Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008790
Gene name
Locationscaffold_1:2064036..2065874
Strand-
Gene length (bp)1838
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.2E-14 9 86

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 157 179 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008790
MPRRVKVAVVGSGLAGLTSAWLLTRPLNNRDVEFDVHLFEKADTFGMDAASMSILDSSAQEQWRIDVPMRTFQGG
YYPQLLAMYKKVGVKLRPSNFDYSFSLFSPPSTKKKRKITTTFIYNGSSGRSGLSMPSYLADMSLQVKALFLNSF
LRKMWTYVVFLSMTMEILFCFIMSAVHAAPFLRPHDLEDKSFGKWAEDVKPTNAVARWIGLDVAWQNYVRDVMVP
LWSGMCTATAQDILNYPAVEFLDFIWLTIGTPHYVLANGVRDIATELSKELEHIHLSSPITSVAADPDAPHLASL
TCMTASGEETIISGFHHIIFATEADTAASILRGFASSISDSAHLEGGAFSDHLQQQVEVLNKFKYRTVVVVNHTD
NTLLPDDIRDRRELNLVYHHGGEPGIFVEGPDRDSSVCVPSSYAMVTHILPRPDDYSPNLPTIYQTTNPYIPPKK
DSILCSSKLRRAIPTVEARKALQGFCQEDGRRWWECPAVCKTKLGPLQGAGRLLDRSHPGIWICGSYAFPGIPFL
EGCVVSAKNVVIQGIFECEKTNLKEEPWMA*
Coding >AgabiH97|008790
ATGCCTCGCAGAGTCAAAGTAGCTGTTGTTGGCAGTGGACTAGCAGGCCTCACATCTGCATGGCTCTTGACACGA
CCCTTGAATAACAGGGATGTCGAGTTTGACGTCCATCTCTTCGAAAAGGCTGATACTTTCGGGATGGATGCTGCA
TCCATGTCAATACTTGACTCGTCTGCTCAGGAGCAGTGGAGGATTGATGTGCCCATGAGAACATTCCAGGGAGGC
TACTACCCTCAGCTCCTCGCTATGTACAAGAAGGTCGGAGTCAAGCTGAGGCCAAGCAACTTTGACTATTCGTTC
TCGCTGTTTTCTCCGCCGAGCACAAAGAAAAAGAGAAAGATTACTACGACGTTCATCTACAATGGCTCCTCTGGA
CGCTCGGGTCTCAGCATGCCGTCTTATCTAGCTGACATGTCGCTCCAGGTCAAGGCTCTCTTTCTTAATTCCTTT
CTACGGAAAATGTGGACATATGTTGTCTTTCTGTCCATGACGATGGAGATCCTATTCTGCTTCATTATGTCCGCC
GTCCACGCTGCGCCTTTCCTTCGTCCACATGATCTCGAGGATAAATCTTTCGGAAAGTGGGCCGAAGATGTTAAA
CCAACAAATGCTGTTGCCCGCTGGATAGGTCTCGACGTTGCTTGGCAAAACTACGTACGGGATGTCATGGTACCT
TTATGGTCTGGCATGTGTACAGCGACAGCGCAAGATATCTTAAACTATCCCGCTGTGGAATTCTTAGATTTTATT
TGGTTAACGATTGGCACACCGCACTATGTTTTGGCCAATGGTGTCCGCGACATTGCCACTGAGCTCAGCAAAGAA
CTTGAACATATTCATCTTTCTTCACCAATCACCTCCGTCGCTGCGGACCCAGATGCACCTCATTTGGCATCACTG
ACTTGCATGACAGCCTCAGGGGAAGAAACTATTATAAGTGGCTTCCATCACATTATTTTTGCGACCGAGGCAGAT
ACTGCAGCGTCGATACTGCGAGGCTTCGCCTCTAGTATTTCTGACTCTGCACATCTGGAAGGAGGCGCTTTCAGT
GATCATCTGCAGCAACAAGTAGAAGTTTTAAACAAATTCAAATATCGGACGGTTGTGGTCGTAAATCATACAGAT
AACACACTTCTACCCGATGATATCCGAGATCGCCGTGAACTCAACCTTGTCTATCATCATGGAGGCGAGCCGGGA
ATTTTTGTTGAAGGTCCGGATAGAGATTCCTCTGTTTGTGTCCCGAGTTCCTACGCCATGGTGACCCACATCCTA
CCCAGGCCAGATGATTATTCTCCAAATCTACCTACCATATACCAAACGACCAATCCTTATATCCCACCTAAGAAG
GATTCAATTCTGTGTTCTTCTAAATTACGAAGGGCAATTCCAACCGTAGAGGCCAGAAAGGCTCTGCAAGGCTTT
TGCCAAGAGGACGGTCGGAGATGGTGGGAGTGCCCCGCGGTTTGCAAAACAAAACTCGGACCTCTCCAAGGCGCT
GGAAGATTGTTAGACAGAAGCCATCCCGGAATATGGATTTGCGGTTCCTATGCATTCCCTGGCATCCCATTCTTG
GAAGGTTGCGTTGTGAGCGCGAAGAATGTCGTCATCCAGGGTATTTTTGAATGCGAAAAAACAAATTTAAAAGAG
GAGCCTTGGATGGCGTGA
Transcript >AgabiH97|008790
ATGCCTCGCAGAGTCAAAGTAGCTGTTGTTGGCAGTGGACTAGCAGGCCTCACATCTGCATGGCTCTTGACACGA
CCCTTGAATAACAGGGATGTCGAGTTTGACGTCCATCTCTTCGAAAAGGCTGATACTTTCGGGATGGATGCTGCA
TCCATGTCAATACTTGACTCGTCTGCTCAGGAGCAGTGGAGGATTGATGTGCCCATGAGAACATTCCAGGGAGGC
TACTACCCTCAGCTCCTCGCTATGTACAAGAAGGTCGGAGTCAAGCTGAGGCCAAGCAACTTTGACTATTCGTTC
TCGCTGTTTTCTCCGCCGAGCACAAAGAAAAAGAGAAAGATTACTACGACGTTCATCTACAATGGCTCCTCTGGA
CGCTCGGGTCTCAGCATGCCGTCTTATCTAGCTGACATGTCGCTCCAGGTCAAGGCTCTCTTTCTTAATTCCTTT
CTACGGAAAATGTGGACATATGTTGTCTTTCTGTCCATGACGATGGAGATCCTATTCTGCTTCATTATGTCCGCC
GTCCACGCTGCGCCTTTCCTTCGTCCACATGATCTCGAGGATAAATCTTTCGGAAAGTGGGCCGAAGATGTTAAA
CCAACAAATGCTGTTGCCCGCTGGATAGGTCTCGACGTTGCTTGGCAAAACTACGTACGGGATGTCATGGTACCT
TTATGGTCTGGCATGTGTACAGCGACAGCGCAAGATATCTTAAACTATCCCGCTGTGGAATTCTTAGATTTTATT
TGGTTAACGATTGGCACACCGCACTATGTTTTGGCCAATGGTGTCCGCGACATTGCCACTGAGCTCAGCAAAGAA
CTTGAACATATTCATCTTTCTTCACCAATCACCTCCGTCGCTGCGGACCCAGATGCACCTCATTTGGCATCACTG
ACTTGCATGACAGCCTCAGGGGAAGAAACTATTATAAGTGGCTTCCATCACATTATTTTTGCGACCGAGGCAGAT
ACTGCAGCGTCGATACTGCGAGGCTTCGCCTCTAGTATTTCTGACTCTGCACATCTGGAAGGAGGCGCTTTCAGT
GATCATCTGCAGCAACAAGTAGAAGTTTTAAACAAATTCAAATATCGGACGGTTGTGGTCGTAAATCATACAGAT
AACACACTTCTACCCGATGATATCCGAGATCGCCGTGAACTCAACCTTGTCTATCATCATGGAGGCGAGCCGGGA
ATTTTTGTTGAAGGTCCGGATAGAGATTCCTCTGTTTGTGTCCCGAGTTCCTACGCCATGGTGACCCACATCCTA
CCCAGGCCAGATGATTATTCTCCAAATCTACCTACCATATACCAAACGACCAATCCTTATATCCCACCTAAGAAG
GATTCAATTCTGTGTTCTTCTAAATTACGAAGGGCAATTCCAACCGTAGAGGCCAGAAAGGCTCTGCAAGGCTTT
TGCCAAGAGGACGGTCGGAGATGGTGGGAGTGCCCCGCGGTTTGCAAAACAAAACTCGGACCTCTCCAAGGCGCT
GGAAGATTGTTAGACAGAAGCCATCCCGGAATATGGATTTGCGGTTCCTATGCATTCCCTGGCATCCCATTCTTG
GAAGGTTGCGTTGTGAGCGCGAAGAATGTCGTCATCCAGGGTATTTTTGAATGCGAAAAAACAAATTTAAAAGAG
GAGCCTTGGATGGCGTGA
Gene >AgabiH97|008790
ATGCCTCGCAGAGTCAAAGTAGCTGTTGTTGGCAGTGGACTAGCAGGCCTCACATCTGCATGGCTCTTGACACGA
CCCTTGAATAACAGGGATGTCGAGTTTGACGTCCATCTCTTCGAAAAGGTAGCCTTCACTTTTTTTTTTGCATGG
CTGCGAATGTACTTATTTGAGGCCAGGCTGATACTTTCGGGATGGATGCTGCATCCATGTCAATACTTGACTCGT
CTGCTCAGGAGCAGTGGAGGATTGATGTGCCCATGAGAACATTCCAGGGAGGTATGAATTCGAGCTTCTTATACA
TCGTCTAATTATGATACTCAACTCTCCTACTAGGCTACTACCCTCAGCTCCTCGCTATGTACAAGAAGGTCGGAG
TCAAGCTGAGGCCAAGCAACTTTGACTATTCGTTCTCGCTGTTTTCTCCGCCGAGCACAAAGAAAAAGAGAAAGA
TTACTACGACGTTCATCTACAATGGCTCCTCTGGACGCTCGGGTCTCAGCATGCCGTCTTATCTAGCTGACATGT
CGCTCCAGGTCAAGGCTCTCTTTCTTAATTCCTTTCTACGGAAAATGTGGACATATGTTGTCTTTCTGTCCATGA
CGATGGAGATCCTATTCTGCTTCATTATGTCCGCCGTCCACGCTGCGCCTTTCCTTCGTCCACATGATCTCGAGG
ATAAATCTTTCGGAAAGTGGGCCGAAGATGTTAAACCAACAAATGCTGTTGCCCGCTGGATAGGTCTCGACGTTG
CTTGGCAAAACTACGTACGGGATGTCATGGTACCTTTATGGTCTGGCATGTGTACAGCGACAGCGCAAGATATCT
TAAACTATCCCGCTGTGGAATTCTTAGGTAAATGATGCGCGTATCACAAATGATTTATCTGATACTAGCAATATT
TTTGACTTCTAGATTTTATTTGGTTAACGATTGGCACACCGCACTATGTTTTGGCCAATGGTGTCCGCGACATTG
CCACTGAGCTCAGCAAAGAACTTGAACATATTCATCTTTCTTCACCAATCACCTCCGTCGCTGCGGACCCAGATG
CACCTCATTTGGCATCACTGACTTGCATGACAGCCTCAGGGGAAGAAACTATTATAAGTGGCTTCCATCACATTA
TTTTTGCGACCGAGGCAGATACTGCAGCGTCGATACTGCGAGGCTTCGCCTCTAGTATTTCTGACTCTGCACATC
TGGAAGGAGGCGCTTTCAGTGATCATCTGCAGCAACAAGTAGAAGTTTTAAACAAATTCAAATATCGGACGGTTG
TGGTCGTAAATCATACAGATAACACACTTCTACCCGATGATATCCGAGATCGCCGTGAACTCAACCTTGTCTATC
ATCATGGAGGCGAGCCGGGAATTTTTGTTGAAGGTCCGGATAGAGATTCCTCTGTTTGTGTCCCGAGTTCCTACG
CCATGGTGACCCACATCCTACCCAGGCCAGATGATTATTCTCCAAATCTACCTACCATATACCAAACGACCAATC
CTTATATCCCACCTAAGAAGGATTCAATTCTGTGTTCTTCTAAATTACGAAGGGCAATTCCAACCGTAGAGGCCA
GAAAGGCTCTGCAAGGCTTTTGCCAAGAGGACGGTCGGAGATGGTGGGAGTGCCCCGCGGTTTGCAAAACAAAAC
TCGGACCTCTCCAAGGCGCTGGAAGATTGTTAGACAGAAGCCATCCCGGAATATGGATTTGCGGTTCCTATGCAT
TCCCTGGCATCCCATTCTTGGAAGGTTGCGTTGTGAGCGCGAAGAATGTCGTCATCCAGGGTATTTTTGAATGCG
AAAAAACAAATTTAAAAGAGGAGCCTTGGATGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail