ACAGAAGCTGATGCAGCTGCTCGCATCGCCGCGACTGGTGCCCAATCTGCCGGCGGCAACACTGGAAATAATTCC
GGGTCTGAAGATAATAATGATGATGCCGGTGGTGCTGCCGGAGATGACAGCGATACTGGTAACGATGGGGGAGCG
AACAACGCTGGTGACGGTGGCGCAGCCGGGAATGATAACAACACAGGCAACAACGGCGGGGCTAATAACGCTGGT
GGTGGCGCAGCCGGGAATGATAACAACACGGGCAACGATGGAGGGGCTAATAACGCTGGTGGCGGCGCAGCCGGG
AATGATAACAACACAGGCAACAATGGCGGGGCCAATAACGCTGGTGGCGGCGCAGCTGGGAATGATAACGATACC
GACAACAATGGTGGTGCTAACAACGCTGGTGGCGGTGGTGCAGCTGGAAACAACGACAACAGTGACCCACAAAAG
TCATCAACTCTGGACCCTGATGTCATCGCCAAAGGATTCGCGAATGATGGTCAAGATGTTCCCGTTGACGGCCAA
GTCGCCTCCCTCACCTCAACCAATAACTTTATCAACTTTTGCAAGGACATAAATCTGCCGATTACCAACGGTGAA
CAGAAGACTGGTGGGTCATGTAACCCAACACCAATGGGAGCTATTCCTTCCACTTCCGTTATGCCATCGTCAAAA
TTTGTTTTCCCCAAGAACGGAGGCACTGTTCCCGCAAACAAAAAATTTACCCTTAAAATGGCGATCAAGAACGTG
GACACGGGGAACTTTGTGAATGCTCAGAGCAATTATTACGCTGCACCACAGCATTTGAATGCTCAGGGTATAATC
ATAGGACACTCACATGTGGTCGTTGAGAAGCTCGATTCAATGACCCAGACGACACCAACCGACCCGAATGTTTTC
GCCTTCTTCAAGGGTGTGAATGGCAAAGCTGATGCCCAGGGAGTTTTGAATGTGGATGTTGACAAAGGTTTACCT
GCTGGGACCTACAAGCTTTCGTCCATCAACGCTGCGGCCAATCACCAGCCCGTCCTTGTGGCAGTCGCTCAGCAC
GGATCTCTTGATGACGTTGTCTATTTTACCGTCCAATAA
Transcript >AgabiH97|008920
ATGATGCAACTGCGTTCTGCTCTTCTGACCCTGGCACTTGTTCTTGCAGTATCTTCTCATCCCACTCTGGATCGT
CGTGCTTCCTTCACTCTCAAGAATGGTCAAGATGCAATTGCATTAAATCAAAAGTTTAGCAAGCTTACTGCCAAC
TCCCCCTGCCAGTCGGGGGAAAACGCTTGTGTAGACCAAAAGTTTGCCCAGTGTATCGGCGGGAAATTTGTCCTT
CAAGCATGTGGCCCGGGCACGACTTGTTCAGCACTGCCTCTTGTCAATTCACCAGGAACATCTATTACTTGCACC
ACAGAAGCTGATGCAGCTGCTCGCATCGCCGCGACTGGTGCCCAATCTGCCGGCGGCAACACTGGAAATAATTCC
GGGTCTGAAGATAATAATGATGATGCCGGTGGTGCTGCCGGAGATGACAGCGATACTGGTAACGATGGGGGAGCG
AACAACGCTGGTGACGGTGGCGCAGCCGGGAATGATAACAACACAGGCAACAACGGCGGGGCTAATAACGCTGGT
GGTGGCGCAGCCGGGAATGATAACAACACGGGCAACGATGGAGGGGCTAATAACGCTGGTGGCGGCGCAGCCGGG
AATGATAACAACACAGGCAACAATGGCGGGGCCAATAACGCTGGTGGCGGCGCAGCTGGGAATGATAACGATACC
GACAACAATGGTGGTGCTAACAACGCTGGTGGCGGTGGTGCAGCTGGAAACAACGACAACAGTGACCCACAAAAG
TCATCAACTCTGGACCCTGATGTCATCGCCAAAGGATTCGCGAATGATGGTCAAGATGTTCCCGTTGACGGCCAA
GTCGCCTCCCTCACCTCAACCAATAACTTTATCAACTTTTGCAAGGACATAAATCTGCCGATTACCAACGGTGAA
CAGAAGACTGGTGGGTCATGTAACCCAACACCAATGGGAGCTATTCCTTCCACTTCCGTTATGCCATCGTCAAAA
TTTGTTTTCCCCAAGAACGGAGGCACTGTTCCCGCAAACAAAAAATTTACCCTTAAAATGGCGATCAAGAACGTG
GACACGGGGAACTTTGTGAATGCTCAGAGCAATTATTACGCTGCACCACAGCATTTGAATGCTCAGGGTATAATC
ATAGGACACTCACATGTGGTCGTTGAGAAGCTCGATTCAATGACCCAGACGACACCAACCGACCCGAATGTTTTC
GCCTTCTTCAAGGGTGTGAATGGCAAAGCTGATGCCCAGGGAGTTTTGAATGTGGATGTTGACAAAGGTTTACCT
GCTGGGACCTACAAGCTTTCGTCCATCAACGCTGCGGCCAATCACCAGCCCGTCCTTGTGGCAGTCGCTCAGCAC
GGATCTCTTGATGACGTTGTCTATTTTACCGTCCAATAA
Gene >AgabiH97|008920
ATGATGCAACTGCGTTCTGCTCTTCTGACCCTGGCACTTGTTCTTGCAGTATCTTCTCATCCCACTCTGGATCGT
CGTGCTTCCTTCACTCTCAAGAATGGTCAAGATGCAATTGCATTAAAGTATGTCCCATTTATCTACCGTCCCTGC
CTAATCTAATTATTGCTTCCAGTCAAAAGTTTAGCAAGCTTACTGCCAACTCCCCCTGCCAGTCGGGGGAAAACG
CTTGTGTAGACCAAAAGTTTGCCCAGTGTATCGGCGGGAAATTTGTCCTTCAAGCATGTGGCCCGGGCACGACGT
AAGCATTCAAATCTTTTTGGAAAGATGTTTGTCTTTATAATAAACCAACCTTTGACAGTTGTTCAGCACTGCCTC
TTGTCAATTCACCAGGAACATCTATTACTTGCACCACAGAAGCTGATGCAGCTGCTCGCATCGCCGCGGTGAGTT
GATCCAAGTAATCTGCCACTTTTCCAAACTTCTGATGATCCAATCTGTAGACTGGTGCCCAATCTGCCGGCGGCA
ACACTGGAAATAATTCCGGGTCTGAAGATAATAATGATGATGCCGGTGGTGCTGCCGGAGATGACAGCGATACTG
GTAACGATGGGGGAGCGAACAACGCTGGTGACGGTGGCGCAGCCGGGAATGATAACAACACAGGCAACAACGGCG
GGGCTAATAACGCTGGTGGTGGCGCAGCCGGGAATGATAACAACACGGGCAACGATGGAGGGGCTAATAACGCTG
GTGGCGGCGCAGCCGGGAATGATAACAACACAGGCAACAATGGCGGGGCCAATAACGCTGGTGGCGGCGCAGCTG
GGAATGATAACGATACCGACAACAATGGTGGTGCTAACAACGCTGGTGGCGGTGGTGCAGCTGGAAACAACGACA
ACAGTGACCCACAAAAGTCATCAAGTATGTCTACAAACCATTTCCAATGATCAAAACAAGTGACTAACTGGGTGA
TATCAGCTCTGGACCCTGATGTCATCGCCAAAGGATTCGCGAATGATGGTCAAGATGTTCCCGTTGACGGCCAAG
TCGCCTCCCTCACCTCAACCAATAACTTTATCAACTTTTGCAAGGACATAAATCTGCCGATTACCAACGGTGAAC
AGAAGACTGGTGGGTCATGTAACCCAACACCAATGGGAGCTATTCCTTCCACTTCCGTTATGCCATCGTCAAAAT
TTGTTTTCCCCAAGAACGGAGGCACTGTTCCCGCAAACAAAAAATTTACCCTTAAAATGGCGATCAAGAACGTGG
ACACGGGGAACTTTGTGAATGCTCAGAGCAATTATTACGCTGCACCACAGCATTTGAATGCTCAGGGTATAATCA
TAGGACACTCACATGTGGTCGTTGAGAAGCTCGATTCAATGACCCAGACGACACCAACCGACCCGAATGTTTTCG
CCTTCTTCAAGGGTGTGAATGGCAAAGCTGATGCCCAGGGAGTTTTGAATGTGGATGTTGACAAAGGTTTACCTG
CTGGGACCTACAAGCTTTCGTCCATCAACGCTGCGGCCAATCACCAGCCCGTCCTTGTGGCAGTCGCTCAGCACG
GATCTCTTGATGACGTTGTCTATGTAAGTCGCCACTCCACTTGTTTTTTTAATAGTTTGATACTCAAGTCGATGC
CAGTTTACCGTCCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail