Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|008010
Gene name
Locationscaffold_1:1886747..1890723
Strand-
Gene length (bp)3976
Transcript length (bp)3726
Coding sequence length (bp)3726
Protein length (aa) 1242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01369 Sec7 Sec7 domain 2.9E-29 427 557
PF00169 PH PH domain 8.8E-10 719 825
PF15410 PH_9 Pleckstrin homology domain 5.2E-08 705 826

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13817|SEC7C_SCHPO Protein transport protein sec73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec73 PE=3 SV=2 407 834 9.0E-45
sp|Q10491|SEC74_SCHPO Arf guanine nucleotide exchange factor sec74 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec74 PE=1 SV=2 447 832 3.0E-43
sp|Q06836|SYT1_YEAST Arf guanine nucleotide exchange factor SYT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYT1 PE=1 SV=1 436 556 2.0E-20
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 440 557 2.0E-19
sp|Q9LZX8|BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana GN=BIG2 PE=2 SV=1 414 582 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13817|SEC7C_SCHPO Protein transport protein sec73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec73 PE=3 SV=2 407 834 9.0E-45
sp|Q10491|SEC74_SCHPO Arf guanine nucleotide exchange factor sec74 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec74 PE=1 SV=2 447 832 3.0E-43
sp|Q06836|SYT1_YEAST Arf guanine nucleotide exchange factor SYT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYT1 PE=1 SV=1 436 556 2.0E-20
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 440 557 2.0E-19
sp|Q9LZX8|BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana GN=BIG2 PE=2 SV=1 414 582 1.0E-18
sp|F4JSZ5|BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana GN=BIG1 PE=2 SV=1 441 557 8.0E-17
sp|O43739|CYH3_HUMAN Cytohesin-3 OS=Homo sapiens GN=CYTH3 PE=1 SV=2 411 566 2.0E-16
sp|Q80YW0|CYH4_MOUSE Cytohesin-4 OS=Mus musculus GN=Cyth4 PE=1 SV=1 425 566 2.0E-16
sp|P97696|CYH3_RAT Cytohesin-3 OS=Rattus norvegicus GN=Cyth3 PE=2 SV=1 441 566 3.0E-16
sp|O08967|CYH3_MOUSE Cytohesin-3 OS=Mus musculus GN=Cyth3 PE=1 SV=1 441 566 3.0E-16
sp|Q9UIA0|CYH4_HUMAN Cytohesin-4 OS=Homo sapiens GN=CYTH4 PE=2 SV=1 433 566 2.0E-15
sp|Q42510|GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana GN=GN PE=1 SV=1 399 540 2.0E-15
sp|Q9P7V5|SEC7B_SCHPO Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec72 PE=1 SV=1 425 557 3.0E-15
sp|F4JN05|BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana GN=BIG4 PE=3 SV=1 451 557 5.0E-15
sp|P63035|CYH2_RAT Cytohesin-2 OS=Rattus norvegicus GN=Cyth2 PE=1 SV=1 441 566 7.0E-15
sp|P63034|CYH2_MOUSE Cytohesin-2 OS=Mus musculus GN=Cyth2 PE=1 SV=2 441 566 8.0E-15
sp|Q9LPC5|BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana GN=BIG3 PE=1 SV=1 441 556 8.0E-15
sp|Q2KI41|CYH2_BOVIN Cytohesin-2 OS=Bos taurus GN=CYTH2 PE=2 SV=1 441 622 1.0E-14
sp|Q99418|CYH2_HUMAN Cytohesin-2 OS=Homo sapiens GN=CYTH2 PE=1 SV=2 441 566 1.0E-14
sp|Q76MY7|CYH2_CHLAE Cytohesin-2 OS=Chlorocebus aethiops GN=CYTH2 PE=2 SV=1 441 566 1.0E-14
sp|F4K2K3|GNL2_ARATH ARF guanine-nucleotide exchange factor GNL2 OS=Arabidopsis thaliana GN=GNL2 PE=2 SV=1 399 540 3.0E-14
sp|P97694|CYH1_RAT Cytohesin-1 OS=Rattus norvegicus GN=Cyth1 PE=1 SV=1 425 566 5.0E-14
sp|Q9QX11|CYH1_MOUSE Cytohesin-1 OS=Mus musculus GN=Cyth1 PE=1 SV=2 425 566 5.0E-14
sp|Q15438|CYH1_HUMAN Cytohesin-1 OS=Homo sapiens GN=CYTH1 PE=1 SV=1 425 566 7.0E-14
sp|Q76MZ1|CYH1_CHLAE Cytohesin-1 OS=Chlorocebus aethiops GN=CYTH1 PE=2 SV=1 425 566 7.0E-14
sp|F4IXW2|BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana GN=BIG5 PE=1 SV=2 426 557 1.0E-13
sp|Q5DU25|IQEC2_MOUSE IQ motif and SEC7 domain-containing protein 2 OS=Mus musculus GN=Iqsec2 PE=1 SV=3 426 540 3.0E-13
sp|Q5JU85|IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens GN=IQSEC2 PE=1 SV=1 426 540 4.0E-13
sp|A2A5R2|BIG2_MOUSE Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Mus musculus GN=Arfgef2 PE=1 SV=1 443 556 7.0E-13
sp|Q6DN90|IQEC1_HUMAN IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens GN=IQSEC1 PE=1 SV=1 426 556 9.0E-13
sp|Q3TES0|IQEC3_MOUSE IQ motif and SEC7 domain-containing protein 3 OS=Mus musculus GN=Iqsec3 PE=1 SV=1 426 540 9.0E-13
sp|Q8R0S2|IQEC1_MOUSE IQ motif and SEC7 domain-containing protein 1 OS=Mus musculus GN=Iqsec1 PE=1 SV=2 426 540 9.0E-13
sp|Q76M68|IQEC3_RAT IQ motif and SEC7 domain-containing protein 3 OS=Rattus norvegicus GN=Iqsec3 PE=1 SV=1 426 540 9.0E-13
sp|Q9UPP2|IQEC3_HUMAN IQ motif and SEC7 domain-containing protein 3 OS=Homo sapiens GN=IQSEC3 PE=2 SV=3 426 540 1.0E-12
sp|Q9Y6D6|BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens GN=ARFGEF1 PE=1 SV=2 313 540 1.0E-12
sp|O46382|BIG1_BOVIN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Bos taurus GN=ARFGEF1 PE=1 SV=1 433 540 2.0E-12
sp|D4A631|BIG1_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Rattus norvegicus GN=Arfgef1 PE=1 SV=1 393 540 2.0E-12
sp|G3X9K3|BIG1_MOUSE Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Mus musculus GN=Arfgef1 PE=1 SV=1 433 540 2.0E-12
sp|Q5DTT2|PSD1_MOUSE PH and SEC7 domain-containing protein 1 OS=Mus musculus GN=Psd PE=1 SV=2 424 556 2.0E-12
sp|Q7TSU1|BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus GN=Arfgef2 PE=1 SV=1 443 556 2.0E-12
sp|A5PKW4|PSD1_HUMAN PH and SEC7 domain-containing protein 1 OS=Homo sapiens GN=PSD PE=1 SV=2 424 556 2.0E-12
sp|Q9ESQ7|PSD1_RAT PH and SEC7 domain-containing protein 1 OS=Rattus norvegicus GN=Psd PE=1 SV=1 424 556 3.0E-12
sp|Q9Y6D5|BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens GN=ARFGEF2 PE=1 SV=3 443 540 3.0E-12
sp|Q9P7R8|YHV3_SCHPO Uncharacterized protein C211.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC211.03c PE=1 SV=1 448 540 5.0E-12
sp|P11075|SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC7 PE=1 SV=2 404 538 7.0E-12
sp|Q9FLY5|GNL1_ARATH ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana GN=GNL1 PE=3 SV=1 431 552 1.0E-11
sp|F1MUS9|PSD1_BOVIN PH and SEC7 domain-containing protein 1 OS=Bos taurus GN=PSD PE=2 SV=1 424 556 1.0E-10
sp|Q9NYI0|PSD3_HUMAN PH and SEC7 domain-containing protein 3 OS=Homo sapiens GN=PSD3 PE=1 SV=2 424 556 1.0E-10
sp|Q2PFD7|PSD3_MOUSE PH and SEC7 domain-containing protein 3 OS=Mus musculus GN=Psd3 PE=1 SV=2 424 556 2.0E-10
sp|Q9UT02|SEC7A_SCHPO Protein transport protein sec71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec71 PE=1 SV=1 397 540 5.0E-10
sp|Q6P1I6|PSD2_MOUSE PH and SEC7 domain-containing protein 2 OS=Mus musculus GN=Psd2 PE=1 SV=1 424 556 7.0E-10
sp|Q9BQI7|PSD2_HUMAN PH and SEC7 domain-containing protein 2 OS=Homo sapiens GN=PSD2 PE=2 SV=3 424 556 7.0E-10
sp|Q92538|GBF1_HUMAN Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens GN=GBF1 PE=1 SV=2 445 556 2.0E-09
sp|Q9R1D7|GBF1_CRIGR Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Cricetulus griseus GN=GBF1 PE=1 SV=1 445 616 8.0E-09
sp|Q8NDX1|PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens GN=PSD4 PE=1 SV=2 424 556 1.0E-08
sp|Q8BLR5|PSD4_MOUSE PH and SEC7 domain-containing protein 4 OS=Mus musculus GN=Psd4 PE=1 SV=1 443 556 4.0E-08
sp|P39993|GEA2_YEAST ARF guanine-nucleotide exchange factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEA2 PE=1 SV=1 440 540 7.0E-08
sp|Q9QZN3|FBX8_MOUSE F-box only protein 8 OS=Mus musculus GN=Fbxo8 PE=2 SV=2 465 556 3.0E-07
sp|Q5E9G6|FBX8_BOVIN F-box only protein 8 OS=Bos taurus GN=FBXO8 PE=2 SV=1 465 556 4.0E-07
sp|Q9NRD0|FBX8_HUMAN F-box only protein 8 OS=Homo sapiens GN=FBXO8 PE=2 SV=1 465 556 4.0E-07
sp|Q8BLR5|PSD4_MOUSE PH and SEC7 domain-containing protein 4 OS=Mus musculus GN=Psd4 PE=1 SV=1 703 830 8.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0032012 regulation of ARF protein signal transduction Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0010646 regulation of cell communication No
GO:0023051 regulation of signaling No
GO:0098772 molecular function regulator activity No
GO:0050789 regulation of biological process No
GO:0065007 biological regulation No
GO:0030234 enzyme regulator activity No
GO:0008150 biological_process No
GO:0030695 GTPase regulator activity No
GO:0051056 regulation of small GTPase mediated signal transduction No
GO:0050794 regulation of cellular process No
GO:1902531 regulation of intracellular signal transduction No
GO:0048583 regulation of response to stimulus No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0046578 regulation of Ras protein signal transduction No
GO:0003674 molecular_function No
GO:0009966 regulation of signal transduction No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|008010
MGHLPLKAPNSPSLEQDQLPPPYHQTSHPPFVVTETTTTRTEVVTTTTERTTHFVSLTGWKKHNNVDDTMSRRPH
HSGNSEENGGPALKTSSIQRDKALPPTPPVTSAHQASLDRNAHIIANPSKQSGDQTQTSNGLGFPQLTSLAPLPS
TPSLSLKNATTFTTTLSPLKVVRRSNSSERVERSLTALNTEGETSQRTRRLSLGPTALLKFGAADTKSKADSPKT
VSRKRSFWARKRPDVPIPQPRPSTVHGNVSHSRTSMEVDLSNFPPPNIGQSKCQAHDLPPGSTRQQSLGKSIGPQ
VFISPAPHSSSQVIHNSKRPSTAPGQASAMSPSVPGSRRMASVNVPEKTANLYPPVPRVRSQSGSPLLHRLSFNV
FSSSPAISSSTSSPTSPLLGATPDFIRKPVVVPRPLDKEPPDVYVGRLMDAVSKVDIVNTLASSAEPFYVSALKI
FLECFDFVGDPLDIALRKLLLEVGLPKETQQIDRAIEAFAKRYILCNPSLYLSEDHPYILAFSLIMLHTDAFNKS
NRRKMTKPDYLKNTRLPGVAPEILEYLYDNIVFAPFIFIEDPLDVNSQYGPVAESNRRSSVFRDSPSPSLPYSPT
GTMLAIKSNKIDLYYMISNNLLGPLQINVENYIPLSSPYHYEGTVGKWDQEELLLSFVNAHVVEVKSDTARPAPF
FGVSPVSPNSMDPDNDVQGKPSALRVAKVGLMSRKDHLLGVGRKPIGRKWKSWGVLLTGSQLLFSRDPAWLNTLS
NQTETDNIRFSIPQSEVLRVDEIISLKNAIAVHDRSYLKHRFTFRLVLSDSRQFLLKASNENDMNQWISRINYAS
AFKSAGIHMRLASMSGRSMQLTGVAAATFHLHDIQNQMHPQPSDPVAWDDNAAHQLLQMLSGEDPANIRRHRERK
MTLRTNRKVELEAPIPPEIEKTPEFKDTFDQVKADLAAESRPDTKKDSEPVNIPTLMISAVDATKSSLDLSLSSP
VSSSTSHSRQPSRSQIIETKLTELDDQLAATEEHLDMHMRFVRNVAKLMPFQKATRDRLLAAIQAKAIIIMQMRL
DVARMCCHRSVLLDDMVAESRIWKEVKDVALQTAKQTLQRQGSEDMHATHGGTSAVRALQMSRRPGSDSSVCESF
HTAIDFGPDWPSSDDLGSSLLTASVTFGSSRPSSSGSVSTQLWLEEDQNAEPVENTGQHERFYTAQEHPAEEAED
WNKTRCAKRVSLVRIPSNLESLPVNKRLAGSLSTTKQVVEY*
Coding >AgabiH97|008010
ATGGGACATCTTCCCTTGAAAGCTCCAAATTCTCCATCTCTTGAACAGGACCAGCTACCCCCTCCTTATCACCAG
ACCAGTCACCCTCCATTCGTTGTCACGGAAACAACCACTACTCGTACTGAAGTCGTCACCACCACGACTGAAAGA
ACCACTCACTTCGTATCACTCACGGGATGGAAAAAGCATAACAATGTGGATGATACCATGTCGCGGCGCCCTCAT
CATTCTGGAAATTCTGAGGAGAACGGAGGTCCCGCGTTGAAGACATCCTCTATTCAACGTGACAAAGCTCTTCCC
CCAACACCTCCGGTTACTTCTGCTCACCAGGCCTCTTTGGATCGCAATGCACATATTATAGCAAACCCATCAAAG
CAAAGTGGTGATCAAACCCAGACGTCCAATGGACTGGGATTTCCGCAACTTACAAGCCTCGCCCCACTGCCTTCA
ACCCCTTCACTCAGTCTGAAGAATGCGACTACCTTCACCACGACTTTAAGCCCTCTCAAGGTTGTCAGACGATCA
AACAGCTCTGAACGAGTCGAGAGGTCACTCACCGCTTTGAATACGGAGGGTGAGACGAGTCAGCGAACTCGACGC
CTATCGCTCGGCCCCACAGCCCTTCTTAAGTTCGGTGCCGCTGACACAAAATCAAAGGCAGACTCACCGAAAACG
GTATCGAGGAAGAGGTCATTTTGGGCTCGAAAGCGTCCCGATGTCCCTATCCCACAGCCACGACCCTCTACCGTA
CACGGCAATGTTTCCCATTCACGTACTTCCATGGAGGTCGATCTTTCCAATTTCCCCCCTCCTAACATTGGACAA
TCAAAATGTCAAGCTCATGACCTTCCACCTGGTTCGACGAGACAGCAATCGCTTGGCAAATCTATCGGACCTCAG
GTTTTCATCTCCCCGGCCCCGCACTCCAGCTCGCAAGTTATTCACAACTCAAAGAGACCATCAACTGCGCCAGGG
CAAGCTTCGGCCATGAGCCCTTCCGTACCGGGCTCTCGCCGAATGGCATCTGTCAATGTTCCCGAGAAAACCGCC
AATCTTTACCCCCCTGTCCCAAGAGTTCGCTCCCAATCGGGTTCGCCTTTACTTCATAGACTATCTTTCAACGTC
TTCTCGTCTTCTCCGGCTATTTCTTCCTCTACGTCGTCCCCTACGTCCCCGCTTTTGGGCGCTACACCCGATTTT
ATCCGCAAACCTGTTGTAGTTCCGCGACCCTTAGATAAAGAGCCTCCCGATGTCTATGTTGGCAGATTGATGGAT
GCTGTCAGCAAGGTCGACATTGTCAACACCCTGGCATCCAGTGCAGAACCATTTTATGTTTCAGCACTGAAAATA
TTTCTTGAATGCTTCGACTTTGTAGGAGATCCCCTCGATATCGCTTTACGCAAGCTACTGCTCGAAGTGGGGTTG
CCCAAGGAGACTCAACAGATTGATCGCGCCATTGAGGCGTTTGCTAAACGTTATATCCTATGCAACCCATCTCTA
TATTTATCAGAAGACCATCCCTATATTCTAGCCTTTAGTTTAATCATGCTTCACACTGATGCTTTCAACAAATCC
AATAGACGAAAGATGACCAAGCCTGATTATCTCAAGAACACGAGGTTACCTGGTGTTGCACCCGAAATTCTAGAA
TATCTTTATGATAATATCGTTTTTGCTCCATTCATATTTATCGAGGATCCTCTGGATGTAAATAGTCAATATGGC
CCCGTTGCCGAGTCAAACCGCCGTTCATCCGTTTTTCGGGATTCGCCATCTCCAAGTTTACCTTATTCTCCAACC
GGGACGATGCTGGCTATCAAGTCTAACAAGATCGACCTATACTACATGATTAGTAATAACCTCCTTGGGCCTTTA
CAAATCAACGTTGAGAATTATATACCCCTTTCCAGTCCATATCATTATGAAGGAACTGTCGGCAAGTGGGACCAA
GAAGAGCTTCTACTTTCATTTGTCAATGCACATGTCGTGGAAGTCAAATCTGACACCGCTCGTCCAGCGCCTTTC
TTTGGAGTGTCACCTGTCTCTCCCAATTCAATGGATCCCGATAACGACGTTCAAGGAAAACCGTCAGCGCTAAGA
GTCGCGAAGGTTGGGCTTATGAGCCGCAAGGATCATCTTCTCGGAGTTGGAAGAAAACCGATTGGTCGTAAATGG
AAATCTTGGGGCGTGCTTTTGACTGGATCTCAACTGCTATTCTCTCGAGATCCAGCTTGGTTGAATACTCTCTCA
AATCAAACCGAAACGGATAACATTCGATTCTCGATACCTCAATCAGAGGTACTCAGAGTAGACGAGATAATTTCT
TTGAAGAATGCGATTGCAGTTCACGACAGGTCATACCTTAAGCATCGTTTTACCTTTCGACTCGTATTATCTGAT
AGTCGACAGTTCCTTCTCAAGGCATCCAATGAAAATGACATGAACCAATGGATCTCCAGGATCAACTATGCAAGT
GCATTCAAGTCTGCAGGTATTCATATGCGATTAGCGAGCATGTCTGGGAGGAGTATGCAGCTTACTGGCGTCGCC
GCTGCAACATTTCATTTGCACGACATCCAGAACCAAATGCATCCTCAGCCCTCTGATCCAGTGGCATGGGATGAC
AATGCCGCTCACCAGTTGTTGCAGATGCTTTCAGGTGAAGATCCTGCAAACATACGGAGGCATCGCGAGCGGAAG
ATGACACTTCGCACCAACCGGAAGGTTGAATTGGAAGCGCCGATACCGCCTGAAATTGAGAAGACACCCGAGTTC
AAAGATACATTTGACCAGGTTAAAGCCGACCTTGCTGCCGAGAGTCGGCCAGATACGAAGAAGGATTCCGAACCT
GTCAACATTCCCACTCTCATGATATCCGCAGTGGATGCTACTAAGTCCTCTCTAGACTTATCATTATCATCACCA
GTATCTTCCTCAACTAGCCATTCTCGACAACCTTCCAGGTCCCAAATTATCGAAACTAAACTTACGGAGCTAGAC
GATCAATTAGCTGCAACGGAAGAGCATCTCGACATGCACATGCGATTCGTACGTAATGTCGCAAAATTGATGCCG
TTTCAAAAAGCTACCCGGGACCGCCTATTGGCCGCGATCCAGGCAAAGGCTATCATAATTATGCAGATGAGACTT
GATGTGGCAAGAATGTGCTGTCATCGAAGCGTCTTGTTGGATGACATGGTAGCAGAAAGTCGCATCTGGAAAGAG
GTTAAAGACGTTGCCTTGCAGACTGCAAAACAGACACTGCAAAGACAAGGATCGGAGGACATGCATGCGACCCAT
GGCGGAACGTCGGCTGTCAGGGCATTGCAGATGTCGCGACGTCCAGGGTCCGATTCGTCGGTATGCGAGTCGTTC
CACACTGCCATTGACTTCGGGCCGGATTGGCCCTCTTCGGATGACCTGGGGTCCTCGTTACTTACAGCGTCGGTG
ACGTTTGGTTCATCGCGGCCAAGTTCTTCTGGATCTGTGTCGACACAGCTATGGCTTGAAGAAGACCAGAACGCA
GAGCCTGTTGAGAACACTGGGCAGCATGAAAGATTCTATACTGCGCAAGAACATCCTGCAGAAGAAGCTGAAGAC
TGGAACAAGACGCGATGCGCAAAACGTGTTTCGCTGGTGAGGATACCGTCAAATTTGGAATCGCTGCCGGTGAAC
AAACGGCTGGCAGGAAGTCTGTCGACGACTAAACAAGTGGTGGAATATTGA
Transcript >AgabiH97|008010
ATGGGACATCTTCCCTTGAAAGCTCCAAATTCTCCATCTCTTGAACAGGACCAGCTACCCCCTCCTTATCACCAG
ACCAGTCACCCTCCATTCGTTGTCACGGAAACAACCACTACTCGTACTGAAGTCGTCACCACCACGACTGAAAGA
ACCACTCACTTCGTATCACTCACGGGATGGAAAAAGCATAACAATGTGGATGATACCATGTCGCGGCGCCCTCAT
CATTCTGGAAATTCTGAGGAGAACGGAGGTCCCGCGTTGAAGACATCCTCTATTCAACGTGACAAAGCTCTTCCC
CCAACACCTCCGGTTACTTCTGCTCACCAGGCCTCTTTGGATCGCAATGCACATATTATAGCAAACCCATCAAAG
CAAAGTGGTGATCAAACCCAGACGTCCAATGGACTGGGATTTCCGCAACTTACAAGCCTCGCCCCACTGCCTTCA
ACCCCTTCACTCAGTCTGAAGAATGCGACTACCTTCACCACGACTTTAAGCCCTCTCAAGGTTGTCAGACGATCA
AACAGCTCTGAACGAGTCGAGAGGTCACTCACCGCTTTGAATACGGAGGGTGAGACGAGTCAGCGAACTCGACGC
CTATCGCTCGGCCCCACAGCCCTTCTTAAGTTCGGTGCCGCTGACACAAAATCAAAGGCAGACTCACCGAAAACG
GTATCGAGGAAGAGGTCATTTTGGGCTCGAAAGCGTCCCGATGTCCCTATCCCACAGCCACGACCCTCTACCGTA
CACGGCAATGTTTCCCATTCACGTACTTCCATGGAGGTCGATCTTTCCAATTTCCCCCCTCCTAACATTGGACAA
TCAAAATGTCAAGCTCATGACCTTCCACCTGGTTCGACGAGACAGCAATCGCTTGGCAAATCTATCGGACCTCAG
GTTTTCATCTCCCCGGCCCCGCACTCCAGCTCGCAAGTTATTCACAACTCAAAGAGACCATCAACTGCGCCAGGG
CAAGCTTCGGCCATGAGCCCTTCCGTACCGGGCTCTCGCCGAATGGCATCTGTCAATGTTCCCGAGAAAACCGCC
AATCTTTACCCCCCTGTCCCAAGAGTTCGCTCCCAATCGGGTTCGCCTTTACTTCATAGACTATCTTTCAACGTC
TTCTCGTCTTCTCCGGCTATTTCTTCCTCTACGTCGTCCCCTACGTCCCCGCTTTTGGGCGCTACACCCGATTTT
ATCCGCAAACCTGTTGTAGTTCCGCGACCCTTAGATAAAGAGCCTCCCGATGTCTATGTTGGCAGATTGATGGAT
GCTGTCAGCAAGGTCGACATTGTCAACACCCTGGCATCCAGTGCAGAACCATTTTATGTTTCAGCACTGAAAATA
TTTCTTGAATGCTTCGACTTTGTAGGAGATCCCCTCGATATCGCTTTACGCAAGCTACTGCTCGAAGTGGGGTTG
CCCAAGGAGACTCAACAGATTGATCGCGCCATTGAGGCGTTTGCTAAACGTTATATCCTATGCAACCCATCTCTA
TATTTATCAGAAGACCATCCCTATATTCTAGCCTTTAGTTTAATCATGCTTCACACTGATGCTTTCAACAAATCC
AATAGACGAAAGATGACCAAGCCTGATTATCTCAAGAACACGAGGTTACCTGGTGTTGCACCCGAAATTCTAGAA
TATCTTTATGATAATATCGTTTTTGCTCCATTCATATTTATCGAGGATCCTCTGGATGTAAATAGTCAATATGGC
CCCGTTGCCGAGTCAAACCGCCGTTCATCCGTTTTTCGGGATTCGCCATCTCCAAGTTTACCTTATTCTCCAACC
GGGACGATGCTGGCTATCAAGTCTAACAAGATCGACCTATACTACATGATTAGTAATAACCTCCTTGGGCCTTTA
CAAATCAACGTTGAGAATTATATACCCCTTTCCAGTCCATATCATTATGAAGGAACTGTCGGCAAGTGGGACCAA
GAAGAGCTTCTACTTTCATTTGTCAATGCACATGTCGTGGAAGTCAAATCTGACACCGCTCGTCCAGCGCCTTTC
TTTGGAGTGTCACCTGTCTCTCCCAATTCAATGGATCCCGATAACGACGTTCAAGGAAAACCGTCAGCGCTAAGA
GTCGCGAAGGTTGGGCTTATGAGCCGCAAGGATCATCTTCTCGGAGTTGGAAGAAAACCGATTGGTCGTAAATGG
AAATCTTGGGGCGTGCTTTTGACTGGATCTCAACTGCTATTCTCTCGAGATCCAGCTTGGTTGAATACTCTCTCA
AATCAAACCGAAACGGATAACATTCGATTCTCGATACCTCAATCAGAGGTACTCAGAGTAGACGAGATAATTTCT
TTGAAGAATGCGATTGCAGTTCACGACAGGTCATACCTTAAGCATCGTTTTACCTTTCGACTCGTATTATCTGAT
AGTCGACAGTTCCTTCTCAAGGCATCCAATGAAAATGACATGAACCAATGGATCTCCAGGATCAACTATGCAAGT
GCATTCAAGTCTGCAGGTATTCATATGCGATTAGCGAGCATGTCTGGGAGGAGTATGCAGCTTACTGGCGTCGCC
GCTGCAACATTTCATTTGCACGACATCCAGAACCAAATGCATCCTCAGCCCTCTGATCCAGTGGCATGGGATGAC
AATGCCGCTCACCAGTTGTTGCAGATGCTTTCAGGTGAAGATCCTGCAAACATACGGAGGCATCGCGAGCGGAAG
ATGACACTTCGCACCAACCGGAAGGTTGAATTGGAAGCGCCGATACCGCCTGAAATTGAGAAGACACCCGAGTTC
AAAGATACATTTGACCAGGTTAAAGCCGACCTTGCTGCCGAGAGTCGGCCAGATACGAAGAAGGATTCCGAACCT
GTCAACATTCCCACTCTCATGATATCCGCAGTGGATGCTACTAAGTCCTCTCTAGACTTATCATTATCATCACCA
GTATCTTCCTCAACTAGCCATTCTCGACAACCTTCCAGGTCCCAAATTATCGAAACTAAACTTACGGAGCTAGAC
GATCAATTAGCTGCAACGGAAGAGCATCTCGACATGCACATGCGATTCGTACGTAATGTCGCAAAATTGATGCCG
TTTCAAAAAGCTACCCGGGACCGCCTATTGGCCGCGATCCAGGCAAAGGCTATCATAATTATGCAGATGAGACTT
GATGTGGCAAGAATGTGCTGTCATCGAAGCGTCTTGTTGGATGACATGGTAGCAGAAAGTCGCATCTGGAAAGAG
GTTAAAGACGTTGCCTTGCAGACTGCAAAACAGACACTGCAAAGACAAGGATCGGAGGACATGCATGCGACCCAT
GGCGGAACGTCGGCTGTCAGGGCATTGCAGATGTCGCGACGTCCAGGGTCCGATTCGTCGGTATGCGAGTCGTTC
CACACTGCCATTGACTTCGGGCCGGATTGGCCCTCTTCGGATGACCTGGGGTCCTCGTTACTTACAGCGTCGGTG
ACGTTTGGTTCATCGCGGCCAAGTTCTTCTGGATCTGTGTCGACACAGCTATGGCTTGAAGAAGACCAGAACGCA
GAGCCTGTTGAGAACACTGGGCAGCATGAAAGATTCTATACTGCGCAAGAACATCCTGCAGAAGAAGCTGAAGAC
TGGAACAAGACGCGATGCGCAAAACGTGTTTCGCTGGTGAGGATACCGTCAAATTTGGAATCGCTGCCGGTGAAC
AAACGGCTGGCAGGAAGTCTGTCGACGACTAAACAAGTGGTGGAATATTGA
Gene >AgabiH97|008010
ATGGGACATCTTCCCTTGAAAGCTCCAAATTCTCCATCTCTTGAACAGGACCAGCTACCCCCTCCTTATCACCAG
ACCAGTCACCCTCCATTCGTTGTCACGGAAACAACCACTACTCGTACTGAAGTCGTCACCACCACGACTGAAAGA
ACCACTCACTTCGTATCACTCACGGGATGGAAAAAGCATAACAATGTGGATGATACCATGTCGCGGCGCCCTCAT
CATTCTGGAAATTCTGAGGAGAACGGAGGTCCCGCGTTGAAGACATCCTCTATTCAACGTGACAAAGCTCTTCCC
CCAACACCTCCGGTTACTTCTGCTCACCAGGCCTCTTTGGATCGCAATGCACATATTATAGCAAACCCATCAAAG
CAAAGTGGTGATCAAACCCAGACGTCCAATGGACTGGGATTTCCGCAACTTACAAGCCTCGCCCCACTGCCTTCA
ACCCCTTCACTCAGTCTGAAGAATGCGACTACCTTCACCACGACTTTAAGCCCTCTCAAGGTTGTCAGACGATCA
AACAGCTCTGAACGAGTCGAGAGGTCACTCACCGCTTTGAATACGGAGGGTGAGACGAGTCAGCGAACTCGACGC
CTATCGCTCGGCCCCACAGCCCTTCTTAAGTTCGGTGCCGCTGACACAAAATCAAAGGCAGACTCACCGAAAACG
GTATCGAGGAAGAGGTCATTTTGGGCTCGAAAGCGTCCCGATGTCCCTATCCCACAGCCACGACCCTCTACCGTA
CACGGCAATGTTTCCCATTCACGTACTTCCATGGAGGTCGATCTTTCCAATTTCCCCCCTCCTAACATTGGACAA
TCAAAATGTCAAGCTCATGACCTTCCACCTGGTTCGACGAGACAGCAATCGCTTGGCAAATCTATCGGACCTCAG
GTTTTCATCTCCCCGGCCCCGCACTCCAGCTCGCAAGTTATTCACAACTCAAAGAGACCATCAACTGCGCCAGGG
CAAGCTTCGGCCATGAGCCCTTCCGTACCGGGCTCTCGCCGAATGGCATCTGTCAATGTTCCCGAGAAAACCGCC
AATCTTTACCCCCCTGTCCCAAGAGTTCGCTCCCAATCGGGTTCGCCTTTACTTCATAGACTATCTTTCAACGTC
TTCTCGTCTTCTCCGGCTATTTCTTCCTCTACGTCGTCCCCTACGTCCCCGCTTTTGGGCGCTACACCCGATTTT
ATCCGCAAACCTGTTGTAGTTCCGCGACCCTTAGATAAAGAGCCTCCCGATGTCTATGTTGGCAGATTGATGGAT
GCTGTCAGCAAGGTCGACATTGTCAACACCCTGGCATCCAGGTAAAGCTTTTACTAGGTTGCGGATCCGGATTAC
TCATGCCTCCTCGACAGTGCAGAACCATTTTATGTTTCAGCACTGAAAATATTTCTTGAATGCTTCGACTTTGTA
GGAGATCCCCTCGATATCGCTTTACGCAAGCTACTGCTCGAAGTGGGGTTGCCCAAGGAGACTCAACAGATTGAT
CGCGCCATTGAGGCGTTTGCTAAACGTTATATCCTATGCAACCCATCTCTATATTTATCAGAAGGTATATCTCAC
AATCATGTCTCGTTCAGTGCTAATTCTGCTATCTAGACCATCCCTATATTCTAGCCTTTAGTTTAATCATGCTTC
ACACTGATGCTTTCAACAAATCCAATAGACGAAAGATGACCAAGCCTGATTATCTCAAGAACACGAGGTTACCTG
GTGTTGCACCCGAAATTCTAGAAGTAAGGCAACCCCCAAATTTCGGAGCTAGTTTGCTTATAACAAATGCAGTAT
CTTTATGATAATATCGTTTTTGCTCCATTCATATTTATCGAGGATCCTCTGGATGTAAATAGTCAATATGGCCCC
GTTGCCGAGTCAAACCGCCGTTCATCCGTTTTTCGGGATTCGCCATCTCCAAGTTTACCTTATTCTCCAACCGGG
ACGATGCTGGCTATCAAGTCTAACAAGATCGACCTATACTACATGATTAGTAATGTGAGTCAAAAGTTTGTATCC
TTCTTTAAGTACTAATTACATCCTAGAACCTCCTTGGGCCTTTACAAATCAACGTTGAGAATTATATACCCCTTT
CCAGTCCATATCATTATGAAGGAACTGTCGGCAAGTGGGACCAAGAAGAGCTTCTACTTTCATTTGTCAATGCAC
ATGTCGTGGAAGTCAAATCTGACACCGCTCGTCCAGCGCCTTTCTTTGGAGTGTCACCTGTCTCTCCCAATTCAA
TGGATCCCGATAACGACGTTCAAGGAAAACCGTCAGCGCTAAGAGTCGCGAAGGTTGGGCTTATGAGCCGCAAGG
ATCATCTTCTCGGAGTTGGAAGAAAACCGATTGGTCGTAAATGGAAATCTTGGGGCGTGCTTTTGACTGGATCTC
AACTGCTATTCTCTCGAGATCCAGCTTGGTTGAATACTCTCTCAAATCAAACCGAAACGGATAACATTCGATTCT
CGATACCTCAATCAGAGGTACTCAGAGTAGACGAGATAATTTCTTTGAAGAATGCGATTGCAGTTCACGACAGGT
CATACCTTAAGGTAACTTTAATCTTCTATTCGGATTTCGAAGGAAATTACATGCCACCCTCCTTTAGCATCGTTT
TACCTTTCGACTCGTATTATCTGATAGTCGACAGTTCCTTCTCAAGGCATCCAATGAAAATGACATGAACCAATG
GATCTCCAGGATCAACTATGCAAGTGCATTCAAGTCTGCAGGTATTCATATGCGATTAGCGAGCATGTCTGGGAG
GAGTATGCAGCTTACTGGCGTCGCCGCTGCAACATTTCATTTGCACGACATCCAGAACCAAATGCATCCTCAGCC
CTCTGATCCAGTGGCATGGGATGACAATGCCGCTCACCAGTTGTTGCAGATGCTTTCAGGTGAAGATCCTGCAAA
CATACGGAGGCATCGCGAGCGGAAGATGACACTTCGCACCAACCGGAAGGTTGAATTGGAAGCGCCGATACCGCC
TGAAATTGAGAAGACACCCGAGTTCAAAGATACATTTGACCAGGTTAAAGCCGACCTTGCTGCCGAGAGTCGGCC
AGATACGAAGAAGGATTCCGAACCTGTCAACATTCCCACTCTCATGATATCCGCAGTGGATGCTACTAAGTCCTC
TCTAGACTTATCATTATCATCACCAGTATCTTCCTCAACTAGCCATTCTCGACAACCTTCCAGGTCCCAAATTAT
CGAAACTAAACTTACGGAGCTAGACGATCAATTAGCTGCAACGGAAGAGCATCTCGACATGCACATGCGATTCGT
ACGTAATGTCGCAAAATTGATGCCGTTTCAAAAAGCTACCCGGGACCGCCTATTGGCCGCGATCCAGGCAAAGGC
TATCATAATTATGCAGATGAGACTTGATGTGGCAAGAATGTGCTGTCATCGAAGCGTCTTGTTGGATGACATGGT
AGCAGAAAGTCGCATCTGGAAAGAGGTTAAAGACGTTGCCTTGCAGACTGCAAAACAGACACTGCAAAGACAAGG
ATCGGAGGACATGCATGCGACCCATGGCGGAACGTCGGCTGTCAGGGCATTGCAGATGTCGCGACGTCCAGGGTC
CGATTCGTCGGTATGCGAGTCGTTCCACACTGCCATTGACTTCGGGCCGGATTGGCCCTCTTCGGATGACCTGGG
GTCCTCGTTACTTACAGCGTCGGTGACGTTTGGTTCATCGCGGCCAAGTTCTTCTGGATCTGTGTCGACACAGCT
ATGGCTTGAAGAAGACCAGAACGCAGAGCCTGTTGAGAACACTGGGCAGCATGAAAGATTCTATACTGCGCAAGA
ACATCCTGCAGAAGAAGCTGAAGACTGGAACAAGACGCGATGCGCAAAACGTGTTTCGCTGGTGAGGATACCGTC
AAATTTGGAATCGCTGCCGGTGAACAAACGGCTGGCAGGAAGTCTGTCGACGACTAAACAAGTGGTGGAATATTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail