Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008420
Gene name
Locationscaffold_1:1989732..1992344
Strand-
Gene length (bp)2612
Transcript length (bp)2124
Coding sequence length (bp)2124
Protein length (aa) 708

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 1.3E-107 360 694
PF15409 PH_8 Pleckstrin homology domain 2.3E-18 31 114
PF00169 PH PH domain 3.0E-06 27 116

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 268 696 9.0E-85
sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1 225 696 1.0E-83
sp|Q8S8P9|ORP1B_ARATH Oxysterol-binding protein-related protein 1B OS=Arabidopsis thaliana GN=ORP1B PE=2 SV=1 263 697 1.0E-80
sp|Q8BXR9|OSBL6_MOUSE Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=1 SV=1 346 696 6.0E-79
sp|Q9BZF2|OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1 346 695 2.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9DBS9|OSBL3_MOUSE Oxysterol-binding protein-related protein 3 OS=Mus musculus GN=Osbpl3 PE=1 SV=2 268 696 9.0E-85
sp|Q9H4L5|OSBL3_HUMAN Oxysterol-binding protein-related protein 3 OS=Homo sapiens GN=OSBPL3 PE=1 SV=1 225 696 1.0E-83
sp|Q8S8P9|ORP1B_ARATH Oxysterol-binding protein-related protein 1B OS=Arabidopsis thaliana GN=ORP1B PE=2 SV=1 263 697 1.0E-80
sp|Q8BXR9|OSBL6_MOUSE Oxysterol-binding protein-related protein 6 OS=Mus musculus GN=Osbpl6 PE=1 SV=1 346 696 6.0E-79
sp|Q9BZF2|OSBL7_HUMAN Oxysterol-binding protein-related protein 7 OS=Homo sapiens GN=OSBPL7 PE=2 SV=1 346 695 2.0E-78
sp|Q9BZF3|OSBL6_HUMAN Oxysterol-binding protein-related protein 6 OS=Homo sapiens GN=OSBPL6 PE=1 SV=1 346 696 7.0E-78
sp|O80866|ORP1A_ARATH Oxysterol-binding protein-related protein 1A OS=Arabidopsis thaliana GN=ORP1A PE=2 SV=1 317 697 2.0E-77
sp|Q8L751|ORP1C_ARATH Oxysterol-binding protein-related protein 1C OS=Arabidopsis thaliana GN=ORP1C PE=2 SV=1 319 697 4.0E-77
sp|Q9SAF0|ORP1D_ARATH Oxysterol-binding protein-related protein 1D OS=Arabidopsis thaliana GN=ORP1D PE=2 SV=1 44 694 5.0E-75
sp|Q9SU36|ORP2B_ARATH Oxysterol-binding protein-related protein 2B OS=Arabidopsis thaliana GN=ORP2B PE=2 SV=2 300 694 1.0E-72
sp|Q940Y1|ORP2A_ARATH Oxysterol-binding protein-related protein 2A OS=Arabidopsis thaliana GN=ORP2A PE=2 SV=1 344 695 2.0E-72
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 342 694 8.0E-70
sp|Q969R2|OSBP2_HUMAN Oxysterol-binding protein 2 OS=Homo sapiens GN=OSBP2 PE=1 SV=2 4 694 8.0E-63
sp|Q5QNQ6|OSBP2_MOUSE Oxysterol-binding protein 2 OS=Mus musculus GN=Osbp2 PE=1 SV=1 1 694 3.0E-61
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 344 697 3.0E-61
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.05c PE=1 SV=2 360 694 1.0E-60
sp|Q9BXW6|OSBL1_HUMAN Oxysterol-binding protein-related protein 1 OS=Homo sapiens GN=OSBPL1A PE=1 SV=2 347 692 2.0E-56
sp|Q91XL9|OSBL1_MOUSE Oxysterol-binding protein-related protein 1 OS=Mus musculus GN=Osbpl1a PE=1 SV=2 347 692 5.0E-56
sp|Q8K4M9|OSBL1_RAT Oxysterol-binding protein-related protein 1 OS=Rattus norvegicus GN=Osbpl1a PE=1 SV=1 347 692 3.0E-55
sp|Q9H1P3|OSBL2_HUMAN Oxysterol-binding protein-related protein 2 OS=Homo sapiens GN=OSBPL2 PE=1 SV=1 285 692 7.0E-54
sp|P16258|OSBP1_RABIT Oxysterol-binding protein 1 OS=Oryctolagus cuniculus GN=OSBP PE=1 SV=1 30 694 2.0E-53
sp|Q3B7Z2|OSBP1_MOUSE Oxysterol-binding protein 1 OS=Mus musculus GN=Osbp PE=1 SV=3 30 694 5.0E-53
sp|Q12451|OSH2_YEAST Oxysterol-binding protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH2 PE=1 SV=1 360 694 2.0E-52
sp|P22059|OSBP1_HUMAN Oxysterol-binding protein 1 OS=Homo sapiens GN=OSBP PE=1 SV=1 30 694 9.0E-52
sp|P35845|OSH1_YEAST Oxysterol-binding protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWH1 PE=1 SV=4 353 696 3.0E-47
sp|Q54ID7|OSB11_DICDI Oxysterol-binding protein 11 OS=Dictyostelium discoideum GN=osbK PE=3 SV=1 357 694 2.0E-43
sp|Q9SR33|ORP3B_ARATH Oxysterol-binding protein-related protein 3B OS=Arabidopsis thaliana GN=ORP3B PE=2 SV=1 357 677 3.0E-41
sp|Q54QP6|OSB8_DICDI Oxysterol-binding protein 8 OS=Dictyostelium discoideum GN=osbH PE=1 SV=1 361 694 1.0E-40
sp|Q93Y40|ORP3C_ARATH Oxysterol-binding protein-related protein 3C OS=Arabidopsis thaliana GN=ORP3C PE=2 SV=1 357 677 6.0E-40
sp|Q9LZM1|ORP3A_ARATH Oxysterol-binding protein-related protein 3A OS=Arabidopsis thaliana GN=ORP3A PE=1 SV=1 362 680 2.0E-39
sp|Q8BX94|OSBL2_MOUSE Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=1 SV=1 285 549 1.0E-31
sp|Q9H0X9|OSBL5_HUMAN Oxysterol-binding protein-related protein 5 OS=Homo sapiens GN=OSBPL5 PE=1 SV=1 354 686 3.0E-25
sp|Q9BZF1|OSBL8_HUMAN Oxysterol-binding protein-related protein 8 OS=Homo sapiens GN=OSBPL8 PE=1 SV=3 354 676 3.0E-22
sp|Q86KG4|OSB4_DICDI Oxysterol-binding protein 4 OS=Dictyostelium discoideum GN=osbD PE=3 SV=2 360 686 5.0E-22
sp|B9EJ86|OSBL8_MOUSE Oxysterol-binding protein-related protein 8 OS=Mus musculus GN=Osbpl8 PE=1 SV=1 354 676 9.0E-22
sp|Q9ER64|OSBL5_MOUSE Oxysterol-binding protein-related protein 5 OS=Mus musculus GN=Osbpl5 PE=1 SV=3 354 686 4.0E-21
sp|Q9BXB5|OSB10_HUMAN Oxysterol-binding protein-related protein 10 OS=Homo sapiens GN=OSBPL10 PE=1 SV=2 354 693 1.0E-20
sp|S4R1M9|OSB10_MOUSE Oxysterol-binding protein-related protein 10 OS=Mus musculus GN=Osbpl10 PE=1 SV=1 296 692 3.0E-19
sp|Q9UUA1|YJX1_SCHPO Oxysterol-binding protein homolog C23B6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC23B6.01c PE=1 SV=2 361 683 2.0E-18
sp|Q8BX94|OSBL2_MOUSE Oxysterol-binding protein-related protein 2 OS=Mus musculus GN=Osbpl2 PE=1 SV=1 593 692 3.0E-17
sp|Q9UW25|OBPA_CANAL Oxysterol-binding protein-like protein OBPa OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=OBPA PE=3 SV=1 370 685 2.0E-15
sp|Q54NM4|OSB10_DICDI Oxysterol-binding protein 10 OS=Dictyostelium discoideum GN=osbJ PE=3 SV=1 376 584 1.0E-13
sp|Q02201|OSH6_YEAST Oxysterol-binding protein homolog 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH6 PE=1 SV=1 370 581 2.0E-13
sp|Q0IJ05|OSBL9_XENTR Oxysterol-binding protein-related protein 9 OS=Xenopus tropicalis GN=osbpl9 PE=2 SV=1 369 686 3.0E-13
sp|P38755|OSH7_YEAST Oxysterol-binding protein homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH7 PE=1 SV=1 302 581 5.0E-13
sp|Q8CI95|OSB11_MOUSE Oxysterol-binding protein-related protein 11 OS=Mus musculus GN=Osbpl11 PE=1 SV=2 361 693 2.0E-12
sp|P0C199|KES1_USTMA Protein KES1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KES1 PE=3 SV=1 372 669 2.0E-12
sp|Q9BXB4|OSB11_HUMAN Oxysterol-binding protein-related protein 11 OS=Homo sapiens GN=OSBPL11 PE=1 SV=2 361 692 3.0E-12
sp|Q54PS9|OSB9_DICDI Oxysterol-binding protein 9 OS=Dictyostelium discoideum GN=osbI PE=3 SV=1 370 665 3.0E-12
sp|A2A8Z1|OSBL9_MOUSE Oxysterol-binding protein-related protein 9 OS=Mus musculus GN=Osbpl9 PE=1 SV=1 369 686 2.0E-11
sp|Q96SU4|OSBL9_HUMAN Oxysterol-binding protein-related protein 9 OS=Homo sapiens GN=OSBPL9 PE=1 SV=2 369 686 2.0E-11
sp|Q54EF5|OSB12_DICDI Oxysterol-binding protein 12 OS=Dictyostelium discoideum GN=osbL PE=3 SV=1 370 583 2.0E-10
sp|O74178|KES1_SCHPO Protein kes1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kes1 PE=2 SV=2 372 679 1.0E-09
sp|Q9SW00|ORP4B_ARATH Oxysterol-binding protein-related protein 4B OS=Arabidopsis thaliana GN=ORP4B PE=2 SV=2 352 583 4.0E-08
sp|O13944|YEH1_SCHPO Oxysterol-binding protein homolog C23H4.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.01c PE=1 SV=2 13 285 4.0E-08
sp|P38713|OSH3_YEAST Oxysterol-binding protein homolog 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OSH3 PE=1 SV=1 29 125 2.0E-07
sp|Q9SVZ9|ORP4A_ARATH Oxysterol-binding protein-related protein 4A OS=Arabidopsis thaliana GN=ORP4A PE=2 SV=2 370 503 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008289 lipid binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008420
MRHGSAQFAADIPLAPANKQSSSPSAVLCQGWVLKKRRKKMQGFARRYFVLFNNGLLQYSFEPARPVRDQLSLHN
AAISTAPGRKDIHIDSGTATFHIKCLSTSDFDTWMRAFRTFISSGQESKNLLSPRQHHRQASIKLNKYEGVAETM
AVTLEQLEESISTLLQELNAKKLTSVRKKSEKDYSKDAVFGIFKKHPQHPVGQHGLATSPSELPPAAQHVLSVLE
ELKKQHSLLLRSMQAAYARTEDEHHKHRSESAFGRSRHSVATSISDATHEWHDAVEDFESGPEEFIMDIPEHTEE
PSSVATNDSSSTLEQLDQSSSDLNEESGEKQPSPQSLKTDARAIVRRTCLPSPVVGDQGSLFAVLKKNIGKDLST
IALPVTFNEPLTLLQATAEEVEYFGLLDEVTRTTNPIEQLSFVAAFAVSGYAHTRHRSGRKGFNPMLAETFEDVR
MKFIAEKVRHHPVELAYHAEGEGWELTATSAGRTKFWGKSLEIISEGKAQLRVGDELFTWTKPSSFVRNVVVGTK
YLEHCGQLTVQSLTSHYHCVLEFKQNTYWSSSNVVSGPVYSPTGEVVSHIEGKWDDQISQALDSSHFRLLWRMHP
FPLDTQDYYGFTAFGITLNEITPDLVGKLPPTDSRYRPDVRALERGDISTAEASKLRLEELQRERRRNKQDRQPR
WFKQVGNEWVYAGGYWEARANGWKGEHVEPLW*
Coding >AgabiH97|008420
ATGAGGCACGGGTCTGCTCAGTTTGCTGCCGATATTCCTCTGGCACCAGCAAACAAACAGTCATCCTCACCCTCT
GCGGTGCTCTGCCAGGGATGGGTTCTCAAGAAACGCAGAAAGAAGATGCAAGGTTTTGCCCGGCGTTATTTTGTG
CTCTTCAACAATGGCTTGTTGCAATACTCCTTTGAACCCGCTCGACCCGTTCGAGACCAACTATCCCTCCATAAT
GCTGCCATATCCACTGCTCCCGGACGAAAAGACATACACATCGATTCAGGCACAGCGACTTTCCATATCAAATGC
CTCAGCACCTCAGACTTCGATACGTGGATGAGAGCTTTCAGAACATTCATCTCTTCAGGACAGGAATCCAAGAAC
CTTCTTAGTCCACGGCAACATCATCGACAGGCAAGCATCAAACTGAATAAATATGAGGGTGTTGCGGAGACAATG
GCTGTTACGCTTGAACAACTTGAAGAATCCATTTCGACCCTTCTACAGGAGCTGAATGCGAAAAAGCTTACGAGT
GTCCGTAAGAAGTCTGAGAAGGATTATTCTAAAGATGCTGTTTTCGGCATATTCAAGAAACATCCTCAGCACCCG
GTGGGACAACATGGTCTGGCCACGTCACCCTCAGAGTTACCTCCAGCTGCCCAGCATGTCTTGAGCGTACTCGAA
GAACTCAAGAAACAACATTCTCTATTACTGAGATCAATGCAGGCTGCTTACGCCCGCACTGAAGATGAACACCAT
AAGCACCGTTCTGAATCTGCCTTTGGACGCAGCCGCCATTCGGTTGCAACCTCAATTAGTGATGCTACTCACGAG
TGGCATGATGCCGTAGAAGATTTTGAAAGTGGCCCAGAAGAGTTTATCATGGATATTCCAGAACACACTGAGGAA
CCAAGCAGTGTTGCCACGAATGACAGTTCCAGCACTCTGGAACAACTTGATCAATCTAGCAGCGATTTAAATGAG
GAAAGTGGAGAGAAGCAGCCATCACCTCAAAGTTTGAAAACTGACGCACGAGCGATTGTAAGGCGTACTTGCCTG
CCATCACCCGTGGTCGGGGATCAAGGTAGCTTATTTGCTGTGCTCAAAAAGAACATTGGCAAGGATTTATCAACC
ATCGCCCTCCCTGTTACCTTCAATGAGCCCCTTACATTACTCCAGGCAACAGCTGAAGAGGTGGAATACTTTGGC
CTTCTCGATGAAGTAACCCGCACCACAAATCCGATTGAGCAGCTCTCCTTCGTAGCAGCTTTTGCAGTCTCGGGA
TATGCTCATACGCGACATCGGTCAGGGAGGAAAGGATTTAATCCTATGTTGGCGGAAACTTTCGAGGATGTTCGC
ATGAAATTCATCGCAGAAAAAGTTCGTCATCATCCGGTGGAATTAGCCTACCACGCTGAGGGAGAAGGATGGGAG
TTGACGGCTACTTCGGCAGGACGGACAAAATTTTGGGGGAAAAGCCTTGAAATCATTTCAGAAGGAAAAGCGCAA
TTACGAGTGGGAGACGAACTATTTACCTGGACAAAGCCATCGTCCTTTGTACGCAATGTCGTGGTTGGAACGAAG
TATCTCGAGCACTGTGGACAATTAACGGTGCAGAGCCTTACCAGTCACTACCATTGCGTATTGGAATTCAAACAA
AATACGTATTGGAGCTCTTCAAACGTAGTCTCTGGCCCCGTATACTCGCCCACCGGCGAAGTTGTCAGTCATATA
GAAGGAAAGTGGGACGACCAAATATCCCAAGCTTTGGATTCATCACATTTCCGCCTTCTGTGGCGAATGCACCCT
TTCCCACTGGACACTCAGGATTACTATGGTTTTACAGCCTTTGGGATTACACTGAATGAAATCACTCCCGATCTG
GTCGGGAAATTGCCACCGACGGATTCAAGGTATAGACCTGATGTTCGAGCTCTAGAAAGGGGGGATATAAGCACG
GCTGAGGCAAGCAAACTCAGACTCGAAGAATTGCAACGCGAAAGGCGTAGAAATAAACAGGACCGTCAGCCAAGA
TGGTTCAAACAAGTCGGAAATGAGTGGGTCTATGCGGGCGGCTATTGGGAGGCGAGGGCTAATGGATGGAAAGGC
GAGCACGTTGAACCGCTCTGGTGA
Transcript >AgabiH97|008420
ATGAGGCACGGGTCTGCTCAGTTTGCTGCCGATATTCCTCTGGCACCAGCAAACAAACAGTCATCCTCACCCTCT
GCGGTGCTCTGCCAGGGATGGGTTCTCAAGAAACGCAGAAAGAAGATGCAAGGTTTTGCCCGGCGTTATTTTGTG
CTCTTCAACAATGGCTTGTTGCAATACTCCTTTGAACCCGCTCGACCCGTTCGAGACCAACTATCCCTCCATAAT
GCTGCCATATCCACTGCTCCCGGACGAAAAGACATACACATCGATTCAGGCACAGCGACTTTCCATATCAAATGC
CTCAGCACCTCAGACTTCGATACGTGGATGAGAGCTTTCAGAACATTCATCTCTTCAGGACAGGAATCCAAGAAC
CTTCTTAGTCCACGGCAACATCATCGACAGGCAAGCATCAAACTGAATAAATATGAGGGTGTTGCGGAGACAATG
GCTGTTACGCTTGAACAACTTGAAGAATCCATTTCGACCCTTCTACAGGAGCTGAATGCGAAAAAGCTTACGAGT
GTCCGTAAGAAGTCTGAGAAGGATTATTCTAAAGATGCTGTTTTCGGCATATTCAAGAAACATCCTCAGCACCCG
GTGGGACAACATGGTCTGGCCACGTCACCCTCAGAGTTACCTCCAGCTGCCCAGCATGTCTTGAGCGTACTCGAA
GAACTCAAGAAACAACATTCTCTATTACTGAGATCAATGCAGGCTGCTTACGCCCGCACTGAAGATGAACACCAT
AAGCACCGTTCTGAATCTGCCTTTGGACGCAGCCGCCATTCGGTTGCAACCTCAATTAGTGATGCTACTCACGAG
TGGCATGATGCCGTAGAAGATTTTGAAAGTGGCCCAGAAGAGTTTATCATGGATATTCCAGAACACACTGAGGAA
CCAAGCAGTGTTGCCACGAATGACAGTTCCAGCACTCTGGAACAACTTGATCAATCTAGCAGCGATTTAAATGAG
GAAAGTGGAGAGAAGCAGCCATCACCTCAAAGTTTGAAAACTGACGCACGAGCGATTGTAAGGCGTACTTGCCTG
CCATCACCCGTGGTCGGGGATCAAGGTAGCTTATTTGCTGTGCTCAAAAAGAACATTGGCAAGGATTTATCAACC
ATCGCCCTCCCTGTTACCTTCAATGAGCCCCTTACATTACTCCAGGCAACAGCTGAAGAGGTGGAATACTTTGGC
CTTCTCGATGAAGTAACCCGCACCACAAATCCGATTGAGCAGCTCTCCTTCGTAGCAGCTTTTGCAGTCTCGGGA
TATGCTCATACGCGACATCGGTCAGGGAGGAAAGGATTTAATCCTATGTTGGCGGAAACTTTCGAGGATGTTCGC
ATGAAATTCATCGCAGAAAAAGTTCGTCATCATCCGGTGGAATTAGCCTACCACGCTGAGGGAGAAGGATGGGAG
TTGACGGCTACTTCGGCAGGACGGACAAAATTTTGGGGGAAAAGCCTTGAAATCATTTCAGAAGGAAAAGCGCAA
TTACGAGTGGGAGACGAACTATTTACCTGGACAAAGCCATCGTCCTTTGTACGCAATGTCGTGGTTGGAACGAAG
TATCTCGAGCACTGTGGACAATTAACGGTGCAGAGCCTTACCAGTCACTACCATTGCGTATTGGAATTCAAACAA
AATACGTATTGGAGCTCTTCAAACGTAGTCTCTGGCCCCGTATACTCGCCCACCGGCGAAGTTGTCAGTCATATA
GAAGGAAAGTGGGACGACCAAATATCCCAAGCTTTGGATTCATCACATTTCCGCCTTCTGTGGCGAATGCACCCT
TTCCCACTGGACACTCAGGATTACTATGGTTTTACAGCCTTTGGGATTACACTGAATGAAATCACTCCCGATCTG
GTCGGGAAATTGCCACCGACGGATTCAAGGTATAGACCTGATGTTCGAGCTCTAGAAAGGGGGGATATAAGCACG
GCTGAGGCAAGCAAACTCAGACTCGAAGAATTGCAACGCGAAAGGCGTAGAAATAAACAGGACCGTCAGCCAAGA
TGGTTCAAACAAGTCGGAAATGAGTGGGTCTATGCGGGCGGCTATTGGGAGGCGAGGGCTAATGGATGGAAAGGC
GAGCACGTTGAACCGCTCTGGTGA
Gene >AgabiH97|008420
ATGAGGCACGGGTCTGCTCAGTTTGCTGCCGATATTCCTCTGGCACCAGCAAACAAACAGTCATCCTCACCCTCT
GCGGTGCTCTGCCAGGGATGGGTTCTCAAGAAACGCAGAAAGAAGATGCAAGGCATGTTTTCAGAGTTTGTCACG
TTTCATGTGTCCACAACTTGATCTTCCCAGGTTTTGCCCGGCGTTATTTTGTGCTCTTCAACAATGGCTTGTTGC
AATACTCCTTTGAACCCGCTCGACCCGTTCGAGACCAACTATCCCTCCATAATGCTGCCATATCCACTGCTCCCG
GACGAAAAGACATACACATCGATTCAGGCACAGCGACTTTCCATATCAAATGCCTCAGCACCTCAGACTTCGATA
CGTGGATGAGAGCTTTCAGGTCAACATTTCTGGCCATACACTCCAGTCATGGGGCTCACTCTGCCATTCTGTAGA
ACATTCATCTCTTCAGGACAGGAATCCAAGAACCTTCTTAGTCCACGGCAACATCATCGACAGGCAAGCATCAAA
CTGAATAAATATGAGGGTGTTGCGGAGACAATGGCTGTTGTGCGTAAATGGATTATCAGTGGGGGAAGTCTGTCT
CATCATTGGCTCATCAATATAACCCAGACGCTTGAACAACTTGAAGAATCCATTTCGACCCTTCTACAGGAGCTG
AATGCGAAAAAGCTTACGAGTGTCCGTAAGAAGTCTGAGAAGGATTATTCTAAAGATGCTGTTTTCGGCATATTC
AAGAAACGTGCGTTTAAATCCGATTGTCGTTGTGCCATTCTTGACTCTCTTTAGATCCTCAGCACCCGGTGGGAC
AACATGGTCTGGCCACGTCACCCTCAGAGTTACCTCCAGCTGCCCAGCATGTCTTGAGCGTACTCGAAGAACTCA
AGAAACAACATTCTCTATTACTGAGATCAATGCAGGCTGCTGTCAGTGAATACCTTGTTTGCCATTCAGTTCCAT
TACTAACTATTTAAAAGTACGCCCGCACTGAAGATGAACACCATAAGCACCGTTCTGAATCTGCCTTTGGACGCA
GCCGCCATTCGGTTGCAACCTCAATTAGTGATGCTACTCACGAGTGGCATGATGCCGTAGAAGATTTTGAAAGTG
GCCCAGAAGAGTTTATCATGGATATTCCAGAACACACTGAGGAACCAAGCAGTGTTGCCACGAATGACAGTTCCA
GCACTCTGGAACAACTTGATCAATCTAGCAGCGATTTAAATGAGGAAAGTGGAGAGAAGCAGCCATCACCTCAAA
GTTTGAAAACTGACGCACGAGCGATTGTAAGGCGTACTTGCCTGCCATCACCCGTGGTCGGGGATCAAGGTAGCT
TATTTGCTGTGCTCAAAAAGAACATTGGCAAGGTATCAGCATCCTCTCTACCTTTGTCTTGCGCCTGTTCATTTT
TACGAAGGATTTATCAACCATCGCCCTCCCTGTTACCTTCAATGAGCCCCTTACATTACTCCAGGCAACAGCTGA
AGAGGTGGAATACTTTGGCCTTCTCGATGAAGTAACCCGCACCACAAATCCGATTGAGCAGCTCTCCTTCGTAGC
AGCTTTTGCAGTCTCGGGATATGCTCATACGCGACATCGGTCAGGGAGGAAAGGATTGTAAGCTAGCCCCGCTTT
CGCATTTTTTTGTTCATTCAAATTGACGAGCGATGCTTCACCTAGTAATCCTATGTTGGCGGAAACTTTCGAGGA
TGTTCGCATGAAATTCATCGCAGAAAAAGTTCGTCATCATCCGGTGGAATTAGCCTACCACGCTGAGGGAGAAGG
ATGGGAGTTGACGGCTACTTCGGCAGGACGGACAAAATTTTGGGGTACATCATGTCGCGCGTTATCAAAGGTTTC
AGAGGTTCTTACGCGATCTTATGACAGGGAAAAGCCTTGAAATCATTTCAGAAGGAAAAGCGCAATTACGAGTGG
GAGACGAACTATTTACCTGGTACATCAATCACTTTCTTCGGTTTCCTGTACTCACTATTATAAAAAGGACAAAGC
CATCGTCCTTTGTACGCAATGTCGTGGTTGGAACGAAGTATCTCGAGCACTGTGGACAATTAACGGTGCAGAGCC
TTACCAGTCACTACCATTGCGTATTGGAATTCAAACAAAATACGTATTGGAGCTCTTCAAACGTAGTCTCTGGCC
CCGTATACTCGCCCACCGGCGAAGTTGTCAGTCATATAGAAGGAAAGTGGGACGACCAAATATCCCAAGCTTTGG
ATTCATCACATTTCCGCCTTCTGTGGCGAATGCACCCTTTCCCACTGGACACTCAGGATTACTATGGTTTTACAG
CCTTTGGGATTACACTGAATGAAATCACTCCCGATCTGGTCGGGAAATTGCCACCGACGGATTCAAGGTATAGAC
CTGATGTTCGAGCTCTAGAAAGGGGGGATATAAGCACGGCTGAGGCAAGCAAACTCAGACTCGAAGAATTGCAAC
GCGAAAGGCGTAGAAATAAACAGGACCGTCAGCCAAGATGGTTCAAACAAGTCGGAAATGAGTGGGTCTATGCGG
GCGGCTATTGGGAGGCGAGGGCTAATGGATGGAAAGGCGAGCACGTTGAACCGCTCTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail