Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008160
Gene name
Locationscaffold_1:1922989..1923865
Strand+
Gene length (bp)876
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09430 EMC7_beta-sandw ER membrane protein complex subunit 7, beta-sandwich domain 5.7E-20 40 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94694|YG1A_SCHPO UPF0620 protein C83.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.10 PE=3 SV=1 1 177 7.0E-13
sp|Q9NPA0|EMC7_HUMAN ER membrane protein complex subunit 7 OS=Homo sapiens GN=EMC7 PE=1 SV=1 19 155 3.0E-10
sp|Q4R5V2|EMC7_MACFA ER membrane protein complex subunit 7 OS=Macaca fascicularis GN=EMC7 PE=2 SV=1 19 155 3.0E-10
sp|A5PJA8|EMC7_BOVIN ER membrane protein complex subunit 7 OS=Bos taurus GN=EMC7 PE=2 SV=1 19 155 3.0E-10
sp|Q9EP72|EMC7_MOUSE ER membrane protein complex subunit 7 OS=Mus musculus GN=Emc7 PE=1 SV=1 19 155 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94694|YG1A_SCHPO UPF0620 protein C83.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC83.10 PE=3 SV=1 1 177 7.0E-13
sp|Q9NPA0|EMC7_HUMAN ER membrane protein complex subunit 7 OS=Homo sapiens GN=EMC7 PE=1 SV=1 19 155 3.0E-10
sp|Q4R5V2|EMC7_MACFA ER membrane protein complex subunit 7 OS=Macaca fascicularis GN=EMC7 PE=2 SV=1 19 155 3.0E-10
sp|A5PJA8|EMC7_BOVIN ER membrane protein complex subunit 7 OS=Bos taurus GN=EMC7 PE=2 SV=1 19 155 3.0E-10
sp|Q9EP72|EMC7_MOUSE ER membrane protein complex subunit 7 OS=Mus musculus GN=Emc7 PE=1 SV=1 19 155 3.0E-10
sp|Q0IHY5|EMC7_XENTR ER membrane protein complex subunit 7 OS=Xenopus tropicalis GN=emc7 PE=2 SV=1 16 178 1.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 137 159 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008160
MLGLQTLLFSSWLLVATAFDLTGMVVWNDVCPDAVSLGRGKVVLNNGQLGGSVTANGSFTIYNVPTGSHLLSVVA
HDHSFDNLRVDVNNETAHVHPYTLGTPFNPPSTVSLSYPLKLTPKEKLDFFVPPHSFSLSGLLTNPMVLFGIGGL
ALFAINSLVDVNALQEAAKQGSESNTSPPRLADGHDQIRGGPMKRGTKRTRR*
Coding >AgabiH97|008160
ATGCTGGGTCTACAGACGCTGTTATTTTCCTCATGGCTTCTCGTTGCCACTGCGTTTGATCTCACTGGCATGGTC
GTATGGAACGACGTTTGTCCAGATGCTGTTTCTCTAGGAAGGGGGAAGGTAGTCCTCAACAATGGACAATTAGGT
GGTAGTGTCACTGCAAATGGCAGCTTCACCATTTATAATGTGCCGACAGGTTCTCATCTACTATCAGTGGTTGCT
CATGACCATTCTTTTGATAACTTGCGAGTCGACGTCAATAATGAGACTGCCCATGTACACCCATATACTCTCGGA
ACGCCTTTCAATCCACCCTCAACCGTCTCTTTGTCATACCCACTCAAACTGACGCCAAAAGAAAAGCTCGACTTC
TTTGTGCCGCCGCATTCCTTCAGCCTTTCCGGTCTGTTGACAAATCCTATGGTCCTGTTCGGTATCGGTGGCCTT
GCATTATTCGCTATAAACTCGCTTGTGGACGTTAATGCGCTTCAGGAGGCTGCGAAGCAGGGAAGCGAAAGCAAC
ACTTCTCCACCCAGACTCGCAGATGGTCACGATCAGATTCGGGGTGGACCAATGAAACGAGGGACTAAAAGAACT
CGACGGTAA
Transcript >AgabiH97|008160
ATGCTGGGTCTACAGACGCTGTTATTTTCCTCATGGCTTCTCGTTGCCACTGCGTTTGATCTCACTGGCATGGTC
GTATGGAACGACGTTTGTCCAGATGCTGTTTCTCTAGGAAGGGGGAAGGTAGTCCTCAACAATGGACAATTAGGT
GGTAGTGTCACTGCAAATGGCAGCTTCACCATTTATAATGTGCCGACAGGTTCTCATCTACTATCAGTGGTTGCT
CATGACCATTCTTTTGATAACTTGCGAGTCGACGTCAATAATGAGACTGCCCATGTACACCCATATACTCTCGGA
ACGCCTTTCAATCCACCCTCAACCGTCTCTTTGTCATACCCACTCAAACTGACGCCAAAAGAAAAGCTCGACTTC
TTTGTGCCGCCGCATTCCTTCAGCCTTTCCGGTCTGTTGACAAATCCTATGGTCCTGTTCGGTATCGGTGGCCTT
GCATTATTCGCTATAAACTCGCTTGTGGACGTTAATGCGCTTCAGGAGGCTGCGAAGCAGGGAAGCGAAAGCAAC
ACTTCTCCACCCAGACTCGCAGATGGTCACGATCAGATTCGGGGTGGACCAATGAAACGAGGGACTAAAAGAACT
CGACGGTAA
Gene >AgabiH97|008160
ATGCTGGGTCTACAGACGCTGTTATTTTCCTCATGGTATGTTAAATATCTAGCACATGTATCTGCGGTTAACATG
ATTCAGGCTTCTCGTTGCCACTGCGTTTGATCTCACTGGCATGGTCGTATGGAACGACGTTTGTCCAGGTTTGCC
TACTCCCCGTCTCTTCACCTGTTCTCTCAGTAATCTAACCACTTGAATGCTGTCGTACAGATGCTGTTTCTCTAG
GAAGGGGGAAGGTAGTCCTCAACAATGGACAATTAGGTGGTAGTGTCACTGCAAATGGCAGCTTCACCATGTATT
TTCCATCTCTCCAGCGACCCCCATCCTTTTTTGACTGAATTTGCAGTTATAATGTGCCGACAGGTTCTCATCTAC
TATCAGTGGTTGCTCATGACCATTCTTTTGATAACGTGCGCGCATTATCCGCATTTTACGATGTGTTCTATTGAC
ATATACGAATAGTTGCGAGTCGACGTCAATAATGAGACTGCCCATGTACACCCATATACTCTCGGAACGCCTTTC
AATCCACCCTCAACCGTCTCTTTGTCATACCCACTCAAACTGACGCCAAAAGAAAAGCTCGACTTCTTTGTGCCG
CCGCATTCCTTCAGCCTTTCCGGTCTGTTGACAAATCCTATGGTCCTGTTCGGTATCGGTGGCCTTGCATTATTC
GCTATAAACTCGCTTGTGGACGTTAATGCGCTTCAGGAGGCTGCGAAGCAGGGAAGCGAAAGGTGATTGAAGTGC
AGTGTCTTCCATTATCAGAACTGACACTTCGATTATAGCAACACTTCTCCACCCAGACTCGCAGATGGTCACGAT
CAGATTCGGGGTGGACCAATGAAACGAGGGACTAAAAGAACTCGACGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail