Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008290
Gene name
Locationscaffold_1:1952397..1953405
Strand-
Gene length (bp)1008
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13176 TPR_7 Tetratricopeptide repeat 5.5E-04 114 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens GN=TTC1 PE=1 SV=1 23 243 3.0E-20
sp|Q3ZBR5|TTC1_BOVIN Tetratricopeptide repeat protein 1 OS=Bos taurus GN=TTC1 PE=2 SV=1 21 243 1.0E-19
sp|Q91Z38|TTC1_MOUSE Tetratricopeptide repeat protein 1 OS=Mus musculus GN=Ttc1 PE=1 SV=1 29 243 2.0E-18
sp|Q9MAH1|TTL1_ARATH TPR repeat-containing thioredoxin TTL1 OS=Arabidopsis thaliana GN=TTL1 PE=1 SV=1 82 191 5.0E-09
sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 109 184 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99614|TTC1_HUMAN Tetratricopeptide repeat protein 1 OS=Homo sapiens GN=TTC1 PE=1 SV=1 23 243 3.0E-20
sp|Q3ZBR5|TTC1_BOVIN Tetratricopeptide repeat protein 1 OS=Bos taurus GN=TTC1 PE=2 SV=1 21 243 1.0E-19
sp|Q91Z38|TTC1_MOUSE Tetratricopeptide repeat protein 1 OS=Mus musculus GN=Ttc1 PE=1 SV=1 29 243 2.0E-18
sp|Q9MAH1|TTL1_ARATH TPR repeat-containing thioredoxin TTL1 OS=Arabidopsis thaliana GN=TTL1 PE=1 SV=1 82 191 5.0E-09
sp|Q9SIN1|TTL3_ARATH Inactive TPR repeat-containing thioredoxin TTL3 OS=Arabidopsis thaliana GN=TTL3 PE=1 SV=2 109 184 3.0E-08
sp|Q7DMA9|PAS1_ARATH Peptidyl-prolyl cis-trans isomerase PASTICCINO1 OS=Arabidopsis thaliana GN=PAS1 PE=1 SV=2 15 212 1.0E-07
sp|Q84JR9|TTL4_ARATH TPR repeat-containing thioredoxin TTL4 OS=Arabidopsis thaliana GN=TTL4 PE=2 SV=1 107 236 2.0E-07
sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 19 204 5.0E-07
sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 19 204 9.0E-07
sp|P26882|PPID_BOVIN Peptidyl-prolyl cis-trans isomerase D OS=Bos taurus GN=PPID PE=1 SV=6 29 203 2.0E-06
sp|Q15785|TOM34_HUMAN Mitochondrial import receptor subunit TOM34 OS=Homo sapiens GN=TOMM34 PE=1 SV=2 104 189 6.0E-06
sp|Q9UIM3|FKBPL_HUMAN FK506-binding protein-like OS=Homo sapiens GN=FKBPL PE=1 SV=1 108 184 7.0E-06
sp|A4K2V0|TOM34_PONAB Mitochondrial import receptor subunit TOM34 OS=Pongo abelii GN=TOMM34 PE=2 SV=1 104 189 8.0E-06
sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 20 183 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008290
MASDTPVQVTLQAESLPIEDRIREANTRKTEGNDSFRKSDWEEALSAYESALVFLPKSTVTLDDNRSHESPPQTE
EEDEPTRHTEDPTPKSTQESIDPEMEKKCANLRSILNANIGACYVKLGEHKKAVEACTRALADDPKYVKALQRRA
TSNDILDTWTSLTSAQEDYNSLLELLPPGQETQEVQTKLRKLKPRLEVAQKKETTEMLGELKTLGDSVLGNFGLS
TDNFKFEPNGQGGYSVNFQR*
Coding >AgabiH97|008290
ATGGCAAGTGATACACCAGTCCAAGTTACCCTCCAAGCAGAGTCACTACCCATAGAAGATCGAATACGCGAGGCA
AACACGCGAAAAACAGAAGGAAATGATTCTTTTCGAAAAAGCGATTGGGAAGAAGCTCTATCAGCCTATGAATCC
GCTCTTGTCTTCCTTCCAAAATCAACAGTAACGCTAGACGATAACCGATCTCATGAATCTCCTCCACAGACGGAG
GAGGAAGATGAACCTACTCGACACACTGAGGATCCGACACCAAAATCTACACAAGAAAGTATCGACCCGGAGATG
GAGAAGAAATGTGCGAATCTCAGATCAATTCTGAATGCTAATATAGGAGCATGCTATGTGAAACTAGGAGAGCAC
AAAAAGGCTGTGGAAGCATGCACCCGAGCGTTGGCTGATGATCCTAAATACGTGAAAGCTCTTCAAAGGCGGGCC
ACCTCGAATGATATTTTGGATACATGGACATCGTTAACGTCTGCACAAGAAGATTACAATTCTCTACTAGAATTA
CTGCCTCCTGGCCAAGAGACGCAAGAGGTCCAGACAAAGCTACGGAAGTTGAAGCCGAGGCTAGAAGTGGCCCAG
AAGAAGGAAACTACGGAAATGCTGGGCGAACTAAAAACGTTGGGCGATAGTGTATTGGGGAATTTCGGCCTTTCG
ACAGACAACTTCAAATTCGAGCCGAACGGACAGGGAGGCTATTCTGTCAATTTCCAACGATAG
Transcript >AgabiH97|008290
ATGGCAAGTGATACACCAGTCCAAGTTACCCTCCAAGCAGAGTCACTACCCATAGAAGATCGAATACGCGAGGCA
AACACGCGAAAAACAGAAGGAAATGATTCTTTTCGAAAAAGCGATTGGGAAGAAGCTCTATCAGCCTATGAATCC
GCTCTTGTCTTCCTTCCAAAATCAACAGTAACGCTAGACGATAACCGATCTCATGAATCTCCTCCACAGACGGAG
GAGGAAGATGAACCTACTCGACACACTGAGGATCCGACACCAAAATCTACACAAGAAAGTATCGACCCGGAGATG
GAGAAGAAATGTGCGAATCTCAGATCAATTCTGAATGCTAATATAGGAGCATGCTATGTGAAACTAGGAGAGCAC
AAAAAGGCTGTGGAAGCATGCACCCGAGCGTTGGCTGATGATCCTAAATACGTGAAAGCTCTTCAAAGGCGGGCC
ACCTCGAATGATATTTTGGATACATGGACATCGTTAACGTCTGCACAAGAAGATTACAATTCTCTACTAGAATTA
CTGCCTCCTGGCCAAGAGACGCAAGAGGTCCAGACAAAGCTACGGAAGTTGAAGCCGAGGCTAGAAGTGGCCCAG
AAGAAGGAAACTACGGAAATGCTGGGCGAACTAAAAACGTTGGGCGATAGTGTATTGGGGAATTTCGGCCTTTCG
ACAGACAACTTCAAATTCGAGCCGAACGGACAGGGAGGCTATTCTGTCAATTTCCAACGATAG
Gene >AgabiH97|008290
ATGGCAAGTGATACACCAGTCCAAGTTACCCTCCAAGCAGAGTCACTACCCATAGAAGTGAGTCGACAAAAACGC
CTGTCTGAACTTGGTCGTATGCTGACATGAGATATAGGATCGAATACGCGAGGCAAACACGCGAAAAACAGAAGG
AAATGATTCTTTTCGAAAAAGCGATTGGGAAGAAGCTCTATCAGCCTATGAATCCGCTCTTGTCTTCCTTCCAAA
ATCAACAGTAACGCTAGACGATAACCGATCTCATGAATCTCCTCCACAGACGGAGGAGGAAGATGAACCTACTCG
ACACACTGAGGATCCGACACCAAAATCTACACAAGAAAGTATCGACCCGGAGATGGAGAAGAAATGTGCGAATCT
CAGATCAATTCTGAATGCTAATATAGGAGCATGCTATGTGAAACTAGTGAGTTACATATCTGAACGTCGTATAGC
AGCCATTGGCTGATCGACCGGAGAGGGAGAGCACAAAAAGGCTGTGGAAGCATGCACCCGAGGTACGTATTTATT
CTACCGAAGAAAGTTATGACATGCAAACGTGTTTTCTTTATAGCGTTGGCTGATGATCCTAAATACGTGAAAGCT
CTTCAAAGGCGGGCCACCTCGAATGATATTTTGGATACATGGACATCGTTAACGTCTGCACAAGAAGGTTTTTCT
CGCCATTATAGATCACCGAGTCTAGATTTGACGATACATTCAACAGATTACAATTCTCTACTAGAATTACTGCCT
CCTGGCCAAGAGACGCAAGAGGTCCAGACAAAGCTACGGAAGTTGAAGCCGAGGCTAGAAGTGGCCCAGAAGAAG
GAAACTACGGAAATGCTGGGCGAACTAAAAACGTTGGGCGATAGTGTATTGGGTATGCTTTCAGTTGCGTCTTAA
AGAAGCACATCTTGACCGTGACATCTAGGGAATTTCGGCCTTTCGACAGACAACTTCAAATTCGAGCCGAACGGA
CAGGGAGGCTATTCTGTCAATTTCCAACGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail