Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008300
Gene name
Locationscaffold_1:1953554..1955216
Strand+
Gene length (bp)1662
Transcript length (bp)1170
Coding sequence length (bp)1170
Protein length (aa) 390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00106 adh_short short chain dehydrogenase 7.7E-33 8 199
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 2.0E-13 14 209
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.7E-04 10 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39577|DLTE_BACSU Uncharacterized oxidoreductase DltE OS=Bacillus subtilis (strain 168) GN=dltE PE=3 SV=2 7 231 3.0E-33
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 6 212 5.0E-17
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 8 244 1.0E-15
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 6 203 8.0E-14
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 6 198 8.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39577|DLTE_BACSU Uncharacterized oxidoreductase DltE OS=Bacillus subtilis (strain 168) GN=dltE PE=3 SV=2 7 231 3.0E-33
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 6 212 5.0E-17
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 8 244 1.0E-15
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 6 203 8.0E-14
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 6 198 8.0E-13
sp|Q05016|YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR226C PE=1 SV=1 8 195 1.0E-12
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 10 207 1.0E-12
sp|Q09851|AYR1_SCHPO NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ayr1 PE=3 SV=2 4 197 2.0E-12
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 10 191 2.0E-12
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 6 197 2.0E-12
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 1 231 2.0E-12
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 10 191 2.0E-12
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 10 191 4.0E-12
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 10 191 6.0E-12
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 1 205 1.0E-11
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 1 205 1.0E-11
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 10 199 1.0E-11
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 8 201 2.0E-11
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 10 203 3.0E-11
sp|P69936|YDFG_SALTY NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ydfG PE=3 SV=1 10 191 3.0E-11
sp|P69935|YDFG_SALTI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Salmonella typhi GN=ydfG PE=3 SV=1 10 191 3.0E-11
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 7 195 6.0E-11
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 7 195 9.0E-11
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 7 197 1.0E-10
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 7 197 1.0E-10
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 7 197 1.0E-10
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 7 197 1.0E-10
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 7 197 1.0E-10
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 7 197 1.0E-10
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 7 195 2.0E-10
sp|P25145|Y432_LISMO Uncharacterized oxidoreductase Lmo0432 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0432 PE=3 SV=2 6 210 2.0E-10
sp|O14351|YB45_SCHPO Uncharacterized oxidoreductase C30D10.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC30D10.05c PE=3 SV=1 8 172 2.0E-10
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 11 199 6.0E-10
sp|A7TMJ2|MKAR_VANPO Very-long-chain 3-oxoacyl-CoA reductase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=Kpol_513p6 PE=3 SV=1 3 195 6.0E-10
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 7 195 8.0E-10
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 6 195 1.0E-09
sp|Q9STY8|HSD2_ARATH 11-beta-hydroxysteroid dehydrogenase-like 2 OS=Arabidopsis thaliana GN=HSD2 PE=2 SV=1 8 195 1.0E-09
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 6 210 2.0E-09
sp|P50201|MAS12_AGRRH Agropine synthesis reductase OS=Agrobacterium rhizogenes GN=mas1 PE=3 SV=1 4 195 2.0E-09
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 10 203 2.0E-09
sp|Q4R5G7|DHB12_MACFA Very-long-chain 3-oxoacyl-CoA reductase OS=Macaca fascicularis GN=HSD17B12 PE=2 SV=1 2 195 2.0E-09
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 7 197 3.0E-09
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 7 197 3.0E-09
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 8 207 4.0E-09
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 8 207 4.0E-09
sp|Q1QU27|ISFD2_CHRSD Sulfoacetaldehyde reductase 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD2 PE=1 SV=1 7 212 5.0E-09
sp|P45200|Y1430_HAEIN Probable NADP-dependent dehydrogenase HI_1430 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1430 PE=3 SV=1 6 190 5.0E-09
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 7 193 6.0E-09
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 6 195 6.0E-09
sp|D3U1D9|ISFD_KLEOX Sulfoacetaldehyde reductase OS=Klebsiella oxytoca GN=isfD PE=1 SV=1 4 212 7.0E-09
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 8 198 7.0E-09
sp|Q1R183|ISFD_CHRSD Sulfoacetaldehyde reductase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=isfD PE=1 SV=1 7 195 8.0E-09
sp|P40580|BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC24 PE=1 SV=1 8 198 9.0E-09
sp|P37079|SORD_KLEPN Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 9 192 1.0E-08
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 6 195 1.0E-08
sp|Q9STY7|HSD3_ARATH 11-beta-hydroxysteroid dehydrogenase-like 3 OS=Arabidopsis thaliana GN=HSD3 PE=3 SV=1 8 195 1.0E-08
sp|O05730|VDLC_HELPY Probable short-chain type dehydrogenase/reductase VdlC OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=vdlC PE=3 SV=2 5 205 1.0E-08
sp|P50202|MAS1_AGRT9 Agropine synthesis reductase OS=Agrobacterium tumefaciens (strain 15955) GN=mas1 PE=3 SV=1 6 195 1.0E-08
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 8 197 2.0E-08
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 11 217 2.0E-08
sp|O32229|YVAG_BACSU Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 6 188 2.0E-08
sp|P51658|DHB2_MOUSE Estradiol 17-beta-dehydrogenase 2 OS=Mus musculus GN=Hsd17b2 PE=1 SV=2 6 207 2.0E-08
sp|Q5XG41|DH12A_XENLA Very-long-chain 3-oxoacyl-CoA reductase-A OS=Xenopus laevis GN=hsd17b12-a PE=2 SV=1 8 195 2.0E-08
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 6 195 3.0E-08
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 8 207 3.0E-08
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 6 203 3.0E-08
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 8 197 3.0E-08
sp|P40579|YIV5_YEAST Uncharacterized oxidoreductase YIR035C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIR035C PE=1 SV=1 8 196 4.0E-08
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 5 209 4.0E-08
sp|Q9LUE4|HSD6_ARATH 11-beta-hydroxysteroid dehydrogenase-like 6 OS=Arabidopsis thaliana GN=HSD6 PE=2 SV=1 8 195 5.0E-08
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 6 200 6.0E-08
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 6 215 6.0E-08
sp|G5DGA8|IDLDH_IPSPI Ipsdienol dehydrogenase OS=Ips pini GN=IDOLDH PE=1 SV=1 11 195 6.0E-08
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 8 195 6.0E-08
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 8 195 6.0E-08
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 7 226 7.0E-08
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 2 203 8.0E-08
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 7 210 1.0E-07
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 6 203 1.0E-07
sp|O70503|DHB12_MOUSE Very-long-chain 3-oxoacyl-CoA reductase OS=Mus musculus GN=Hsd17b12 PE=1 SV=1 11 195 2.0E-07
sp|Q28IU1|DHB12_XENTR Very-long-chain 3-oxoacyl-CoA reductase OS=Xenopus tropicalis GN=hsd17b12 PE=2 SV=1 8 195 2.0E-07
sp|Q6P3L6|DH12A_DANRE Very-long-chain 3-oxoacyl-CoA reductase-A OS=Danio rerio GN=hsd17b12a PE=2 SV=1 8 195 3.0E-07
sp|A5PJF6|HSDL1_BOVIN Inactive hydroxysteroid dehydrogenase-like protein 1 OS=Bos taurus GN=HSDL1 PE=2 SV=1 11 195 3.0E-07
sp|O57314|DHB12_ANAPL Very-long-chain 3-oxoacyl-CoA reductase OS=Anas platyrhynchos GN=HSD17B12 PE=2 SV=1 11 195 3.0E-07
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 6 215 3.0E-07
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 8 195 4.0E-07
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 8 195 4.0E-07
sp|Q9R092|H17B6_MOUSE 17-beta-hydroxysteroid dehydrogenase type 6 OS=Mus musculus GN=Hsd17b6 PE=1 SV=1 6 234 5.0E-07
sp|P50200|HDHA_CLOSO NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1 6 194 5.0E-07
sp|P9WGP9|SADH_MYCTU Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sadH PE=2 SV=1 6 176 5.0E-07
sp|P9WGP8|SADH_MYCTO Putative oxidoreductase SadH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sadH PE=3 SV=1 6 176 5.0E-07
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 7 195 5.0E-07
sp|Q62730|DHB2_RAT Estradiol 17-beta-dehydrogenase 2 OS=Rattus norvegicus GN=Hsd17b2 PE=2 SV=1 6 207 5.0E-07
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 8 204 6.0E-07
sp|Q9SY73|PTALR_ARATH NADPH-dependent pterin aldehyde reductase OS=Arabidopsis thaliana GN=At1g10310 PE=1 SV=1 4 195 7.0E-07
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 6 215 7.0E-07
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 6 195 8.0E-07
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 6 195 8.0E-07
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 8 204 8.0E-07
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 8 204 8.0E-07
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 8 204 8.0E-07
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 7 188 1.0E-06
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 8 198 1.0E-06
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 8 195 1.0E-06
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 8 195 1.0E-06
sp|A6ZLA1|MKAR_YEAS7 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_0371 PE=3 SV=1 3 195 1.0E-06
sp|B3LN00|MKAR_YEAS1 Very-long-chain 3-oxoacyl-CoA reductase OS=Saccharomyces cerevisiae (strain RM11-1a) GN=SCRG_02811 PE=3 SV=1 3 195 1.0E-06
sp|Q09517|LE767_CAEEL Very-long-chain 3-oxooacyl-coA reductase let-767 OS=Caenorhabditis elegans GN=let-767 PE=1 SV=2 11 195 2.0E-06
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 6 215 2.0E-06
sp|Q29608|DHI1_SAISC Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Saimiri sciureus GN=HSD11B1 PE=2 SV=3 2 194 2.0E-06
sp|Q8KES3|SPRE_CHLTE Sepiapterin reductase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=CT0609 PE=1 SV=1 10 220 2.0E-06
sp|Q9N126|RDH8_BOVIN Retinol dehydrogenase 8 OS=Bos taurus GN=RDH8 PE=1 SV=1 8 196 2.0E-06
sp|Q21929|DCXR_CAEEL L-xylulose reductase OS=Caenorhabditis elegans GN=dhs-21 PE=1 SV=2 8 218 2.0E-06
sp|P9WGR5|Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0484c PE=1 SV=1 8 195 2.0E-06
sp|P9WGR4|Y484_MYCTO Uncharacterized oxidoreductase MT0502 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0502 PE=3 SV=1 8 195 2.0E-06
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 6 200 2.0E-06
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 6 198 2.0E-06
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 1 202 3.0E-06
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 1 202 3.0E-06
sp|O75828|CBR3_HUMAN Carbonyl reductase [NADPH] 3 OS=Homo sapiens GN=CBR3 PE=1 SV=3 7 126 3.0E-06
sp|Q0U3N7|MKAR_PHANO Very-long-chain 3-oxoacyl-CoA reductase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_13627 PE=3 SV=1 11 183 3.0E-06
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 6 194 4.0E-06
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 1 210 4.0E-06
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 10 194 5.0E-06
sp|P28845|DHI1_HUMAN Corticosteroid 11-beta-dehydrogenase isozyme 1 OS=Homo sapiens GN=HSD11B1 PE=1 SV=3 2 194 5.0E-06
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 6 195 6.0E-06
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 6 195 6.0E-06
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 8 207 6.0E-06
sp|Q6P7J1|DHI1A_XENLA Hydroxysteroid 11-beta-dehydrogenase 1-like protein A OS=Xenopus laevis GN=hsd11b1l-a PE=2 SV=1 8 194 6.0E-06
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 7 197 7.0E-06
sp|Q8K354|CBR3_MOUSE Carbonyl reductase [NADPH] 3 OS=Mus musculus GN=Cbr3 PE=1 SV=1 7 126 7.0E-06
sp|Q0WRJ2|TC10A_ARATH 3-dehydrosphinganine reductase TSC10A OS=Arabidopsis thaliana GN=TSC10A PE=1 SV=1 6 231 8.0E-06
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 7 208 9.0E-06
sp|Q9BPW9|DHRS9_HUMAN Dehydrogenase/reductase SDR family member 9 OS=Homo sapiens GN=DHRS9 PE=1 SV=1 8 231 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008300
MPGIEESKCILVTGATAGIGRALALSLAKLPSKPQVIAAGRRQSRLDELRKEGLETLQLDLDTDALTLKKSVDFI
LEKYPQLDAVILNAGVQYEFDLKKEVDINKLLSEVNINYTAVVTMITYLTPHFLKLSESGRPSFIIPVTAGLGIV
PAVWTPGYSASKAAIHSFTTSLRVQLNDTNVHVLEIIPPLVESELHDDAGTTDKLTKLWMPLDEYIDVTMQGLRN
GDTIISTGKSLSLYEKFDKEKDGTIALMKEAREKWAPFRSNIRRANDANGRERMYALIRCREKQQCRIYLGARIM
RSPDFLYNHLIRTGYSGFLIIYSASKAGIDCSSLLLNEQLGVKVLGVVLPSGNPPQHRNVIALNDLHDGNSYRFN
LLDCSEAHIRIRLD*
Coding >AgabiH97|008300
ATGCCTGGAATTGAAGAAAGCAAATGCATCCTAGTTACTGGAGCTACCGCTGGAATAGGTCGAGCCTTGGCTCTG
AGCTTAGCCAAGTTACCTTCCAAGCCACAAGTCATCGCCGCTGGGAGACGACAGAGTAGACTCGATGAACTTCGA
AAAGAAGGCTTAGAGACTCTCCAACTTGATTTGGACACTGATGCTCTTACATTGAAAAAATCCGTCGATTTCATT
CTCGAGAAATATCCTCAGCTCGACGCAGTCATTCTGAATGCTGGTGTACAGTACGAATTTGACTTGAAAAAGGAG
GTGGACATCAACAAATTGTTATCCGAAGTGAACATCAATTATACCGCCGTCGTAACGATGATTACCTACCTCACT
CCACATTTCTTGAAGCTTTCGGAATCGGGTCGACCCTCGTTCATAATCCCTGTGACTGCTGGTTTGGGCATTGTC
CCTGCCGTATGGACTCCTGGTTATTCCGCTTCGAAAGCCGCCATTCATTCTTTCACTACAAGTTTGCGAGTACAA
CTGAACGATACCAATGTTCACGTTTTGGAAATAATCCCACCACTTGTAGAATCGGAACTGCATGATGACGCGGGC
ACTACGGACAAGCTCACCAAGTTATGGATGCCCCTCGATGAATACATCGACGTCACGATGCAAGGACTAAGGAAT
GGCGATACTATCATATCTACGGGGAAATCACTCAGCTTGTACGAAAAGTTTGACAAAGAAAAGGATGGTACAATA
GCCTTGATGAAAGAAGCAAGGGAGAAATGGGCGCCCTTTAGATCAAATATCCGCCGAGCAAATGACGCGAATGGA
AGAGAAAGGATGTATGCGTTAATACGATGCAGAGAAAAACAGCAATGTCGAATTTATTTGGGTGCTCGGATCATG
AGATCGCCAGACTTCCTTTATAACCATCTCATCAGGACAGGCTATTCCGGGTTCCTAATTATTTACAGCGCTTCA
AAAGCCGGAATTGATTGCTCGTCGCTTCTCTTAAATGAACAGTTGGGTGTCAAAGTTCTCGGAGTTGTTCTTCCG
TCGGGAAACCCTCCGCAACATCGCAACGTGATCGCATTGAATGACCTTCACGACGGCAATAGCTACCGCTTCAAT
CTTCTAGACTGTAGCGAGGCACACATAAGGATCCGCCTTGATTAG
Transcript >AgabiH97|008300
ATGCCTGGAATTGAAGAAAGCAAATGCATCCTAGTTACTGGAGCTACCGCTGGAATAGGTCGAGCCTTGGCTCTG
AGCTTAGCCAAGTTACCTTCCAAGCCACAAGTCATCGCCGCTGGGAGACGACAGAGTAGACTCGATGAACTTCGA
AAAGAAGGCTTAGAGACTCTCCAACTTGATTTGGACACTGATGCTCTTACATTGAAAAAATCCGTCGATTTCATT
CTCGAGAAATATCCTCAGCTCGACGCAGTCATTCTGAATGCTGGTGTACAGTACGAATTTGACTTGAAAAAGGAG
GTGGACATCAACAAATTGTTATCCGAAGTGAACATCAATTATACCGCCGTCGTAACGATGATTACCTACCTCACT
CCACATTTCTTGAAGCTTTCGGAATCGGGTCGACCCTCGTTCATAATCCCTGTGACTGCTGGTTTGGGCATTGTC
CCTGCCGTATGGACTCCTGGTTATTCCGCTTCGAAAGCCGCCATTCATTCTTTCACTACAAGTTTGCGAGTACAA
CTGAACGATACCAATGTTCACGTTTTGGAAATAATCCCACCACTTGTAGAATCGGAACTGCATGATGACGCGGGC
ACTACGGACAAGCTCACCAAGTTATGGATGCCCCTCGATGAATACATCGACGTCACGATGCAAGGACTAAGGAAT
GGCGATACTATCATATCTACGGGGAAATCACTCAGCTTGTACGAAAAGTTTGACAAAGAAAAGGATGGTACAATA
GCCTTGATGAAAGAAGCAAGGGAGAAATGGGCGCCCTTTAGATCAAATATCCGCCGAGCAAATGACGCGAATGGA
AGAGAAAGGATGTATGCGTTAATACGATGCAGAGAAAAACAGCAATGTCGAATTTATTTGGGTGCTCGGATCATG
AGATCGCCAGACTTCCTTTATAACCATCTCATCAGGACAGGCTATTCCGGGTTCCTAATTATTTACAGCGCTTCA
AAAGCCGGAATTGATTGCTCGTCGCTTCTCTTAAATGAACAGTTGGGTGTCAAAGTTCTCGGAGTTGTTCTTCCG
TCGGGAAACCCTCCGCAACATCGCAACGTGATCGCATTGAATGACCTTCACGACGGCAATAGCTACCGCTTCAAT
CTTCTAGACTGTAGCGAGGCACACATAAGGATCCGCCTTGATTAG
Gene >AgabiH97|008300
ATGCCTGGAATTGAAGAAAGCAAATGCATCCTAGTTACTGGAGCTACCGCTGGAATAGGTCGAGCCTTGGCTCTG
AGCTTAGCCAAGTTACCTTCCAAGCCACAAGTCATCGCCGCTGGGAGACGACAGAGTAGACTCGATGAACTTCGA
AAAGAAGGCTTAGAGACTCTCCAACTTGATTTGGACACTGATGCTCTTACATTGAAAAAATCCGTCGATTTCATT
CTCGAGAAATATCCTCAGGTGTGTCGTCTTACTTGGGTGATGTCACTAACAATTGATTAACGTCTTCCGTTCAGC
TCGACGCAGTCATTCTGAATGCTGGTGTACAGTACGAATTTGACTTGAAAAAGGAGGTGGACATCAACAGTAAGT
TAGTTTTCGGACGTTATGAACAGTCTATCAGAACTAATCCAAACATCATGTAGAATTGTTATCCGAAGTGAACAT
CAATTATACCGCCGTCGTAACGATGATTACCTACCTCACTCCACATTTCTTGAAGCTTTCGGTATGTTGTACTCT
GACAGGTCAATTTGTTCTTGTGGCTTATTATTCAAAGGAATCGGGTCGACCCTCGTTCATAATCCCTGTGACTGC
TGGTTTGGGCATTGTCCCTGCCGTATGGACTCCTGGTTATTCCGCTTCGAAAGCCGCCATTCATTCTTTCACTAC
AAGTTTGCGAGTACAACTGAACGATACCAATGTTCACGTTTTGGAAATAATCCCACCGTAAGCTCTTCATCAAGC
ATTCTCTACTGTGTACCTCCGCATGATACACTATTTCAGACTTGTAGAATCGGAACTGCATGATGGTCAGTTGTA
TTATAATATTCTTTACTTCTGATTTATGATTTGTTGGTAGACGCGGGCACTACGGACAAGCTCACCAAGTTATGG
ATGCCCCTCGATGAATACATCGACGTCACGATGCAAGGACTAAGGAATGGCGATACTATCATATCTACGGGGAAA
TCACTCAGCTTGTACGAAAAGTTTGACAAAGAAAAGGATGGTACAATAGCCTTGATGAAAGAAGCAAGGGAGAAA
TGGTGAAGACCTCGATATACCTGGGTATGTCCTGTCTCTTTATGGCCAAACGATAGGGCGCCCTTTAGATCAAAT
ATCCGCCGAGCAAATGACGCGAATGGAAGAGAAAGGATGTATGCGTTAATACGATGCAGAGAAAAACAGCAATGT
CGAATTTATTTGGGTGGTATGTGGGCGTATTCAAGTTAATCGCAGTGGTTTAAAATAAATTACTCTTCGAGCTCG
GAGTAAGTACCAAGCCTTCTTAGCATCCGCCCTGGCCTGCTAAGAGAAACTTGTGATTGTAGTCATGAGATCGCC
AGACTTCCTTTATAACCATCTCATCAGGACAGGCTATTCCGGGTTCCTAATTATTTACAGCGCTTCAAAAGCCGG
AATTGATTGCTCGTCGCTTCTCTTAAATGAACAGTTGGGTGTCAAAGTTCTCGGAGTTGTTCTTCCGTCGGGAAA
CCCTCCGCAACATCGCAACGGTATATGTATCCAAGCCGACCAATGCTCACGTAGATGTTATTTATTATAGTGATC
GCATTGAATGACCTTCACGACGGCAATAGCTACCGCTTCAATCTTCTAGACTGTAGCGAGGCACACATAAGGATC
CGCCTTGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail