Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008240
Gene name
Locationscaffold_1:1935536..1938706
Strand-
Gene length (bp)3170
Transcript length (bp)2478
Coding sequence length (bp)2478
Protein length (aa) 826

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00734 CBM_1 Fungal cellulose binding domain 2.8E-10 792 819

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3MUH7|XG74_PAESP Xyloglucanase OS=Paenibacillus sp. GN=xeg74 PE=1 SV=1 6 764 0.0E+00
sp|A3DFA0|XG74_CLOTH Xyloglucanase Xgh74A OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=xghA PE=3 SV=1 25 754 0.0E+00
sp|Q70DK5|XG74_CLOTM Xyloglucanase Xgh74A OS=Clostridium thermocellum GN=xghA PE=1 SV=1 25 754 0.0E+00
sp|Q7Z9M8|XG74_HYPJQ Xyloglucanase OS=Hypocrea jecorina (strain QM6a) GN=cel74a PE=1 SV=1 16 823 0.0E+00
sp|Q8J0D2|CBHRE_GEOS1 Oligoxyloglucan reducing end-specific cellobiohydrolase OS=Geotrichum sp. (strain M128) PE=1 SV=1 24 746 2.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3MUH7|XG74_PAESP Xyloglucanase OS=Paenibacillus sp. GN=xeg74 PE=1 SV=1 6 764 0.0E+00
sp|A3DFA0|XG74_CLOTH Xyloglucanase Xgh74A OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=xghA PE=3 SV=1 25 754 0.0E+00
sp|Q70DK5|XG74_CLOTM Xyloglucanase Xgh74A OS=Clostridium thermocellum GN=xghA PE=1 SV=1 25 754 0.0E+00
sp|Q7Z9M8|XG74_HYPJQ Xyloglucanase OS=Hypocrea jecorina (strain QM6a) GN=cel74a PE=1 SV=1 16 823 0.0E+00
sp|Q8J0D2|CBHRE_GEOS1 Oligoxyloglucan reducing end-specific cellobiohydrolase OS=Geotrichum sp. (strain M128) PE=1 SV=1 24 746 2.0E-99
sp|Q5BD38|XGCA_EMENI Oligoxyloglucan-reducing end-specific xyloglucanase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xgcA PE=1 SV=1 8 746 4.0E-95
sp|A1DAU0|XGCA_NEOFI Probable oligoxyloglucan-reducing end-specific xyloglucanase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xgcA PE=3 SV=1 5 746 4.0E-90
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 792 824 7.0E-08
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 792 824 7.0E-08
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 787 824 2.0E-07
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 793 824 4.0E-07
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 792 824 4.0E-07
sp|Q9UVS8|CBHB_ASPNG 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger GN=cbhB PE=2 SV=1 792 823 7.0E-07
sp|Q9P8P3|GUX1_TRIHA Exoglucanase 1 OS=Trichoderma harzianum GN=cbh1 PE=1 SV=1 771 823 7.0E-07
sp|A2QAI7|CBHB_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhB PE=3 SV=1 792 823 7.0E-07
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 787 824 8.0E-07
sp|Q5BCX8|EGLD_EMENI Endo-beta-1,4-glucanase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglD PE=1 SV=1 753 823 9.0E-07
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 794 824 1.0E-06
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 793 824 1.0E-06
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 793 824 1.0E-06
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 793 824 2.0E-06
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 792 824 3.0E-06
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 792 824 8.0E-06
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 793 823 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0030247 polysaccharide binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0110165 cellular anatomical entity No
GO:0044238 primary metabolic process No
GO:0030246 carbohydrate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008240
MPSRVKFWITLTLGTFSLVYGQAASQSYRWQNVKIGGGGGFVPGIVFNPSEKGLAYARTDIGGAYKLNADDTWTP
LLDFADDSRWNYWGVDALATDPVQPNRLYLATGLYTNSWDPSNGHILISSDYGKTFDAAPLPFKLGGNMPGRGMG
ERLVVDPNLNSVLYFGARSGNGLWKSTNSGQSWSKVTSFTDTGSFVPDPSDSTGLNSDKIGIAWVTIDKASGSSG
SATPRIFVGVANKGSNSIYISTNGGSSWSAVAGQPTSFLPHKGVLSASERALYITYSDGGGPYDGTSGAVYKYNI
DTGAWTDITPVSGSDLFFGFGGLALDTQKNGTVMVAALNSWWPDGQIFRSTNGGASWTPLWDWAVYPTLNKYYSY
NAALAPWIGPNIVDVTPGNLQIGWMMESLSIDPFDSNHWLYGTGETIYGSRDLLKWDSAHNVTIKSLADGVEETS
VQALISPPSGPPLVSAIGDVGGFVHQSLTRAPSAQFTNPKWSTSADIDFAGNNPSNVVRIGTGDSTSGKQVAISS
DYGVTWNQHFGAPDNVQGGKVAISADADTILWRTNGNGVMVSRNQATFSTVSSLPSDAAIASDKKTNNIFYGASG
KTFYVSTDNGKTFSAHGSLGSATSVFDIAVPPSVSGDIWASTDKGLFHSTDSGATFSAISGITQAWGVALGAPKS
TGGYPAVFVAANYGGEVAYFRSDDRGVNWVKINDAAHGFGAASANCMAADPRVYGRVYIGTNGRGIFYGDVAGSA
PPPTSSATSTTSVSTTTTRSTTTTRSTTTTTSSGNGSPVSGFGQCGGQGWTGGTTCVTGFQCVAQNPFYSQCIPI
*
Coding >AgabiH97|008240
ATGCCCAGCAGAGTTAAATTCTGGATAACTCTGACACTTGGCACCTTCAGCCTTGTCTACGGGCAAGCAGCTTCT
CAGTCTTATAGGTGGCAGAATGTCAAGATCGGCGGTGGTGGTGGGTTTGTCCCCGGCATTGTCTTCAATCCTTCC
GAAAAGGGACTGGCGTATGCTCGCACTGACATCGGAGGAGCCTACAAGCTGAATGCTGATGATACTTGGACGCCT
CTACTTGATTTCGCTGATGATTCTCGGTGGAATTATTGGGGCGTCGATGCTCTTGCAACTGATCCCGTACAACCC
AACCGTCTTTACCTGGCGACTGGGTTGTATACCAACTCATGGGACCCAAGTAACGGCCATATTCTCATATCAAGT
GATTATGGTAAAACATTCGATGCCGCGCCCTTGCCATTCAAGCTCGGTGGTAATATGCCTGGGCGTGGAATGGGA
GAGCGTCTCGTCGTCGATCCCAACCTGAACAGCGTCCTTTATTTTGGCGCTCGCAGTGGTAACGGTCTCTGGAAG
TCAACAAATTCGGGTCAGAGCTGGAGCAAGGTAACAAGCTTCACTGACACTGGGTCTTTCGTTCCCGATCCATCA
GATAGCACCGGCCTGAATTCTGATAAAATTGGGATCGCATGGGTTACCATCGATAAAGCGTCAGGCTCCTCTGGT
TCCGCCACTCCCCGTATATTTGTCGGCGTTGCGAACAAGGGCTCAAACAGCATTTATATATCTACGAATGGCGGT
TCCTCTTGGAGTGCCGTCGCAGGTCAACCAACTAGCTTCCTGCCACATAAGGGCGTTCTATCCGCTTCTGAGAGG
GCACTTTATATCACTTACTCCGATGGTGGCGGTCCTTACGATGGCACAAGCGGTGCAGTTTACAAGTACAACATT
GACACTGGCGCATGGACTGACATAACACCCGTCAGCGGAAGCGATCTCTTCTTTGGTTTCGGAGGTCTAGCCTTA
GATACACAGAAAAACGGGACTGTCATGGTTGCAGCCCTCAACTCGTGGTGGCCTGATGGTCAGATATTCCGCTCG
ACCAACGGGGGTGCATCTTGGACTCCGCTGTGGGACTGGGCAGTCTACCCGACTCTCAACAAATACTACAGTTAT
AACGCTGCCCTGGCGCCGTGGATAGGACCCAACATCGTTGATGTCACCCCCGGAAATCTGCAAATCGGGTGGATG
ATGGAATCACTATCCATTGATCCTTTCGACTCGAATCATTGGCTCTACGGCACTGGAGAAACTATCTATGGAAGT
CGTGACCTCCTCAAATGGGACAGTGCACACAACGTCACCATCAAGTCGCTCGCAGATGGTGTCGAGGAAACCTCC
GTCCAAGCCCTTATTTCACCTCCTTCCGGACCGCCTCTTGTTTCTGCTATTGGTGACGTTGGCGGTTTTGTCCAC
CAATCACTTACCCGTGCACCCAGCGCCCAGTTTACCAATCCCAAGTGGTCGACCTCGGCTGACATCGATTTCGCT
GGCAACAACCCTAGTAATGTCGTTCGCATTGGTACTGGTGATAGTACTAGTGGCAAACAGGTCGCCATCTCTTCC
GACTATGGCGTTACTTGGAATCAGCATTTTGGAGCTCCTGATAATGTTCAAGGCGGAAAGGTTGCCATCTCCGCT
GATGCCGACACCATCCTCTGGCGTACAAATGGTAACGGTGTCATGGTGTCGCGAAACCAGGCCACCTTCAGTACT
GTCTCTTCTCTGCCCTCCGACGCGGCCATCGCCTCTGATAAGAAAACAAATAATATTTTCTACGGAGCCTCCGGT
AAAACATTCTACGTTTCCACAGACAACGGCAAGACATTTTCAGCCCATGGTAGCCTAGGTTCAGCTACGTCTGTC
TTCGACATAGCTGTCCCCCCGAGTGTCAGCGGTGACATCTGGGCCTCCACTGACAAGGGCCTATTCCATTCTACT
GACAGCGGTGCGACTTTTAGTGCTATCTCTGGTATCACACAGGCCTGGGGTGTCGCTCTTGGTGCACCTAAATCT
ACAGGAGGATATCCTGCTGTTTTCGTTGCCGCCAATTACGGCGGGGAGGTAGCCTACTTTAGGTCTGATGACCGG
GGAGTCAACTGGGTAAAGATTAATGACGCCGCACATGGCTTTGGTGCCGCTAGTGCTAACTGCATGGCTGCTGAT
CCACGTGTATACGGACGCGTTTATATCGGAACTAATGGTCGCGGTATCTTCTATGGTGATGTTGCTGGTTCCGCC
CCTCCTCCAACCTCTAGTGCTACATCTACTACGAGTGTATCCACTACAACGACTAGATCCACCACAACGACTAGA
TCCACTACAACGACGACGAGTTCGGGTAATGGATCACCTGTTTCGGGCTTTGGTCAATGCGGTGGTCAAGGTTGG
ACAGGCGGTACTACCTGTGTCACTGGATTCCAATGTGTTGCACAGAATCCATTTTATTCGCAATGTATCCCGATT
TGA
Transcript >AgabiH97|008240
ATGCCCAGCAGAGTTAAATTCTGGATAACTCTGACACTTGGCACCTTCAGCCTTGTCTACGGGCAAGCAGCTTCT
CAGTCTTATAGGTGGCAGAATGTCAAGATCGGCGGTGGTGGTGGGTTTGTCCCCGGCATTGTCTTCAATCCTTCC
GAAAAGGGACTGGCGTATGCTCGCACTGACATCGGAGGAGCCTACAAGCTGAATGCTGATGATACTTGGACGCCT
CTACTTGATTTCGCTGATGATTCTCGGTGGAATTATTGGGGCGTCGATGCTCTTGCAACTGATCCCGTACAACCC
AACCGTCTTTACCTGGCGACTGGGTTGTATACCAACTCATGGGACCCAAGTAACGGCCATATTCTCATATCAAGT
GATTATGGTAAAACATTCGATGCCGCGCCCTTGCCATTCAAGCTCGGTGGTAATATGCCTGGGCGTGGAATGGGA
GAGCGTCTCGTCGTCGATCCCAACCTGAACAGCGTCCTTTATTTTGGCGCTCGCAGTGGTAACGGTCTCTGGAAG
TCAACAAATTCGGGTCAGAGCTGGAGCAAGGTAACAAGCTTCACTGACACTGGGTCTTTCGTTCCCGATCCATCA
GATAGCACCGGCCTGAATTCTGATAAAATTGGGATCGCATGGGTTACCATCGATAAAGCGTCAGGCTCCTCTGGT
TCCGCCACTCCCCGTATATTTGTCGGCGTTGCGAACAAGGGCTCAAACAGCATTTATATATCTACGAATGGCGGT
TCCTCTTGGAGTGCCGTCGCAGGTCAACCAACTAGCTTCCTGCCACATAAGGGCGTTCTATCCGCTTCTGAGAGG
GCACTTTATATCACTTACTCCGATGGTGGCGGTCCTTACGATGGCACAAGCGGTGCAGTTTACAAGTACAACATT
GACACTGGCGCATGGACTGACATAACACCCGTCAGCGGAAGCGATCTCTTCTTTGGTTTCGGAGGTCTAGCCTTA
GATACACAGAAAAACGGGACTGTCATGGTTGCAGCCCTCAACTCGTGGTGGCCTGATGGTCAGATATTCCGCTCG
ACCAACGGGGGTGCATCTTGGACTCCGCTGTGGGACTGGGCAGTCTACCCGACTCTCAACAAATACTACAGTTAT
AACGCTGCCCTGGCGCCGTGGATAGGACCCAACATCGTTGATGTCACCCCCGGAAATCTGCAAATCGGGTGGATG
ATGGAATCACTATCCATTGATCCTTTCGACTCGAATCATTGGCTCTACGGCACTGGAGAAACTATCTATGGAAGT
CGTGACCTCCTCAAATGGGACAGTGCACACAACGTCACCATCAAGTCGCTCGCAGATGGTGTCGAGGAAACCTCC
GTCCAAGCCCTTATTTCACCTCCTTCCGGACCGCCTCTTGTTTCTGCTATTGGTGACGTTGGCGGTTTTGTCCAC
CAATCACTTACCCGTGCACCCAGCGCCCAGTTTACCAATCCCAAGTGGTCGACCTCGGCTGACATCGATTTCGCT
GGCAACAACCCTAGTAATGTCGTTCGCATTGGTACTGGTGATAGTACTAGTGGCAAACAGGTCGCCATCTCTTCC
GACTATGGCGTTACTTGGAATCAGCATTTTGGAGCTCCTGATAATGTTCAAGGCGGAAAGGTTGCCATCTCCGCT
GATGCCGACACCATCCTCTGGCGTACAAATGGTAACGGTGTCATGGTGTCGCGAAACCAGGCCACCTTCAGTACT
GTCTCTTCTCTGCCCTCCGACGCGGCCATCGCCTCTGATAAGAAAACAAATAATATTTTCTACGGAGCCTCCGGT
AAAACATTCTACGTTTCCACAGACAACGGCAAGACATTTTCAGCCCATGGTAGCCTAGGTTCAGCTACGTCTGTC
TTCGACATAGCTGTCCCCCCGAGTGTCAGCGGTGACATCTGGGCCTCCACTGACAAGGGCCTATTCCATTCTACT
GACAGCGGTGCGACTTTTAGTGCTATCTCTGGTATCACACAGGCCTGGGGTGTCGCTCTTGGTGCACCTAAATCT
ACAGGAGGATATCCTGCTGTTTTCGTTGCCGCCAATTACGGCGGGGAGGTAGCCTACTTTAGGTCTGATGACCGG
GGAGTCAACTGGGTAAAGATTAATGACGCCGCACATGGCTTTGGTGCCGCTAGTGCTAACTGCATGGCTGCTGAT
CCACGTGTATACGGACGCGTTTATATCGGAACTAATGGTCGCGGTATCTTCTATGGTGATGTTGCTGGTTCCGCC
CCTCCTCCAACCTCTAGTGCTACATCTACTACGAGTGTATCCACTACAACGACTAGATCCACCACAACGACTAGA
TCCACTACAACGACGACGAGTTCGGGTAATGGATCACCTGTTTCGGGCTTTGGTCAATGCGGTGGTCAAGGTTGG
ACAGGCGGTACTACCTGTGTCACTGGATTCCAATGTGTTGCACAGAATCCATTTTATTCGCAATGTATCCCGATT
TGA
Gene >AgabiH97|008240
ATGCCCAGCAGAGTTAAATTCTGGATAACTCTGACACTTGGCACCTTCAGCCTTGTCTACGGGCAAGCAGCTTCT
CAGTCTTATAGGTGGCAGAATGTCAAGATCGGCGGTGGTGGTGGGTTTGTCCCCGGCATTGTCTTCAATCCTTCC
GAAAAGGTATGCTGTGATGACCTGGCTTTCAAATTTGAATAACGATGGACTAGGGACTGGCGTATGCTCGCACTG
ACATCGGAGGAGCCTACAAGCTGAATGCTGATGATACTTGGACGCCTCTACTTGATTTCGCTGATGATTCTCGGT
GGAATTATTGGGGCGTCGATGCTCTTGCAACTGATCCCGTACAACCCAACCGTCTTTACCTGGTATGTAAAGTAT
AATTTCTGACGGTTGTCAAAATTGGTTCATCGATTTACCAGGCGACTGGGTTGTATACCAACTCATGGGACCCAA
GTAACGGCCATATTCTCATATCAAGTGATTATGGTAAAACATTCGATGCCGCGCCCTTGCCATTCAAGCTCGGTG
GTAATATGCCTGGGCGTGGAATGTAAGTCTCGTTGAATTTTTCTTCTTCTTCACTGATGTATACATCACTTGTGT
ATTTAGGGGAGAGGTAATTGTAATGCTTTTATCATTAAAGTCCTACCTCACATCGCCATCTTGCAGCGTCTCGTC
GTCGATCCCAACCTGAACAGCGTCCTTTATTTTGGCGCTCGCAGTGGTAACGGTCTCTGGAAGTCAACAAATTCG
GGTCAGAGCTGGAGCAAGGTAACAAGCTTCACTGACACTGGTATGCTCAAATGACGGTACTCCAGAGCTGGACTG
CTATTAAGTGTTTTCTTTCCAGGGTCTTTCGTTCCCGATCCATCAGATAGCACCGGCCTGAATTCTGATAAAATT
GGGATCGCATGGGTTACCATCGATAAAGCGTCAGGCTCCTCTGGTTCCGCCACTCCCCGTATATTTGTCGGCGTT
GCGAACAAGGGCTCAAACAGCATTTATATATCTACGAATGGCGGTTCCTCTTGTGAGTTCAAATAGTCCACATGA
GCATTCATTATTCTTATGTATAAAAGGGAGTGCCGTCGCAGGTCAACCAACTAGCTTCCTGCCACATAAGGGCGT
TCTATCCGCTTCTGAGAGGGCACTTTATATCACTTACTCCGATGGTGGCGGTCCTGTGCGTTCATTTTGAACATG
TCTTCCTGTCGCTTTTCTCAACCCGTTTTTGCAAGTACGATGGCACAAGCGGTGCAGTTTACAAGTACAACATTG
ACACTGGCGCATGTAAGCATTCCTAAAGGTCAATATCAGTTGGTTGACTGATCGTGTCACAGGGACTGACATAAC
ACCCGTCAGCGGAAGCGATCTCTTCTTTGGTTTCGGAGGTCTAGCCTTAGATACACAGAAAAACGGGACTGTCAT
GGTTGCAGCCCTCAACTCGTGGTGGCCTGATGGTCAGATATTCCGCTCGACCAACGGGGGTGCATCTTGGACTCC
GCTGTGGGACTGGGCAGTCTACCCGACTCTCAACAAATACTACAGTTATAACGCTGCCCTGGCGCCGTGGATAGG
ACCCAACATCGTTGATGTCACCCCCGGAAATCTGCAAATCGGGTGGATGATGGAATGTATGTTGACTGTACTCAC
TTTCTTCGACTTTATTTGACCACCTTCCATAGCACTATCCATTGATCCTTTCGACTCGAATCATTGGCTCTACGG
CACTGGAGAAACTATCTATGGAAGTCGTGACCTCCTCAAAGTTAGTAAAAAAATGTTGCATACTCCCATATTAGG
TCTGACAATCATCAGTGGGACAGTGCACACAACGTCACCATCAAGTCGCTCGCAGATGGTGTCGAGGAAACCTCC
GTCCAAGCCCTTATTTCACCTCCTTCCGGACCGCCTCTTGTTTCTGCTATTGGTGACGTTGGCGGTAAGTCAGAT
GAAAAAATAACCAAGAAAGGAAGGGCGCTCAAATATTTGTTTTAGGTTTTGTCCACCAATCACTTACCCGTGCAC
CCAGCGCCCAGTTTACCAATCCCAAGTGGTCGACCTCGGCTGACATCGATTTCGCTGGCAACAACCCTAGTAATG
TCGTTCGCATTGGTACTGGTGATAGTACTAGTGGCAAACAGGTCGCCATCTCTTCCGACTATGGCGTTACTTGGA
ATCAGCATTTTGGAGCTCCTGATAATGTTCAAGGCGGAAAGGTTGCCATCTCCGCTGATGCCGACACCATCCTCT
GGCGTACAAATGGTAACGGTGTCATGGTGTCGCGAAACCAGGCCACCTTCAGTACTGTCTCTTCTCTGCCCTCCG
ACGCGGCCATCGCCTCTGATAAGAAAACAAATAATATTTTCTACGGAGCCTCCGGTAAAACATTCTACGTTTCCA
CAGACAACGGCAAGACATTTTCAGCCCATGGTAGCCTAGGTTCAGCTACGTCTGTCTTCGACATAGCTGTCCCCC
CGAGTGTCAGCGGTGACATCTGGGCCTCCACTGACAAGGGCCTATTCCATTCTACTGACAGCGGTGCGACTTTTA
GTGCTATCTCTGGTATCACACAGGCCTGGGGTGTCGCTCTTGGTGCACCTAAATCTACAGGAGGATATCCTGCTG
TTTTCGTTGCCGCCAATTACGGCGGGGAGGTAGCCTACTTTAGGTCTGATGACCGGGGAGTCAACTGGGTAAAGA
TTAATGACGCCGCACATGGCTTTGGTGCCGCTAGTGCTAACTGCATGGCTGCTGATCCACGTGTATACGGACGGT
AAAGCTCTACTGTAATGTTTTAGGATTCGTCGCTGATGATCTCTTTTCTCAGCGTTTATATCGGAACTAATGGTC
GCGGTATCTTCTATGGTGATGTTGCTGGTTCCGCCCCTCCTCCAACCTCTAGTGCTACATCTACTACGAGTGTAT
CCACTACAACGACTAGATCCACCACAACGACTAGATCCACTACAACGACGACGAGTTCGGGTAATGGATCACCTG
TTTCGGGCTTTGGTCAATGCGGTGGTCAAGGTTGGACAGGCGGTACTACCTGTGTCACTGGATTCCAATGTGTTG
CACAGAATCCATGTAAGCCCTCTTTGTTCCTGAAGAGAAACCGTCTGTTCTAAAATCACTTTCTATCAGTTTATT
CGCAATGTATCCCGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail