Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|007770
Gene name
Locationscaffold_1:1839998..1842884
Strand+
Gene length (bp)2886
Transcript length (bp)2718
Coding sequence length (bp)2718
Protein length (aa) 906

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00412 LIM LIM domain 3.9E-05 201 257

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|007770
MGFCRRCGDIVNGQRCNKCGGSVVAPAVSWNQALPQEEQDKWSKTYVSRERSISPVRPRAKSTSRQLEGPSTPSH
SPTPSAKFFPRGVGAHITGSSALDSRITDHISSASMRSTRPLKPTLTGPKPESGILPSLNDTTLSKVYGSVLQPK
ESLTTHSCATCATPFLPDATIYPDPTLPESDEPRFLCRQCFIVGGGSKGLCPTCSKPVTILKAEGGFVYAADRYW
HKKCFNCEGCTKNIGECPMLDLLGRPSCADCFDTCLSREPLTPKRSTVAPDQSSPSIKQRNPGGYSSSSGVSNKL
RDSSSAIEELEQRLGIARSREGSPVIEELSQRLSSIGKDYQFRASPTGPPHAQPNRLNGSPNPGRRLERLKSLEF
NDQIDSSPLSTFGSPRRTLSSPTPTTEAVEEMKKRFLRHSMESPALSTATLLESFPGTPLSPLRPSYPSASPRTN
ATLRTPVLTSEILSPSSSTPDLISDFSDTLTQSSFSGVDSPPRISEPLLGQSHDYGHTVLVHSDEAIAEGTKTNL
TSPDQTYQSTVKLKPQATTTPVKTSIPTGASEQVGSMSATTMCAKCDRPLFALKDGGRFMTVPGEKDTDVPQTYH
EDCFCCALCGHTFKESGSGQAMFVKSPAGPAHVECAPPTKVVIHKSPSAGSLRPSNESMLPKKFTASKIPLASSQ
KSSNYHGSSRLERPFPVVPTTSSSSPRFGSRTVCPGCNKSVSPMERGVVPGPQGSKWHAGCLVCGGKRPPSTSMA
WMLGRGEEKKKEPGCGKKLDSAAKADIDGRIWCRQCLLMLGVGGSPQTTSTGALASNGTFTTQLTGTTTIARQFT
GLGGGDTGLFKQLTGGPGSISPTRSLSPTKQLSHAGPGIRPRPKSVIGMRSSKSLDEGRGMFLVRNLTDISYSNH
GESGA*
Coding >AgabiH97|007770
ATGGGTTTCTGTAGGAGATGTGGTGATATAGTAAACGGTCAACGTTGTAATAAATGCGGGGGCTCCGTCGTCGCC
CCAGCTGTGTCCTGGAACCAGGCTCTTCCCCAGGAAGAGCAGGATAAGTGGTCGAAAACTTACGTTTCTCGCGAG
AGGTCAATCTCTCCAGTTAGGCCCCGGGCCAAGAGCACTAGCCGTCAGCTGGAGGGCCCTTCAACTCCTTCCCAT
TCCCCAACTCCTTCAGCGAAGTTTTTTCCTCGCGGAGTCGGTGCGCACATCACTGGATCTAGCGCCCTTGATAGT
CGTATCACCGACCACATCTCGTCTGCTTCCATGCGATCAACTCGACCACTGAAACCGACACTTACCGGGCCTAAA
CCTGAATCTGGAATCCTCCCCTCTTTAAATGATACCACACTTTCCAAAGTTTATGGCTCAGTACTACAACCGAAA
GAATCCTTGACGACACATTCTTGCGCCACCTGTGCCACCCCTTTTCTCCCTGACGCCACTATATATCCTGATCCA
ACCCTACCTGAATCAGATGAACCACGCTTTTTATGCCGACAGTGCTTCATTGTCGGTGGCGGGTCGAAAGGTCTT
TGTCCAACGTGCTCCAAACCTGTTACAATACTCAAGGCCGAGGGAGGGTTCGTATATGCTGCGGACAGGTACTGG
CATAAAAAGTGTTTCAATTGCGAGGGTTGCACAAAGAATATTGGCGAGTGTCCTATGCTTGATCTGCTTGGGCGG
CCTTCCTGCGCCGATTGCTTCGACACCTGTCTTTCCCGTGAACCTCTTACACCAAAACGATCGACTGTGGCGCCC
GACCAGTCGAGCCCTTCTATCAAGCAGCGGAATCCCGGCGGGTACAGCTCATCAAGTGGTGTTTCAAACAAGCTT
CGAGATTCAAGTTCTGCTATCGAAGAACTAGAGCAGCGTTTGGGTATTGCAAGAAGCCGCGAGGGGAGTCCAGTG
ATTGAGGAGCTTAGCCAACGCCTCAGTTCGATCGGCAAGGATTATCAATTCCGTGCTAGTCCCACCGGTCCGCCA
CACGCACAGCCCAATCGTCTGAATGGCAGCCCGAATCCTGGCCGAAGACTGGAACGCCTTAAAAGCCTGGAATTC
AACGATCAAATAGACAGTTCTCCGTTGTCAACATTTGGAAGTCCGCGACGAACCTTGAGCAGTCCAACTCCCACC
ACAGAAGCAGTTGAAGAAATGAAGAAGAGATTTTTGAGGCACTCCATGGAGTCACCCGCTCTGTCAACCGCTACA
CTCTTGGAGTCGTTCCCTGGGACACCCCTATCCCCTCTGCGTCCTTCCTATCCTTCCGCATCTCCGAGAACCAAT
GCTACGTTGAGGACTCCGGTTCTCACCTCTGAAATCTTGTCCCCATCCTCATCAACGCCTGACCTTATCTCCGAC
TTCTCCGACACATTGACACAATCATCGTTTTCTGGCGTAGACTCCCCTCCTAGGATTTCTGAACCTCTTCTCGGC
CAATCCCACGATTATGGCCACACAGTTCTGGTTCATTCGGATGAAGCTATTGCTGAGGGGACAAAGACCAATTTG
ACCTCACCTGATCAGACTTACCAATCGACAGTTAAACTCAAACCACAAGCAACAACCACCCCGGTAAAAACATCC
ATTCCAACAGGAGCCTCTGAACAAGTCGGCAGTATGTCTGCAACTACGATGTGTGCGAAATGTGACAGGCCTCTG
TTCGCATTGAAAGACGGCGGTAGATTTATGACAGTACCTGGTGAGAAAGATACGGATGTCCCTCAAACCTACCAC
GAAGATTGTTTCTGTTGCGCTCTTTGTGGTCATACCTTCAAGGAGAGTGGCAGCGGTCAGGCTATGTTCGTCAAG
AGCCCTGCCGGACCCGCTCATGTTGAGTGTGCCCCACCCACCAAAGTAGTGATCCATAAATCTCCTAGCGCTGGC
TCTCTACGACCCTCAAACGAAAGTATGCTGCCAAAAAAGTTTACTGCTTCGAAGATACCACTAGCGTCATCTCAG
AAGAGCAGCAACTACCATGGCTCTAGTCGTCTTGAACGACCGTTTCCAGTTGTCCCAACAACATCATCTTCATCC
CCTCGGTTTGGGAGTCGAACAGTCTGCCCTGGTTGTAATAAATCCGTCTCTCCCATGGAAAGGGGTGTCGTACCA
GGACCTCAAGGTTCAAAGTGGCATGCAGGCTGTTTGGTTTGTGGAGGAAAACGACCACCATCCACATCTATGGCT
TGGATGCTTGGTAGAGGCGAAGAAAAGAAGAAGGAGCCAGGCTGCGGCAAAAAGCTTGATAGTGCAGCAAAGGCT
GATATTGACGGTCGAATTTGGTGCAGACAGTGTTTGTTGATGCTTGGTGTTGGAGGTTCACCGCAAACAACGTCG
ACTGGGGCACTAGCTTCTAATGGCACATTTACAACACAACTAACTGGTACTACCACGATTGCACGTCAATTTACA
GGCTTGGGTGGTGGGGATACTGGCCTATTCAAACAGCTCACGGGAGGTCCAGGATCAATTAGTCCCACCCGGAGT
CTCAGCCCAACGAAACAGCTAAGCCATGCTGGGCCAGGTATTCGGCCGAGACCTAAGAGCGTGATTGGGATGCGC
AGTTCAAAGAGCCTCGATGAAGGAAGAGGAATGTTTTTGGTAAGAAACCTTACGGATATCAGTTACTCAAATCAC
GGGGAAAGTGGAGCTTGA
Transcript >AgabiH97|007770
ATGGGTTTCTGTAGGAGATGTGGTGATATAGTAAACGGTCAACGTTGTAATAAATGCGGGGGCTCCGTCGTCGCC
CCAGCTGTGTCCTGGAACCAGGCTCTTCCCCAGGAAGAGCAGGATAAGTGGTCGAAAACTTACGTTTCTCGCGAG
AGGTCAATCTCTCCAGTTAGGCCCCGGGCCAAGAGCACTAGCCGTCAGCTGGAGGGCCCTTCAACTCCTTCCCAT
TCCCCAACTCCTTCAGCGAAGTTTTTTCCTCGCGGAGTCGGTGCGCACATCACTGGATCTAGCGCCCTTGATAGT
CGTATCACCGACCACATCTCGTCTGCTTCCATGCGATCAACTCGACCACTGAAACCGACACTTACCGGGCCTAAA
CCTGAATCTGGAATCCTCCCCTCTTTAAATGATACCACACTTTCCAAAGTTTATGGCTCAGTACTACAACCGAAA
GAATCCTTGACGACACATTCTTGCGCCACCTGTGCCACCCCTTTTCTCCCTGACGCCACTATATATCCTGATCCA
ACCCTACCTGAATCAGATGAACCACGCTTTTTATGCCGACAGTGCTTCATTGTCGGTGGCGGGTCGAAAGGTCTT
TGTCCAACGTGCTCCAAACCTGTTACAATACTCAAGGCCGAGGGAGGGTTCGTATATGCTGCGGACAGGTACTGG
CATAAAAAGTGTTTCAATTGCGAGGGTTGCACAAAGAATATTGGCGAGTGTCCTATGCTTGATCTGCTTGGGCGG
CCTTCCTGCGCCGATTGCTTCGACACCTGTCTTTCCCGTGAACCTCTTACACCAAAACGATCGACTGTGGCGCCC
GACCAGTCGAGCCCTTCTATCAAGCAGCGGAATCCCGGCGGGTACAGCTCATCAAGTGGTGTTTCAAACAAGCTT
CGAGATTCAAGTTCTGCTATCGAAGAACTAGAGCAGCGTTTGGGTATTGCAAGAAGCCGCGAGGGGAGTCCAGTG
ATTGAGGAGCTTAGCCAACGCCTCAGTTCGATCGGCAAGGATTATCAATTCCGTGCTAGTCCCACCGGTCCGCCA
CACGCACAGCCCAATCGTCTGAATGGCAGCCCGAATCCTGGCCGAAGACTGGAACGCCTTAAAAGCCTGGAATTC
AACGATCAAATAGACAGTTCTCCGTTGTCAACATTTGGAAGTCCGCGACGAACCTTGAGCAGTCCAACTCCCACC
ACAGAAGCAGTTGAAGAAATGAAGAAGAGATTTTTGAGGCACTCCATGGAGTCACCCGCTCTGTCAACCGCTACA
CTCTTGGAGTCGTTCCCTGGGACACCCCTATCCCCTCTGCGTCCTTCCTATCCTTCCGCATCTCCGAGAACCAAT
GCTACGTTGAGGACTCCGGTTCTCACCTCTGAAATCTTGTCCCCATCCTCATCAACGCCTGACCTTATCTCCGAC
TTCTCCGACACATTGACACAATCATCGTTTTCTGGCGTAGACTCCCCTCCTAGGATTTCTGAACCTCTTCTCGGC
CAATCCCACGATTATGGCCACACAGTTCTGGTTCATTCGGATGAAGCTATTGCTGAGGGGACAAAGACCAATTTG
ACCTCACCTGATCAGACTTACCAATCGACAGTTAAACTCAAACCACAAGCAACAACCACCCCGGTAAAAACATCC
ATTCCAACAGGAGCCTCTGAACAAGTCGGCAGTATGTCTGCAACTACGATGTGTGCGAAATGTGACAGGCCTCTG
TTCGCATTGAAAGACGGCGGTAGATTTATGACAGTACCTGGTGAGAAAGATACGGATGTCCCTCAAACCTACCAC
GAAGATTGTTTCTGTTGCGCTCTTTGTGGTCATACCTTCAAGGAGAGTGGCAGCGGTCAGGCTATGTTCGTCAAG
AGCCCTGCCGGACCCGCTCATGTTGAGTGTGCCCCACCCACCAAAGTAGTGATCCATAAATCTCCTAGCGCTGGC
TCTCTACGACCCTCAAACGAAAGTATGCTGCCAAAAAAGTTTACTGCTTCGAAGATACCACTAGCGTCATCTCAG
AAGAGCAGCAACTACCATGGCTCTAGTCGTCTTGAACGACCGTTTCCAGTTGTCCCAACAACATCATCTTCATCC
CCTCGGTTTGGGAGTCGAACAGTCTGCCCTGGTTGTAATAAATCCGTCTCTCCCATGGAAAGGGGTGTCGTACCA
GGACCTCAAGGTTCAAAGTGGCATGCAGGCTGTTTGGTTTGTGGAGGAAAACGACCACCATCCACATCTATGGCT
TGGATGCTTGGTAGAGGCGAAGAAAAGAAGAAGGAGCCAGGCTGCGGCAAAAAGCTTGATAGTGCAGCAAAGGCT
GATATTGACGGTCGAATTTGGTGCAGACAGTGTTTGTTGATGCTTGGTGTTGGAGGTTCACCGCAAACAACGTCG
ACTGGGGCACTAGCTTCTAATGGCACATTTACAACACAACTAACTGGTACTACCACGATTGCACGTCAATTTACA
GGCTTGGGTGGTGGGGATACTGGCCTATTCAAACAGCTCACGGGAGGTCCAGGATCAATTAGTCCCACCCGGAGT
CTCAGCCCAACGAAACAGCTAAGCCATGCTGGGCCAGGTATTCGGCCGAGACCTAAGAGCGTGATTGGGATGCGC
AGTTCAAAGAGCCTCGATGAAGGAAGAGGAATGTTTTTGGTAAGAAACCTTACGGATATCAGTTACTCAAATCAC
GGGGAAAGTGGAGCTTGA
Gene >AgabiH97|007770
ATGGGTTTCTGTAGGAGATGTGGTGATATAGTAAACGGTCAACGTTGTAATAAATGCGGGGGCTCCGTCGTCGGT
GAGTATTATCAATTCTCAATGAATCTCGTTGGGCTCTGACGAGTCGTCCTAATTAGCCCCAGCTGTGTCCTGGAA
CCAGGCTCTTCCCCAGGAAGAGCAGGATAAGTGGTCGAAAACTTACGTTTCTCGCGAGAGGTCAATCTCTCCAGT
TAGGCCCCGGGCCAAGAGCACTAGCCGTCAGCTGGAGGGCCCTTCAACTCCTTCCCATTCCCCAACTCCTTCAGC
GAAGTTTTTTCCTCGCGGAGTCGGTGCGCACATCACTGGATCTAGCGCCCTTGATAGTCGTATCACCGACCACAT
CTCGTCTGCTTCCATGCGATCAACTCGACCACTGAAACCGACACTTACCGGGCCTAAACCTGAATCTGGAATCCT
CCCCTCTTTAAATGATACCACACTTTCCAAAGTTTATGGCTCAGTACTACAACCGAAAGAATCCTTGACGACACA
TTCTTGCGCCACCTGTGCCACCCCTTTTCTCCCTGACGCCACTATATATCCTGATCCAACCCTACCTGAATCAGA
TGAACCACGCTTTTTATGCCGACAGTGCTTCATTGTCGGTGGCGGGTCGAAAGGTCTTTGTCCAACGTGCTCCAA
ACCTGTTACAATACTCAAGGCCGAGGGAGGGTTCGTATATGCTGCGGACAGGTACTGGCATAAAAAGTGTTTCAA
TTGCGAGGGTTGCACAAAGAATATTGGCGAGTGTCCTATGCTTGATCTGCTTGGGCGGCCTTCCTGCGCCGATTG
CTTCGACACCTGTCTTTCCCGTGAACCTCTTACACCAAAACGATCGACTGTGGCGCCCGACCAGTCGAGCCCTTC
TATCAAGCAGCGGAATCCCGGCGGGTACAGCTCATCAAGTGGTGTTTCAAACAAGCTTCGAGATTCAAGTTCTGC
TATCGAAGAACTAGAGCAGCGTTTGGGTATTGCAAGAAGCCGCGAGGGGAGTCCAGTGATTGAGGAGCTTAGCCA
ACGCCTCAGTTCGATCGGCAAGGATTATCAATTCCGTGCTAGTCCCACCGGTCCGCCACACGCACAGCCCAATCG
TCTGAATGGCAGCCCGAATCCTGGCCGAAGACTGGAACGCCTTAAAAGCCTGGAATTCAACGATCAAATAGACAG
TTCTCCGTTGTCAACATTTGGAAGTCCGCGACGAACCTTGAGCAGTCCAACTCCCACCACAGAAGCAGTTGAAGA
AATGAAGAAGAGATTTTTGAGGCACTCCATGGAGTCACCCGCTCTGTCAACCGCTACACTCTTGGAGTCGTTCCC
TGGGACACCCCTATCCCCTCTGCGTCCTTCCTATCCTTCCGCATCTCCGAGAACCAATGCTACGTTGAGGACTCC
GGTTCTCACCTCTGAAATCTTGTCCCCATCCTCATCAACGCCTGACCTTATCTCCGACTTCTCCGACACATTGAC
ACAATCATCGTTTTCTGGCGTAGACTCCCCTCCTAGGATTTCTGAACCTCTTCTCGGCCAATCCCACGATTATGG
CCACACAGTTCTGGTTCATTCGGATGAAGCTATTGCTGAGGGGACAAAGACCAATTTGACCTCACCTGATCAGAC
TTACCAATCGACAGTTAAACTCAAACCACAAGCAACAACCACCCCGGTAAAAACATCCATTCCAACAGGAGCCTC
TGAACAAGTCGGCAGTATGTCTGCAACTACGATGTGTGCGAAATGTGACAGGCCTCTGTTCGCATTGAAAGACGG
CGGTAGATTTATGACAGTACCTGGTGAGAAAGATACGGATGTCCCTCAAACCTACCACGAAGATTGTTTCTGTTG
CGCTCTTTGTGGTCATACCTTCAAGGAGAGTGGCAGCGGTCAGGCTATGTTCGTCAAGAGCCCTGCCGGACCCGC
TCATGTTGAGGTGCGTAGGTTATATACTGCTGGAATGGCCCGAGTACTTAGCGACGTTTAAAGTGTGCCCCACCC
ACCAAAGTAGTGATCCATAAATCTCCTAGCGCTGGCTCTCTACGACCCTCAAACGAAAGTATGCTGCCAAAAAAG
TTTACTGCTTCGAAGATACCACTAGCGTCATCTCAGAAGAGCAGCAACTACCATGGCTCTAGTCGTCTTGAACGA
CCGTTTCCAGTTGTCCCAACAACATCATCTTCATCCCCTCGGTTTGGGAGTCGAACAGTCTGCCCTGGTTGTAAT
AAATCCGTCTCTCCCATGGAAAGGGGTGTCGTACCAGGACCTCAAGGTTCAAAGTGGCATGCAGGCTGTTTGGTT
TGTGGAGGAAAACGACCACCATCCACATCTATGGCTTGGATGCTTGGTAGAGGCGAAGAAAAGAAGAAGGAGCCA
GGCTGCGGCAAAAAGCTTGATAGTGCAGCAAAGGCTGATATTGACGGTCGAATTTGGTGCAGACAGTGTTTGGTA
AAGGCTTTCATTTACTGATTGCTGCCTAATTTTCAACCTTACCATTTTATTTAGTTGATGCTTGGTGTTGGAGGT
TCACCGCAAACAACGTCGACTGGGGCACTAGCTTCTAATGGCACATTTACAACACAACTAACTGGTACTACCACG
ATTGCACGTCAATTTACAGGCTTGGGTGGTGGGGATACTGGCCTATTCAAACAGCTCACGGGAGGTCCAGGATCA
ATTAGTCCCACCCGGAGTCTCAGCCCAACGAAACAGCTAAGCCATGCTGGGCCAGGTATTCGGCCGAGACCTAAG
AGCGTGATTGGGATGCGCAGTTCAAAGAGCCTCGATGAAGGAAGAGGAATGTTTTTGGTAAGAAACCTTACGGAT
ATCAGTTACTCAAATCACGGGGAAAGTGGAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail