Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008360
Gene name
Locationscaffold_1:1971812..1973989
Strand-
Gene length (bp)2177
Transcript length (bp)2007
Coding sequence length (bp)2007
Protein length (aa) 669

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 4 23 19
2 210 232 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 4.17 1.93 6.42
Initials Initials knots 3.99 1.83 6.15
Pileal_Stipeal_center Stage I stipe center 3.54 1.59 5.48
Pileal_Stipeal_shell Stage I stipe shell 3.43 1.49 5.36
DIF_stipe_center Stage II stipe center 1.56 0.60 2.52
DIF_stipe_shell Stage II stipe shell 1.34 0.48 2.19
DIF_stipe_skin Stage II stipe skin 4.21 1.96 6.46
DIF_cap_skin Stage II cap skin 7.78 3.89 11.67
DIF_cap_tissue Stage II cap tissue 6.05 2.97 9.12
DIF_gill_tissue Stage II gill tissue 6.03 2.91 9.16
YFB_stipe_center Young fruiting body stipe center 3.90 1.32 6.48
YFB_stipe_shell Young fruiting body stipe shell 1.48 0.54 2.42
YFB_stipe_skin Young fruiting body stipe skin 3.60 1.63 5.57
YFB_cap_skin Young fruiting body cap skin 3.92 1.81 6.03
YFB_cap_tissue Young fruiting body cap tissue 6.88 3.07 10.70
YFB_gill_tissue Young fruiting body gill tissue 3.73 1.71 5.75
YFB_veil Young fruiting body veil 3.33 1.45 5.20

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.407743 no
Casing YFB_stipe_center 0.931434 no
Casing YFB_stipe_shell 0.006387 yes
Casing YFB_stipe_skin 0.805849 no
Casing YFB_cap_skin 0.928042 no
Casing YFB_cap_tissue 0.215507 no
Casing YFB_gill_tissue 0.861297 no
Casing YFB_veil 0.680633 no
Casing Initials 0.949998 no
Casing Pileal_Stipeal_center 0.779200 no
Casing Pileal_Stipeal_shell 0.733331 no
Casing DIF_stipe_center 0.006032 yes
Casing DIF_stipe_shell 0.002525 yes
Casing DIF_stipe_skin 0.989125 no
Casing DIF_cap_skin 0.087251 no
Casing DIF_cap_tissue 0.384192 no
DIF_gill_tissue YFB_stipe_center 0.373006 no
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.181928 no
DIF_gill_tissue YFB_cap_skin 0.299835 no
DIF_gill_tissue YFB_cap_tissue 0.831574 no
DIF_gill_tissue YFB_gill_tissue 0.236368 no
DIF_gill_tissue YFB_veil 0.122322 no
YFB_stipe_center YFB_stipe_shell 0.028918 yes
YFB_stipe_center YFB_stipe_skin 0.916624 no
YFB_stipe_center YFB_cap_skin 0.995045 no
YFB_stipe_center YFB_cap_tissue 0.219988 no
YFB_stipe_center YFB_gill_tissue 0.955124 no
YFB_stipe_center YFB_veil 0.822132 no
YFB_stipe_shell YFB_stipe_skin 0.029164 yes
YFB_stipe_shell YFB_cap_skin 0.016386 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.023153 yes
YFB_stipe_shell YFB_veil 0.050294 no
YFB_stipe_skin YFB_cap_skin 0.899599 no
YFB_stipe_skin YFB_cap_tissue 0.080708 no
YFB_stipe_skin YFB_gill_tissue 0.960476 no
YFB_stipe_skin YFB_veil 0.913716 no
YFB_cap_skin YFB_cap_tissue 0.148512 no
YFB_cap_skin YFB_gill_tissue 0.944542 no
YFB_cap_skin YFB_veil 0.790273 no
YFB_cap_tissue YFB_gill_tissue 0.115194 no
YFB_cap_tissue YFB_veil 0.056760 no
YFB_gill_tissue YFB_veil 0.866189 no
Initials DIF_gill_tissue 0.329583 no
Initials YFB_stipe_center 0.979187 no
Initials YFB_stipe_shell 0.012880 yes
Initials YFB_stipe_skin 0.875993 no
Initials YFB_cap_skin 0.980127 no
Initials YFB_cap_tissue 0.165414 no
Initials YFB_gill_tissue 0.924285 no
Initials YFB_veil 0.763333 no
Initials Pileal_Stipeal_center 0.852172 no
Initials Pileal_Stipeal_shell 0.810457 no
Initials DIF_stipe_center 0.009446 yes
Initials DIF_stipe_shell 0.005302 yes
Initials DIF_stipe_skin 0.938536 no
Initials DIF_cap_skin 0.063570 no
Initials DIF_cap_tissue 0.309920 no
Pileal_Stipeal_center DIF_gill_tissue 0.169839 no
Pileal_Stipeal_center YFB_stipe_center 0.897078 no
Pileal_Stipeal_center YFB_stipe_shell 0.029164 yes
Pileal_Stipeal_center YFB_stipe_skin 0.982019 no
Pileal_Stipeal_center YFB_cap_skin 0.878978 no
Pileal_Stipeal_center YFB_cap_tissue 0.072150 no
Pileal_Stipeal_center YFB_gill_tissue 0.941566 no
Pileal_Stipeal_center YFB_veil 0.934967 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.966930 no
Pileal_Stipeal_center DIF_stipe_center 0.033211 yes
Pileal_Stipeal_center DIF_stipe_shell 0.014374 yes
Pileal_Stipeal_center DIF_stipe_skin 0.757397 no
Pileal_Stipeal_center DIF_cap_skin 0.027943 yes
Pileal_Stipeal_center DIF_cap_tissue 0.156648 no
Pileal_Stipeal_shell DIF_gill_tissue 0.156118 no
Pileal_Stipeal_shell YFB_stipe_center 0.859861 no
Pileal_Stipeal_shell YFB_stipe_shell 0.040501 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.949564 no
Pileal_Stipeal_shell YFB_cap_skin 0.836131 no
Pileal_Stipeal_shell YFB_cap_tissue 0.070681 no
Pileal_Stipeal_shell YFB_gill_tissue 0.905063 no
Pileal_Stipeal_shell YFB_veil 0.968999 no
Pileal_Stipeal_shell DIF_stipe_center 0.046952 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.018624 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.711764 no
Pileal_Stipeal_shell DIF_cap_skin 0.026955 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.144566 no
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.030610 yes
DIF_stipe_center YFB_stipe_shell 0.948214 no
DIF_stipe_center YFB_stipe_skin 0.026215 yes
DIF_stipe_center YFB_cap_skin 0.015529 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.021583 yes
DIF_stipe_center YFB_veil 0.054170 no
DIF_stipe_center DIF_stipe_shell 0.828473 no
DIF_stipe_center DIF_stipe_skin 0.006387 yes
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.000613 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.011659 yes
DIF_stipe_shell YFB_stipe_shell 0.901014 no
DIF_stipe_shell YFB_stipe_skin 0.007439 yes
DIF_stipe_shell YFB_cap_skin 0.003765 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.004928 yes
DIF_stipe_shell YFB_veil 0.021583 yes
DIF_stipe_shell DIF_stipe_skin 0.001140 yes
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.400991 no
DIF_stipe_skin YFB_stipe_center 0.921094 no
DIF_stipe_skin YFB_stipe_shell 0.006742 yes
DIF_stipe_skin YFB_stipe_skin 0.787233 no
DIF_stipe_skin YFB_cap_skin 0.916603 no
DIF_stipe_skin YFB_cap_tissue 0.203278 no
DIF_stipe_skin YFB_gill_tissue 0.846828 no
DIF_stipe_skin YFB_veil 0.656135 no
DIF_stipe_skin DIF_cap_skin 0.077343 no
DIF_stipe_skin DIF_cap_tissue 0.377989 no
DIF_cap_skin DIF_gill_tissue 0.603358 no
DIF_cap_skin YFB_stipe_center 0.102187 no
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.029648 yes
DIF_cap_skin YFB_cap_skin 0.054575 no
DIF_cap_skin YFB_cap_tissue 0.841447 no
DIF_cap_skin YFB_gill_tissue 0.042475 yes
DIF_cap_skin YFB_veil 0.017226 yes
DIF_cap_skin DIF_cap_tissue 0.593240 no
DIF_cap_tissue DIF_gill_tissue 0.996674 no
DIF_cap_tissue YFB_stipe_center 0.357374 no
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.171535 no
DIF_cap_tissue YFB_cap_skin 0.280457 no
DIF_cap_tissue YFB_cap_tissue 0.828802 no
DIF_cap_tissue YFB_gill_tissue 0.219517 no
DIF_cap_tissue YFB_veil 0.115194 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008360
MPKMAPPLAVFLTLFYCIPRISGSVRAKRVSTSDVDPPFRLNHTVNGNPSHTFLSATSPGFFLNLQISRHTSLVK
FYGHKCSGASLYGVHLACSSESFEIADGYDPSIPTRLDTQPSCIFSLSIDPRENVSLELYNLYDRRFGEYGTVTF
SFAEYIPQDEAGSSVHDQICGHHLDFSNNTSTLLPRDGGESSSTSLSQPDSVMSGKLNIVIGLLTALIVIFLAVV
VVVTTYVLRLRRQAVLDRFKKDPKVKSGKNQNDTADAFLESTTATETLQVRSQDQGGTSSKNRYLEDHQPSVYTN
PTSSLSTRVETDKPVSPSRPQFRNKPPTSPPREPVPEVPKVPFPLPTIQCKGNEINCSSSGSATYPNSGMTVSQA
RPSEPRNPENLMDQRAGSTRPAQTKIPHSRFSKPLPGILSEIPLPSPSHNNRPIAHFPESSGSSNDLPRYIDPKG
RQAEVRDQTIHGPTTTRVGLDSSNQISMHPKLEHIKTPEEARQGARSLHQDLPRTRVEYETPIKVSGDSRWKDTD
TTNLQDRKKLKQDTQRTRVHESPPQHDAIEIAELSLQLPADPEAWLNLLWEQERLAEPVKNNDRSQLEVLQITRP
PVSPADASLRASRRSARIEPNQQDAGESKPTVTLTQYHRHEETTTQPKQEDTRIPIHSPPRALPRPPF*
Coding >AgabiH97|008360
ATGCCAAAGATGGCTCCTCCGCTAGCTGTATTTCTTACTCTCTTCTACTGCATCCCGCGCATCTCTGGTTCTGTG
CGAGCTAAACGCGTATCTACCTCGGACGTCGATCCTCCCTTCCGGCTCAACCATACAGTAAACGGAAACCCGAGT
CACACATTCCTTTCTGCCACTTCTCCGGGGTTCTTTCTCAACCTCCAGATATCTCGTCACACATCACTCGTCAAG
TTTTACGGACATAAATGTTCAGGCGCATCTCTCTATGGCGTCCATCTTGCTTGTAGCAGCGAAAGTTTCGAAATC
GCTGATGGATATGATCCCTCCATTCCGACCCGTCTAGATACCCAGCCAAGTTGCATTTTCTCCCTGTCAATAGAC
CCAAGAGAAAATGTATCTTTGGAACTATACAATCTCTATGACCGGAGGTTTGGAGAGTACGGAACAGTCACCTTC
TCATTCGCTGAGTATATTCCCCAGGACGAAGCAGGATCCAGTGTTCATGATCAGATTTGTGGGCATCACCTTGAC
TTTTCCAACAACACAAGCACCCTTCTACCCCGAGATGGCGGTGAATCCTCCTCTACCAGCTTGTCGCAGCCCGAT
TCTGTGATGAGTGGCAAATTGAACATTGTAATTGGTTTATTGACTGCCCTCATCGTCATATTCCTTGCAGTAGTA
GTTGTCGTCACTACCTACGTGCTGCGCCTCCGTCGTCAAGCAGTGTTAGATCGTTTCAAAAAGGATCCAAAGGTT
AAATCTGGGAAGAATCAAAACGATACCGCTGATGCGTTTCTGGAATCAACCACTGCCACGGAGACGCTACAGGTG
CGATCTCAAGACCAGGGTGGCACTTCCTCCAAGAACCGGTACCTCGAAGACCATCAACCGTCCGTATATACCAAC
CCAACGTCTTCTTTATCCACTCGGGTCGAAACCGACAAACCCGTCTCTCCATCACGACCGCAGTTTCGAAACAAA
CCTCCGACTTCACCTCCCAGAGAACCTGTCCCCGAAGTCCCCAAGGTCCCATTTCCTTTACCCACCATTCAGTGT
AAAGGCAACGAGATCAATTGTAGTAGCTCAGGAAGCGCCACATACCCAAACAGTGGGATGACTGTCAGCCAAGCA
CGCCCATCAGAGCCTCGCAATCCAGAAAACTTGATGGATCAGCGAGCTGGCTCCACTCGCCCGGCCCAAACGAAA
ATTCCTCACTCTCGTTTCTCCAAACCGCTCCCTGGAATTCTTTCAGAAATTCCACTACCTTCACCATCGCATAAT
AACCGGCCCATTGCTCATTTCCCCGAGAGCAGTGGATCTTCAAATGACCTTCCAAGATATATTGATCCCAAGGGA
CGGCAAGCTGAGGTCCGCGATCAGACCATTCATGGACCAACCACAACTCGCGTAGGTCTTGACAGCTCAAACCAA
ATTTCCATGCATCCGAAGCTTGAACACATCAAAACGCCGGAAGAAGCACGGCAGGGAGCCCGATCACTCCATCAG
GATCTGCCAAGAACTAGGGTTGAATATGAAACTCCCATCAAGGTCAGCGGTGATTCTCGTTGGAAGGATACGGAT
ACCACCAACCTACAAGATCGGAAGAAGCTGAAGCAAGATACTCAACGTACACGAGTTCACGAAAGTCCACCACAA
CACGACGCCATCGAAATAGCGGAGTTGAGCCTTCAGCTCCCCGCTGATCCTGAAGCATGGCTCAATCTCCTCTGG
GAGCAGGAGAGACTTGCTGAGCCCGTAAAGAACAACGATAGATCTCAGTTGGAGGTGCTGCAGATAACGCGACCT
CCTGTTTCTCCAGCAGACGCGTCCTTACGTGCTTCCAGGAGAAGCGCTAGGATAGAACCAAACCAGCAAGATGCA
GGTGAAAGTAAACCCACTGTGACCTTAACACAGTATCACAGACACGAGGAGACGACCACGCAGCCGAAGCAGGAG
GATACACGTATTCCGATACATTCGCCTCCCCGTGCCCTCCCAAGGCCTCCATTTTAA
Transcript >AgabiH97|008360
ATGCCAAAGATGGCTCCTCCGCTAGCTGTATTTCTTACTCTCTTCTACTGCATCCCGCGCATCTCTGGTTCTGTG
CGAGCTAAACGCGTATCTACCTCGGACGTCGATCCTCCCTTCCGGCTCAACCATACAGTAAACGGAAACCCGAGT
CACACATTCCTTTCTGCCACTTCTCCGGGGTTCTTTCTCAACCTCCAGATATCTCGTCACACATCACTCGTCAAG
TTTTACGGACATAAATGTTCAGGCGCATCTCTCTATGGCGTCCATCTTGCTTGTAGCAGCGAAAGTTTCGAAATC
GCTGATGGATATGATCCCTCCATTCCGACCCGTCTAGATACCCAGCCAAGTTGCATTTTCTCCCTGTCAATAGAC
CCAAGAGAAAATGTATCTTTGGAACTATACAATCTCTATGACCGGAGGTTTGGAGAGTACGGAACAGTCACCTTC
TCATTCGCTGAGTATATTCCCCAGGACGAAGCAGGATCCAGTGTTCATGATCAGATTTGTGGGCATCACCTTGAC
TTTTCCAACAACACAAGCACCCTTCTACCCCGAGATGGCGGTGAATCCTCCTCTACCAGCTTGTCGCAGCCCGAT
TCTGTGATGAGTGGCAAATTGAACATTGTAATTGGTTTATTGACTGCCCTCATCGTCATATTCCTTGCAGTAGTA
GTTGTCGTCACTACCTACGTGCTGCGCCTCCGTCGTCAAGCAGTGTTAGATCGTTTCAAAAAGGATCCAAAGGTT
AAATCTGGGAAGAATCAAAACGATACCGCTGATGCGTTTCTGGAATCAACCACTGCCACGGAGACGCTACAGGTG
CGATCTCAAGACCAGGGTGGCACTTCCTCCAAGAACCGGTACCTCGAAGACCATCAACCGTCCGTATATACCAAC
CCAACGTCTTCTTTATCCACTCGGGTCGAAACCGACAAACCCGTCTCTCCATCACGACCGCAGTTTCGAAACAAA
CCTCCGACTTCACCTCCCAGAGAACCTGTCCCCGAAGTCCCCAAGGTCCCATTTCCTTTACCCACCATTCAGTGT
AAAGGCAACGAGATCAATTGTAGTAGCTCAGGAAGCGCCACATACCCAAACAGTGGGATGACTGTCAGCCAAGCA
CGCCCATCAGAGCCTCGCAATCCAGAAAACTTGATGGATCAGCGAGCTGGCTCCACTCGCCCGGCCCAAACGAAA
ATTCCTCACTCTCGTTTCTCCAAACCGCTCCCTGGAATTCTTTCAGAAATTCCACTACCTTCACCATCGCATAAT
AACCGGCCCATTGCTCATTTCCCCGAGAGCAGTGGATCTTCAAATGACCTTCCAAGATATATTGATCCCAAGGGA
CGGCAAGCTGAGGTCCGCGATCAGACCATTCATGGACCAACCACAACTCGCGTAGGTCTTGACAGCTCAAACCAA
ATTTCCATGCATCCGAAGCTTGAACACATCAAAACGCCGGAAGAAGCACGGCAGGGAGCCCGATCACTCCATCAG
GATCTGCCAAGAACTAGGGTTGAATATGAAACTCCCATCAAGGTCAGCGGTGATTCTCGTTGGAAGGATACGGAT
ACCACCAACCTACAAGATCGGAAGAAGCTGAAGCAAGATACTCAACGTACACGAGTTCACGAAAGTCCACCACAA
CACGACGCCATCGAAATAGCGGAGTTGAGCCTTCAGCTCCCCGCTGATCCTGAAGCATGGCTCAATCTCCTCTGG
GAGCAGGAGAGACTTGCTGAGCCCGTAAAGAACAACGATAGATCTCAGTTGGAGGTGCTGCAGATAACGCGACCT
CCTGTTTCTCCAGCAGACGCGTCCTTACGTGCTTCCAGGAGAAGCGCTAGGATAGAACCAAACCAGCAAGATGCA
GGTGAAAGTAAACCCACTGTGACCTTAACACAGTATCACAGACACGAGGAGACGACCACGCAGCCGAAGCAGGAG
GATACACGTATTCCGATACATTCGCCTCCCCGTGCCCTCCCAAGGCCTCCATTTTAA
Gene >AgabiH97|008360
ATGCCAAAGATGGCTCCTCCGCTAGCTGTATTTCTTACTCTCTTCTACTGCATCCCGCGCATCTCTGGTTCTGTG
CGAGCTAAACGCGTATCTACCTCGGACGTCGATCCTCCCTTCCGGCTCAACCATACAGTAAACGGAAACCCGAGT
CACACATTCCTTTCTGCCACTTCTCCGGGGTTCTTTCTCAACCTCCAGATATCTCGTAAATAAATATAAGATCGT
CTGTCAACGCTGCGCCCCCTTCTCACTCTACGCACAGGTCACACATCACTCGTCAAGTTTTACGGACATAAATGT
TCAGGCGCATCTCTCTATGGCGTCCATCTTGCTTGTAGCAGCGAAAGTTTCGAAATCGCTGATGGATATGATCCC
TCCATTCCGACCCGTCTAGATACCCAGCCAGTAAGCAAACAATACCGCCTCGTCACCACGGTTATCTAATTTTTT
TTCGTTCAGAGTTGCATTTTCTCCCTGTCAATAGACCCAAGAGAAAATGTATCTTTGGAACTATACAATCTCTAT
GACCGGAGGTTTGGAGAGTACGGAACAGTCACCTTCTCATTCGCTGAGTATATTCCCCAGGACGAAGGTACGAGT
ACAATCACATTGTCCGATGTCTGCAATGCGCAATTGACCAAATTACCGCAGCAGGATCCAGTGTTCATGATCAGA
TTTGTGGGCATCACCTTGACTTTTCCAACAACACAAGCACCCTTCTACCCCGAGATGGCGGTGAATCCTCCTCTA
CCAGCTTGTCGCAGCCCGATTCTGTGATGAGTGGCAAATTGAACATTGTAATTGGTTTATTGACTGCCCTCATCG
TCATATTCCTTGCAGTAGTAGTTGTCGTCACTACCTACGTGCTGCGCCTCCGTCGTCAAGCAGTGTTAGATCGTT
TCAAAAAGGATCCAAAGGTTAAATCTGGGAAGAATCAAAACGATACCGCTGATGCGTTTCTGGAATCAACCACTG
CCACGGAGACGCTACAGGTGCGATCTCAAGACCAGGGTGGCACTTCCTCCAAGAACCGGTACCTCGAAGACCATC
AACCGTCCGTATATACCAACCCAACGTCTTCTTTATCCACTCGGGTCGAAACCGACAAACCCGTCTCTCCATCAC
GACCGCAGTTTCGAAACAAACCTCCGACTTCACCTCCCAGAGAACCTGTCCCCGAAGTCCCCAAGGTCCCATTTC
CTTTACCCACCATTCAGTGTAAAGGCAACGAGATCAATTGTAGTAGCTCAGGAAGCGCCACATACCCAAACAGTG
GGATGACTGTCAGCCAAGCACGCCCATCAGAGCCTCGCAATCCAGAAAACTTGATGGATCAGCGAGCTGGCTCCA
CTCGCCCGGCCCAAACGAAAATTCCTCACTCTCGTTTCTCCAAACCGCTCCCTGGAATTCTTTCAGAAATTCCAC
TACCTTCACCATCGCATAATAACCGGCCCATTGCTCATTTCCCCGAGAGCAGTGGATCTTCAAATGACCTTCCAA
GATATATTGATCCCAAGGGACGGCAAGCTGAGGTCCGCGATCAGACCATTCATGGACCAACCACAACTCGCGTAG
GTCTTGACAGCTCAAACCAAATTTCCATGCATCCGAAGCTTGAACACATCAAAACGCCGGAAGAAGCACGGCAGG
GAGCCCGATCACTCCATCAGGATCTGCCAAGAACTAGGGTTGAATATGAAACTCCCATCAAGGTCAGCGGTGATT
CTCGTTGGAAGGATACGGATACCACCAACCTACAAGATCGGAAGAAGCTGAAGCAAGATACTCAACGTACACGAG
TTCACGAAAGTCCACCACAACACGACGCCATCGAAATAGCGGAGTTGAGCCTTCAGCTCCCCGCTGATCCTGAAG
CATGGCTCAATCTCCTCTGGGAGCAGGAGAGACTTGCTGAGCCCGTAAAGAACAACGATAGATCTCAGTTGGAGG
TGCTGCAGATAACGCGACCTCCTGTTTCTCCAGCAGACGCGTCCTTACGTGCTTCCAGGAGAAGCGCTAGGATAG
AACCAAACCAGCAAGATGCAGGTGAAAGTAAACCCACTGTGACCTTAACACAGTATCACAGACACGAGGAGACGA
CCACGCAGCCGAAGCAGGAGGATACACGTATTCCGATACATTCGCCTCCCCGTGCCCTCCCAAGGCCTCCATTTT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail