Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008180
Gene name
Locationscaffold_1:1924681..1926227
Strand+
Gene length (bp)1546
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 7.3E-24 249 367

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 249 382 9.0E-27
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 249 382 2.0E-25
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 75 381 5.0E-23
sp|Q7T141|PI15A_DANRE Peptidase inhibitor 15-A OS=Danio rerio GN=pi15a PE=3 SV=2 240 376 5.0E-23
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 182 381 6.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47032|PRY1_YEAST Protein PRY1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY1 PE=1 SV=1 249 382 9.0E-27
sp|P47033|PRY3_YEAST Cell wall protein PRY3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY3 PE=1 SV=1 249 382 2.0E-25
sp|P36110|PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRY2 PE=1 SV=1 75 381 5.0E-23
sp|Q7T141|PI15A_DANRE Peptidase inhibitor 15-A OS=Danio rerio GN=pi15a PE=3 SV=2 240 376 5.0E-23
sp|Q5AB49|Y6200_CANAL Probable pathogenesis-related protein CaO19.6200 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.13580 PE=2 SV=1 182 381 6.0E-23
sp|P35795|SC14_SCHCO Fruiting body protein SC14 OS=Schizophyllum commune GN=SC14 PE=2 SV=1 238 374 8.0E-22
sp|Q59ZX3|RBE1_CANAL Repressed by EFG1 protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBE1 PE=1 SV=1 246 375 9.0E-22
sp|Q3KPV7|PI15_XENLA Peptidase inhibitor 15 OS=Xenopus laevis GN=pi15 PE=2 SV=1 211 376 9.0E-22
sp|O43692|PI15_HUMAN Peptidase inhibitor 15 OS=Homo sapiens GN=PI15 PE=1 SV=1 240 376 4.0E-21
sp|Q8BS03|PI15_MOUSE Peptidase inhibitor 15 OS=Mus musculus GN=Pi15 PE=2 SV=2 240 376 4.0E-21
sp|Q98ST6|PI15_CHICK Peptidase inhibitor 15 OS=Gallus gallus GN=PI15 PE=2 SV=1 240 376 6.0E-21
sp|P07053|PR1B_TOBAC Pathogenesis-related protein 1B OS=Nicotiana tabacum PE=2 SV=1 236 376 2.0E-20
sp|D4B327|PRY1_ARTBC Probable pathogenesis-related protein ARB_02861 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02861 PE=3 SV=2 239 382 3.0E-20
sp|P08299|PR1A_TOBAC Pathogenesis-related protein 1A OS=Nicotiana tabacum PE=1 SV=1 236 376 4.0E-20
sp|P09042|PR1C_TOBAC Pathogenesis-related protein 1C OS=Nicotiana tabacum PE=2 SV=3 236 376 1.0E-19
sp|Q41359|PR1_SAMNI Pathogenesis-related protein PR-1 type OS=Sambucus nigra PE=2 SV=1 246 376 2.0E-19
sp|Q59WG5|Y2336_CANAL Probable pathogenesis-related protein CaO19.2336 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.2336 PE=2 SV=1 249 381 6.0E-19
sp|P35794|SC7_SCHCO Fruiting body protein SC7 OS=Schizophyllum commune GN=SC7 PE=2 SV=1 243 373 1.0E-18
sp|Q9H3Y0|CRSPL_HUMAN Peptidase inhibitor R3HDML OS=Homo sapiens GN=R3HDML PE=2 SV=1 240 376 5.0E-18
sp|P35792|PR12_HORVU Pathogenesis-related protein PRB1-2 OS=Hordeum vulgare PE=2 SV=1 246 376 7.0E-18
sp|P11670|PRB1_TOBAC Basic form of pathogenesis-related protein 1 OS=Nicotiana tabacum PE=3 SV=1 246 376 7.0E-18
sp|Q04108|PR04_SOLLC Pathogenesis-related leaf protein 4 OS=Solanum lycopersicum PE=2 SV=1 246 376 1.0E-17
sp|Q8JI38|CRVP_LATSE Cysteine-rich venom protein latisemin OS=Laticauda semifasciata PE=2 SV=1 232 378 1.0E-17
sp|Q8BZQ2|CRLD2_MOUSE Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus GN=Crispld2 PE=1 SV=1 243 376 1.0E-17
sp|A2A5I3|CRSPL_MOUSE Peptidase inhibitor R3HDML OS=Mus musculus GN=R3hdml PE=3 SV=1 240 376 2.0E-17
sp|P04284|PR06_SOLLC Pathogenesis-related leaf protein 6 OS=Solanum lycopersicum GN=PR1B1 PE=1 SV=2 246 376 2.0E-17
sp|Q05968|PR1_HORVU Pathogenesis-related protein 1 OS=Hordeum vulgare PE=2 SV=1 246 376 4.0E-17
sp|Q00008|PRMS_MAIZE Pathogenesis-related protein PRMS OS=Zea mays GN=PRMS PE=2 SV=1 246 375 5.0E-17
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 243 376 5.0E-17
sp|Q9ZNS4|PRB1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=PRB1 PE=2 SV=1 246 376 5.0E-17
sp|P33154|PR1_ARATH Pathogenesis-related protein 1 OS=Arabidopsis thaliana GN=At2g14610 PE=1 SV=1 246 376 9.0E-17
sp|Q9ET66|PI16_MOUSE Peptidase inhibitor 16 OS=Mus musculus GN=Pi16 PE=2 SV=1 235 376 9.0E-17
sp|Q5AB48|RBT4_CANAL Secreted protein RBT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBT4 PE=1 SV=2 246 375 1.0E-16
sp|Q05108|VA5_DOLAR Venom allergen 5 OS=Dolichovespula arenaria PE=1 SV=1 264 376 2.0E-16
sp|Q08697|PR1A_SOLLC Pathogenesis-related protein 1A1 OS=Solanum lycopersicum PE=2 SV=1 246 374 2.0E-16
sp|P0CB15|CRIS_PROFL Serotriflin OS=Protobothrops flavoviridis PE=1 SV=1 233 378 3.0E-16
sp|Q40374|PR1_MEDTR Pathogenesis-related protein PR-1 OS=Medicago truncatula GN=PR-1 PE=2 SV=1 234 376 4.0E-16
sp|B2MVK7|VA5_RHYBR Venom allergen 5 OS=Rhynchium brunneum PE=2 SV=1 220 376 4.0E-16
sp|Q9H0B8|CRLD2_HUMAN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Homo sapiens GN=CRISPLD2 PE=2 SV=1 228 376 9.0E-16
sp|Q58D34|PI16_BOVIN Peptidase inhibitor 16 OS=Bos taurus GN=PI16 PE=2 SV=1 241 376 2.0E-15
sp|P35778|VA3_SOLIN Venom allergen 3 OS=Solenopsis invicta PE=1 SV=2 226 375 3.0E-15
sp|A6QLZ7|CRLD2_BOVIN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Bos taurus GN=CRISPLD2 PE=2 SV=1 236 376 4.0E-15
sp|P84808|CRVP2_NAJKA Cysteine-rich venom protein kaouthin-2 OS=Naja kaouthia PE=1 SV=2 233 378 5.0E-15
sp|P10737|VA53_DOLMA Venom allergen 5.02 (Fragment) OS=Dolichovespula maculata PE=1 SV=3 264 376 6.0E-15
sp|P35793|PR13_HORVU Pathogenesis-related protein PRB1-3 OS=Hordeum vulgare PE=2 SV=1 246 376 1.0E-14
sp|Q6UXB8|PI16_HUMAN Peptidase inhibitor 16 OS=Homo sapiens GN=PI16 PE=1 SV=1 241 376 1.0E-14
sp|P35781|VA51_VESCR Venom allergen 5.01 OS=Vespa crabro PE=1 SV=1 264 373 1.0E-14
sp|P35782|VA52_VESCR Venom allergen 5.02 OS=Vespa crabro PE=1 SV=1 264 373 2.0E-14
sp|Q7ZZN8|CRVP2_NAJAT Cysteine-rich venom protein natrin-2 OS=Naja atra PE=1 SV=1 233 378 2.0E-14
sp|Q98ST5|CRLD1_CHICK Cysteine-rich secretory protein LCCL domain-containing 1 OS=Gallus gallus GN=CRISPLD1 PE=2 SV=1 232 376 2.0E-14
sp|Q9CYL5|GAPR1_MOUSE Golgi-associated plant pathogenesis-related protein 1 OS=Mus musculus GN=Glipr2 PE=1 SV=3 249 381 3.0E-14
sp|P35779|VA3_SOLRI Venom allergen 3 OS=Solenopsis richteri PE=1 SV=2 226 375 3.0E-14
sp|Q41495|ST14_SOLTU STS14 protein OS=Solanum tuberosum GN=STS14 PE=2 SV=1 246 376 4.0E-14
sp|P16562|CRIS2_HUMAN Cysteine-rich secretory protein 2 OS=Homo sapiens GN=CRISP2 PE=1 SV=1 249 376 4.0E-14
sp|Q9H336|CRLD1_HUMAN Cysteine-rich secretory protein LCCL domain-containing 1 OS=Homo sapiens GN=CRISPLD1 PE=2 SV=1 241 376 5.0E-14
sp|P35785|VA5_VESPE Venom allergen 5 OS=Vespula pensylvanica PE=1 SV=1 239 372 1.0E-13
sp|Q05110|VA5_VESVU Venom allergen 5 OS=Vespula vulgaris PE=1 SV=1 239 376 1.0E-13
sp|P35760|VA5_VESMC Venom allergen 5 OS=Vespula maculifrons PE=1 SV=1 239 372 1.0E-13
sp|Q05109|VA5_POLAN Venom allergen 5 (Fragment) OS=Polistes annularis PE=1 SV=1 264 377 2.0E-13
sp|P81656|VA5_POLDO Venom allergen 5 OS=Polistes dominula PE=1 SV=2 264 376 3.0E-13
sp|P35784|VA5_VESGE Venom allergen 5 OS=Vespula germanica PE=1 SV=1 239 372 3.0E-13
sp|P35783|VA5_VESFL Venom allergen 5 OS=Vespula flavopilosa PE=1 SV=1 239 372 3.0E-13
sp|Q8CGD2|CRLD1_MOUSE Cysteine-rich secretory protein LCCL domain-containing 1 OS=Mus musculus GN=Crispld1 PE=2 SV=1 241 376 3.0E-13
sp|Q9CWG1|GLIP1_MOUSE Glioma pathogenesis-related protein 1 OS=Mus musculus GN=Glipr1 PE=2 SV=1 240 372 4.0E-13
sp|P35759|VA5_POLEX Venom allergen 5 OS=Polistes exclamans PE=1 SV=2 264 377 4.0E-13
sp|Q9H4G4|GAPR1_HUMAN Golgi-associated plant pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR2 PE=1 SV=3 249 381 5.0E-13
sp|Q2L6Z1|VAL5_VESMC Venom allergen 5 OS=Vespula maculifrons PE=2 SV=1 239 372 5.0E-13
sp|P86686|VA5_POLPI Venom allergen 5 OS=Polybia paulista PE=1 SV=1 264 375 9.0E-13
sp|P35780|VA5_POLFU Venom allergen 5 OS=Polistes fuscatus PE=1 SV=1 264 377 1.0E-12
sp|A8S6B6|CRVP_AUSSU Cysteine-rich venom protein OS=Austrelaps superbus PE=2 SV=1 233 378 1.0E-12
sp|Q7Z156|VA5_POLSR Venom allergen 5 OS=Polybia scutellaris rioplatensis PE=1 SV=2 264 376 1.0E-12
sp|Q32LB5|GPRL1_BOVIN GLIPR1-like protein 1 OS=Bos taurus GN=GLIPR1L1 PE=2 SV=1 229 372 2.0E-12
sp|P10736|VA52_DOLMA Venom allergen 5.01 OS=Dolichovespula maculata PE=1 SV=1 264 376 3.0E-12
sp|Q60477|CRIS2_CAVPO Cysteine-rich secretory protein 2 OS=Cavia porcellus GN=CRISP2 PE=1 SV=1 240 372 3.0E-12
sp|B3EWZ8|ECT_ACRMI Ectin (Fragment) OS=Acropora millepora PE=1 SV=1 246 381 3.0E-12
sp|Q6UWM5|GPRL1_HUMAN GLIPR1-like protein 1 OS=Homo sapiens GN=GLIPR1L1 PE=1 SV=2 245 373 3.0E-12
sp|A6MFK9|CRVP_DEMVE Cysteine-rich venom protein OS=Demansia vestigiata PE=2 SV=1 232 375 4.0E-12
sp|P48060|GLIP1_HUMAN Glioma pathogenesis-related protein 1 OS=Homo sapiens GN=GLIPR1 PE=1 SV=3 245 372 4.0E-12
sp|Q3SB06|CRVP_OXYMI Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus microlepidotus PE=2 SV=1 232 378 4.0E-12
sp|P86870|VA5_VESMG Venom allergen 5 OS=Vespa magnifica PE=1 SV=2 264 373 4.0E-12
sp|Q3SB07|CRVP_OXYSC Cysteine-rich venom protein pseudechetoxin-like OS=Oxyuranus scutellatus scutellatus PE=2 SV=1 233 378 5.0E-12
sp|Q03401|CRIS1_MOUSE Cysteine-rich secretory protein 1 OS=Mus musculus GN=Crisp1 PE=2 SV=1 238 377 5.0E-12
sp|O19010|CRIS3_HORSE Cysteine-rich secretory protein 3 OS=Equus caballus GN=CRISP3 PE=1 SV=1 233 377 5.0E-12
sp|C0ITL3|VA5_PACCH Venom allergen 5 (Fragment) OS=Pachycondyla chinensis PE=2 SV=1 226 375 5.0E-12
sp|Q3SB03|CRVP_HOPST Cysteine-rich venom protein pseudechetoxin-like OS=Hoplocephalus stephensii PE=2 SV=1 233 378 6.0E-12
sp|P83377|VA5_POLGA Venom allergen 5 OS=Polistes gallicus PE=1 SV=1 264 376 6.0E-12
sp|F8J2D4|CRVP_DRYCN Cysteine-rich venom protein OS=Drysdalia coronoides PE=1 SV=1 233 378 7.0E-12
sp|P54108|CRIS3_HUMAN Cysteine-rich secretory protein 3 OS=Homo sapiens GN=CRISP3 PE=1 SV=1 249 372 7.0E-12
sp|Q09566|LON1_CAEEL Protein lon-1 OS=Caenorhabditis elegans GN=lon-1 PE=1 SV=1 264 374 8.0E-12
sp|Q3SB04|CRVP_NOTSC Cysteine-rich venom protein pseudechetoxin-like OS=Notechis scutatus scutatus PE=2 SV=1 233 378 1.0E-11
sp|Q8AVA4|CRVP_PSEAU Cysteine-rich venom protein pseudechetoxin OS=Pseudechis australis PE=1 SV=1 232 378 1.0E-11
sp|Q8AVA3|CRVP_PSEPO Cysteine-rich venom protein pseudecin OS=Pseudechis porphyriacus PE=1 SV=1 233 378 1.0E-11
sp|D8VNS1|CRVP_CERRY Cysteine-rich venom protein OS=Cerberus rynchops PE=1 SV=1 249 375 2.0E-11
sp|P35786|VA5_VESSQ Venom allergen 5 OS=Vespula squamosa PE=1 SV=1 239 376 2.0E-11
sp|Q2XXQ3|CRVP1_PSEPL Cysteine-rich venom protein ENH1 OS=Pseudoferania polylepis PE=2 SV=1 249 375 2.0E-11
sp|Q2XXQ2|CRVP2_PSEPL Cysteine-rich venom protein ENH2 OS=Pseudoferania polylepis PE=2 SV=1 249 375 2.0E-11
sp|Q2XXQ0|CRVP_ERYPO Cysteine-rich venom protein LIO1 (Fragment) OS=Erythrolamprus poecilogyrus PE=2 SV=1 264 376 2.0E-11
sp|W4VS53|CRVP_TRILK CRISP/Allergen/PR-1 OS=Trittame loki PE=1 SV=1 239 373 3.0E-11
sp|P84805|CRVP1_NAJKA Cysteine-rich venom protein kaouthin-1 OS=Naja kaouthia PE=1 SV=2 232 378 4.0E-11
sp|Q7T1K6|CRVP1_NAJAT Cysteine-rich venom protein natrin-1 OS=Naja atra PE=1 SV=1 232 378 4.0E-11
sp|Q3SB05|CRVP_PSETE Cysteine-rich venom protein pseudechetoxin-like OS=Pseudonaja textilis PE=1 SV=1 232 378 4.0E-11
sp|Q2XXP5|CRVP_TELDH Cysteine-rich venom protein TEL1 (Fragment) OS=Telescopus dhara PE=2 SV=1 232 372 4.0E-11
sp|Q7ZZN9|CRVP_PROJR Cysteine-rich venom protein OS=Protobothrops jerdonii PE=1 SV=1 249 378 5.0E-11
sp|Q7ZT98|CRVP_OPHHA Cysteine-rich venom protein ophanin OS=Ophiophagus hannah PE=1 SV=1 232 375 6.0E-11
sp|P35787|VA5_VESVI Venom allergen 5 OS=Vespula vidua PE=1 SV=1 239 376 8.0E-11
sp|Q7ZTA0|CRVP_AGKPI Cysteine-rich venom protein piscivorin OS=Agkistrodon piscivorus piscivorus PE=1 SV=1 249 378 1.0E-10
sp|Q09GJ9|CRVP_PHIOL Cysteine-rich venom protein OS=Philodryas olfersii PE=2 SV=1 264 378 1.0E-10
sp|Q9CQ35|GRPL2_MOUSE GLIPR1-like protein 2 OS=Mus musculus GN=Glipr1l2 PE=1 SV=1 245 373 1.0E-10
sp|Q2XXQ1|CRVP_LEIMD Cysteine-rich venom protein LEI1 (Fragment) OS=Leioheterodon madagascariensis PE=1 SV=1 249 378 1.0E-10
sp|P0DMT4|CRVP_ECHCO Cysteine-rich venom protein OS=Echis coloratus PE=1 SV=1 249 378 1.0E-10
sp|A9YME1|VA5_MICHY Venom allergen 5 OS=Microctonus hyperodae PE=2 SV=1 219 375 2.0E-10
sp|P81657|VA5_VESMA Venom allergen 5 OS=Vespa mandarinia PE=1 SV=1 264 373 2.0E-10
sp|Q8JGT9|CRVP_RHATT Cysteine-rich venom protein tigrin OS=Rhabdophis tigrinus tigrinus PE=1 SV=1 246 375 2.0E-10
sp|Q2XXQ5|CRVP2_DISTY Cysteine-rich venom protein DIS2 OS=Dispholidus typus PE=2 SV=1 264 375 4.0E-10
sp|P60623|CRVP_TRIST Cysteine-rich venom protein (Fragment) OS=Trimeresurus stejnegeri PE=1 SV=1 249 378 4.0E-10
sp|Q2XXP4|CRVP_TRIBI Cysteine-rich venom protein TRI1 (Fragment) OS=Trimorphodon biscutatus PE=2 SV=1 249 375 5.0E-10
sp|Q8JI39|CRVP_PROFL Cysteine-rich venom protein triflin OS=Protobothrops flavoviridis PE=1 SV=1 249 378 7.0E-10
sp|P16563|CRIS2_MOUSE Cysteine-rich secretory protein 2 OS=Mus musculus GN=Crisp2 PE=1 SV=1 249 372 1.0E-09
sp|Q4G1C9|GRPL2_HUMAN GLIPR1-like protein 2 OS=Homo sapiens GN=GLIPR1L2 PE=2 SV=2 245 373 1.0E-09
sp|Q16937|ASP_ANCCA Ancylostoma secreted protein OS=Ancylostoma caninum GN=ASP PE=2 SV=1 219 376 2.0E-09
sp|Q8JI40|CRVP_GLOBL Cysteine-rich venom protein ablomin OS=Gloydius blomhoffii PE=1 SV=1 249 378 2.0E-09
sp|Q2XXQ6|CRVP1_DISTY Cysteine-rich venom protein DIS1 OS=Dispholidus typus PE=2 SV=1 264 375 2.0E-09
sp|Q91055|CRVP_HELHO Cysteine-rich venom protein helothermine OS=Heloderma horridum horridum PE=1 SV=1 240 373 2.0E-09
sp|Q8UW11|CRVP2_HYDHA Cysteine-rich venom protein 2 OS=Hydrophis hardwickii PE=2 SV=2 233 378 3.0E-09
sp|Q2XXQ4|CRVP3_DISTY Cysteine-rich venom protein DIS3 OS=Dispholidus typus PE=2 SV=1 264 375 4.0E-09
sp|B7FDI1|CRVP_VIPBE Cysteine-rich venom protein OS=Vipera berus PE=1 SV=1 249 378 5.0E-09
sp|Q8UW25|CRVP1_HYDHA Cysteine-rich venom protein 1 OS=Hydrophis hardwickii PE=2 SV=2 233 373 6.0E-09
sp|B7FDI0|CRVP_VIPNI Cysteine-rich venom protein (Fragment) OS=Vipera nikolskii PE=2 SV=1 249 378 6.0E-09
sp|Q03402|CRIS3_MOUSE Cysteine-rich secretory protein 3 OS=Mus musculus GN=Crisp3 PE=1 SV=1 222 377 7.0E-09
sp|F8S0Y4|CRVP_CROAD Cysteine-rich secretory protein OS=Crotalus adamanteus PE=1 SV=1 249 378 9.0E-09
sp|Q7ZT99|CRVP_CROAT Cysteine-rich venom protein catrin OS=Crotalus atrox PE=1 SV=1 264 378 1.0E-08
sp|B0VXV6|CRVP_SISCA Cysteine-rich venom protein 2 OS=Sistrurus catenatus edwardsii PE=2 SV=1 249 378 1.0E-08
sp|P79845|CRVP_PROMU Cysteine-rich venom protein OS=Protobothrops mucrosquamatus PE=2 SV=2 249 378 1.0E-08
sp|P12020|CRIS1_RAT Cysteine-rich secretory protein 1 OS=Rattus norvegicus GN=Crisp1 PE=2 SV=1 227 377 4.0E-08
sp|Q7YT83|TX31_CONTE Cysteine-rich venom protein OS=Conus textile PE=1 SV=1 249 367 3.0E-07
sp|Q2XXP2|CRVPA_VARVA Cysteine-rich venom protein VAR10 (Fragment) OS=Varanus varius PE=2 SV=1 240 376 2.0E-06
sp|Q2XXP1|CRVPB_VARVA Cysteine-rich venom protein VAR11 OS=Varanus varius PE=2 SV=1 240 376 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 38 0.45

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008180
MPWSLLSLSPGLPFPMTRLVALFSLVLAISAVPGGLAGPACARKNYQSADCVKKCKSKWGWTGSMVGTDRWGSVV
NKVENSGQTWDSIISTACGSAKPALPVTTSSVVAPSAPTFTGQPVPPIGAGSDPAQSVPTSSTVVSSSSVSVSTK
SAHSSVAATSSVVSSVKSTLTHATSTSSHTSTTPTTTSTPEPKPTTSRFVTSIRPSPQPTTSEKPTTSTKAPPPP
PTQAPEADPGSNSGTSSSDIQAYLSAHNTVRAQHGAAPLTWSDELAGKAQQWADGCKFQHSGGALGRFGENLAAG
TGNSYGIPQAIKSWADEASDYNPNNPQFSHFTQMVWKGTTQLGCAVQECSGIFSSSFGLAKFYVCEYNPAGNVLG
QFAQNVQA*
Coding >AgabiH97|008180
ATGCCCTGGAGCCTTCTAAGCCTTTCTCCGGGATTGCCTTTCCCTATGACTCGTCTTGTTGCTCTTTTCTCGCTG
GTGTTGGCTATTTCTGCCGTCCCAGGAGGACTTGCTGGTCCAGCCTGTGCCCGTAAGAATTATCAAAGCGCTGAT
TGTGTCAAGAAGTGCAAATCAAAGTGGGGATGGACGGGTAGCATGGTGGGCACCGACCGTTGGGGCTCTGTCGTC
AACAAGGTTGAAAACTCCGGCCAAACTTGGGACTCAATCATCTCTACAGCGTGTGGATCAGCAAAGCCTGCTCTT
CCTGTCACCACATCTTCTGTGGTAGCGCCTTCTGCTCCTACTTTCACTGGTCAACCTGTCCCTCCAATCGGTGCT
GGTTCTGATCCCGCTCAGTCTGTACCGACCTCATCTACTGTTGTGTCTTCTTCATCTGTATCGGTATCGACGAAA
TCGGCCCACTCATCTGTCGCCGCTACGTCATCTGTCGTTTCTTCCGTCAAATCTACATTGACTCATGCTACATCT
ACATCGTCTCATACCTCGACCACTCCGACCACCACGTCTACTCCCGAGCCTAAGCCTACCACTTCCCGTTTCGTA
ACGAGTATTCGGCCTAGTCCCCAGCCTACTACAAGCGAGAAACCCACGACATCTACGAAGGCTCCTCCACCCCCT
CCAACTCAAGCCCCCGAAGCTGATCCTGGCTCCAATTCTGGGACTTCGTCTAGCGATATCCAGGCGTATTTATCT
GCGCACAATACTGTTCGCGCACAGCATGGTGCCGCTCCCTTGACTTGGAGTGACGAGCTCGCCGGTAAGGCGCAG
CAGTGGGCCGACGGTTGTAAGTTCCAGCATTCAGGAGGCGCCCTTGGTAGATTTGGAGAAAATTTGGCTGCTGGT
ACTGGAAATTCATATGGTATCCCTCAAGCCATCAAGTCATGGGCTGACGAAGCTAGCGACTACAACCCCAATAAT
CCACAGTTTTCTCATTTCACTCAAATGGTGTGGAAAGGCACTACGCAGCTCGGTTGTGCTGTCCAGGAATGTAGT
GGGATTTTCTCGTCTTCGTTTGGACTGGCGAAATTTTATGTCTGCGAGTATAACCCAGCAGGTAATGTTTTGGGC
CAGTTCGCTCAAAACGTCCAAGCTTGA
Transcript >AgabiH97|008180
ATGCCCTGGAGCCTTCTAAGCCTTTCTCCGGGATTGCCTTTCCCTATGACTCGTCTTGTTGCTCTTTTCTCGCTG
GTGTTGGCTATTTCTGCCGTCCCAGGAGGACTTGCTGGTCCAGCCTGTGCCCGTAAGAATTATCAAAGCGCTGAT
TGTGTCAAGAAGTGCAAATCAAAGTGGGGATGGACGGGTAGCATGGTGGGCACCGACCGTTGGGGCTCTGTCGTC
AACAAGGTTGAAAACTCCGGCCAAACTTGGGACTCAATCATCTCTACAGCGTGTGGATCAGCAAAGCCTGCTCTT
CCTGTCACCACATCTTCTGTGGTAGCGCCTTCTGCTCCTACTTTCACTGGTCAACCTGTCCCTCCAATCGGTGCT
GGTTCTGATCCCGCTCAGTCTGTACCGACCTCATCTACTGTTGTGTCTTCTTCATCTGTATCGGTATCGACGAAA
TCGGCCCACTCATCTGTCGCCGCTACGTCATCTGTCGTTTCTTCCGTCAAATCTACATTGACTCATGCTACATCT
ACATCGTCTCATACCTCGACCACTCCGACCACCACGTCTACTCCCGAGCCTAAGCCTACCACTTCCCGTTTCGTA
ACGAGTATTCGGCCTAGTCCCCAGCCTACTACAAGCGAGAAACCCACGACATCTACGAAGGCTCCTCCACCCCCT
CCAACTCAAGCCCCCGAAGCTGATCCTGGCTCCAATTCTGGGACTTCGTCTAGCGATATCCAGGCGTATTTATCT
GCGCACAATACTGTTCGCGCACAGCATGGTGCCGCTCCCTTGACTTGGAGTGACGAGCTCGCCGGTAAGGCGCAG
CAGTGGGCCGACGGTTGTAAGTTCCAGCATTCAGGAGGCGCCCTTGGTAGATTTGGAGAAAATTTGGCTGCTGGT
ACTGGAAATTCATATGGTATCCCTCAAGCCATCAAGTCATGGGCTGACGAAGCTAGCGACTACAACCCCAATAAT
CCACAGTTTTCTCATTTCACTCAAATGGTGTGGAAAGGCACTACGCAGCTCGGTTGTGCTGTCCAGGAATGTAGT
GGGATTTTCTCGTCTTCGTTTGGACTGGCGAAATTTTATGTCTGCGAGTATAACCCAGCAGGTAATGTTTTGGGC
CAGTTCGCTCAAAACGTCCAAGCTTGA
Gene >AgabiH97|008180
ATGCCCTGGGCAAGTTTGATATAAATTCCCAACTGGACACCGTAACCTTTTTTTTCAGAGCCTTCTAAGCCTTTC
TCCGGGATTGCCTTTGTCCCGCCAGTCTTTCATTTTTATCGACATTCTTTTCATTCTGCGAGCCCTATGACTCGT
CTTGTTGCTCTTTTCTCGCTGGTGTTGGCTATTTCTGCCGTCCCAGGAGGACTTGCTGGTCCAGCCTGTGCCCGT
AAGAATTATCAAAGCGCTGATTGTGTCAAGAAGTGCAAATCAAAGTGGGGATGGACGGGTAGCATGGTGGGCACC
GACCGTTGGGGCTCTGTCGTCAACAAGGTTGAAAACTCCGGCCAAACTTGGGACTCAATCATCTCTACAGCGTGT
GGATCAGCGTAAGTAAAATGGTTCAATTCACTGTCTATTCCCTGGTTGAGAGTCCTTGTAACAGAAAGCCTGCTC
TTCCTGTCACCACATCTTCTGTGGTAGCGCCTTCTGCTCCTACTTTCACTGGTCAACCTGTCCCTCCAATCGGTG
CTGGTTCTGATCCCGCTCAGTCTGTACCGACCTCATCTACTGTTGTGTCTTCTTCATCTGTATCGGTATCGACGA
AATCGGCCCACTCATCTGTCGCCGCTACGTCATCTGTCGTTTCTTCCGTCAAATCTACATTGACTCATGCTACAT
CTACATCGTCTCATACCTCGACCACTCCGACCACCACGTCTACTCCCGAGCCTAAGCCTACCACTTCCCGTTTCG
TAACGAGTATTCGGCCTAGTCCCCAGCCTACTACAAGCGAGAAACCCACGACATCTACGAAGGCTCCTCCACCCC
CTCCAACTCAAGCCCCCGAAGCTGATCCTGGCTCCAATTCTGGGACTTCGTCTAGCGATATCCAGGCGTATTTAT
CTGCGCACAATACTGTTCGCGCACAGCATGGTGCCGCTCCCTTGACTTGGAGTGACGAGCTCGCCGGTAAGGCGC
AGCAGTGGGCCGACGGTTGTAAGTTCCAGCATTCAGGAGGCGCCCTTGGTAGATTTGGAGGTGAGTTTCCGGTAT
CTCAGGTCGCCAAAAAAAGAAGGGGTTCCTGATTGTGCCTCGATCAATAGAAAATTTGGCTGCTGGTACTGGAAA
TTCATATGGTATCCCTCAAGCCATCAAGTCATGGGCTGACGAAGCTAGTGAGTATCAAATAGTCCAAGTAGTGCA
TGTCCCGCATCCAAGTTATTTACGAACCTTTAAAAAGGCGACTACAACCCCAATAATCCACAGTTTTCTCATTTC
ACTCAAATGGTGTGGAAAGGCACTACGCAGCTCGGTTGTGCTGTCCAGGAATGTAGTGGGATTTTCTCGTCTTCG
TTTGGAGTAGGACTCTTTTTTCTTTGACATGATCTCAATACTGACGTCTCCCTGTAGCTGGCGAAATTTTATGTC
TGCGAGTATAACCCAGCAGGTAATGTTTTGGGCCAGTTCGCGTGAGTGTCAACTCTTTTCCTGTTGTCTGTTTCG
TGTTGACCCTTGCTTTGTCTCTTACAGTCAAAACGTCCAAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail