Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|007740
Gene name
Locationscaffold_1:1832005..1833497
Strand-
Gene length (bp)1492
Transcript length (bp)1119
Coding sequence length (bp)1119
Protein length (aa) 373

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B3I5|A3024_ARTBC Extracellular serine-rich protein ARB_03024 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03024 PE=1 SV=1 22 129 8.0E-11
sp|P0DN32|CUPR1_ARTBC Probable GPI-anchored cupredoxin ARB_05732-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-1 PE=1 SV=1 1 129 6.0E-10
sp|P0DN32|CUPR1_ARTBC Probable GPI-anchored cupredoxin ARB_05732-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-1 PE=1 SV=1 210 309 1.0E-08
sp|D4B3I5|A3024_ARTBC Extracellular serine-rich protein ARB_03024 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03024 PE=1 SV=1 210 328 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 1177.17 412.74 1941.61
Initials Initials knots 421.74 232.27 611.21
Pileal_Stipeal_center Stage I stipe center 470.78 238.24 703.31
Pileal_Stipeal_shell Stage I stipe shell 347.57 196.54 498.61
DIF_stipe_center Stage II stipe center 254.19 146.62 361.76
DIF_stipe_shell Stage II stipe shell 284.08 161.04 407.11
DIF_stipe_skin Stage II stipe skin 425.26 219.89 630.63
DIF_cap_skin Stage II cap skin 472.33 256.18 688.48
DIF_cap_tissue Stage II cap tissue 480.91 259.23 702.59
DIF_gill_tissue Stage II gill tissue 406.82 224.00 589.65
YFB_stipe_center Young fruiting body stipe center 526.78 260.99 792.56
YFB_stipe_shell Young fruiting body stipe shell 305.03 173.54 436.52
YFB_stipe_skin Young fruiting body stipe skin 712.74 342.02 1083.46
YFB_cap_skin Young fruiting body cap skin 446.07 243.63 648.51
YFB_cap_tissue Young fruiting body cap tissue 680.05 347.22 1012.88
YFB_gill_tissue Young fruiting body gill tissue 293.50 162.95 424.04
YFB_veil Young fruiting body veil 362.09 200.22 523.97

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.006742 yes
Casing YFB_stipe_center 0.041164 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.261343 no
Casing YFB_cap_skin 0.011041 yes
Casing YFB_cap_tissue 0.189511 no
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.003365 yes
Casing Initials 0.007782 yes
Casing Pileal_Stipeal_center 0.018344 yes
Casing Pileal_Stipeal_shell 0.002525 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.008457 yes
Casing DIF_cap_skin 0.017226 yes
Casing DIF_cap_tissue 0.021056 yes
DIF_gill_tissue YFB_stipe_center 0.542972 no
DIF_gill_tissue YFB_stipe_shell 0.429397 no
DIF_gill_tissue YFB_stipe_skin 0.105702 no
DIF_gill_tissue YFB_cap_skin 0.864074 no
DIF_gill_tissue YFB_cap_tissue 0.123805 no
DIF_gill_tissue YFB_gill_tissue 0.363211 no
DIF_gill_tissue YFB_veil 0.815588 no
YFB_stipe_center YFB_stipe_shell 0.092841 no
YFB_stipe_center YFB_stipe_skin 0.507902 no
YFB_stipe_center YFB_cap_skin 0.741202 no
YFB_stipe_center YFB_cap_tissue 0.582696 no
YFB_stipe_center YFB_gill_tissue 0.073043 no
YFB_stipe_center YFB_veil 0.310199 no
YFB_stipe_shell YFB_stipe_skin 0.009123 yes
YFB_stipe_shell YFB_cap_skin 0.256555 no
YFB_stipe_shell YFB_cap_tissue 0.010412 yes
YFB_stipe_shell YFB_gill_tissue 0.948135 no
YFB_stipe_shell YFB_veil 0.698740 no
YFB_stipe_skin YFB_cap_skin 0.188653 no
YFB_stipe_skin YFB_cap_tissue 0.948047 no
YFB_stipe_skin YFB_gill_tissue 0.006032 yes
YFB_stipe_skin YFB_veil 0.035993 yes
YFB_cap_skin YFB_cap_tissue 0.236791 no
YFB_cap_skin YFB_gill_tissue 0.201033 no
YFB_cap_skin YFB_veil 0.620893 no
YFB_cap_tissue YFB_gill_tissue 0.007439 yes
YFB_cap_tissue YFB_veil 0.045060 yes
YFB_gill_tissue YFB_veil 0.609752 no
Initials DIF_gill_tissue 0.952460 no
Initials YFB_stipe_center 0.626936 no
Initials YFB_stipe_shell 0.359090 no
Initials YFB_stipe_skin 0.137864 no
Initials YFB_cap_skin 0.923737 no
Initials YFB_cap_tissue 0.164492 no
Initials YFB_gill_tissue 0.296798 no
Initials YFB_veil 0.746261 no
Initials Pileal_Stipeal_center 0.841940 no
Initials Pileal_Stipeal_shell 0.649307 no
Initials DIF_stipe_center 0.092330 no
Initials DIF_stipe_shell 0.227041 no
Initials DIF_stipe_skin 0.989150 no
Initials DIF_cap_skin 0.825878 no
Initials DIF_cap_tissue 0.797884 no
Pileal_Stipeal_center DIF_gill_tissue 0.775991 no
Pileal_Stipeal_center YFB_stipe_center 0.848435 no
Pileal_Stipeal_center YFB_stipe_shell 0.210433 no
Pileal_Stipeal_center YFB_stipe_skin 0.300978 no
Pileal_Stipeal_center YFB_cap_skin 0.932378 no
Pileal_Stipeal_center YFB_cap_tissue 0.356456 no
Pileal_Stipeal_center YFB_gill_tissue 0.161964 no
Pileal_Stipeal_center YFB_veil 0.526281 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.430967 no
Pileal_Stipeal_center DIF_stipe_center 0.048626 yes
Pileal_Stipeal_center DIF_stipe_shell 0.119910 no
Pileal_Stipeal_center DIF_stipe_skin 0.860488 no
Pileal_Stipeal_center DIF_cap_skin 0.995692 no
Pileal_Stipeal_center DIF_cap_tissue 0.974498 no
Pileal_Stipeal_shell DIF_gill_tissue 0.728845 no
Pileal_Stipeal_shell YFB_stipe_center 0.232528 no
Pileal_Stipeal_shell YFB_stipe_shell 0.778073 no
Pileal_Stipeal_shell YFB_stipe_skin 0.027943 yes
Pileal_Stipeal_shell YFB_cap_skin 0.520071 no
Pileal_Stipeal_shell YFB_cap_tissue 0.028437 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.699220 no
Pileal_Stipeal_shell YFB_veil 0.942584 no
Pileal_Stipeal_shell DIF_stipe_center 0.351323 no
Pileal_Stipeal_shell DIF_stipe_shell 0.618681 no
Pileal_Stipeal_shell DIF_stipe_skin 0.640630 no
Pileal_Stipeal_shell DIF_cap_skin 0.386890 no
Pileal_Stipeal_shell DIF_cap_tissue 0.360784 no
DIF_stipe_center DIF_gill_tissue 0.130393 no
DIF_stipe_center YFB_stipe_center 0.019169 yes
DIF_stipe_center YFB_stipe_shell 0.658968 no
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.055779 no
DIF_stipe_center YFB_cap_tissue 0.001140 yes
DIF_stipe_center YFB_gill_tissue 0.752814 no
DIF_stipe_center YFB_veil 0.284650 no
DIF_stipe_center DIF_stipe_shell 0.816978 no
DIF_stipe_center DIF_stipe_skin 0.102187 no
DIF_stipe_center DIF_cap_skin 0.031800 yes
DIF_stipe_center DIF_cap_tissue 0.028918 yes
DIF_stipe_shell DIF_gill_tissue 0.290658 no
DIF_stipe_shell YFB_stipe_center 0.047373 yes
DIF_stipe_shell YFB_stipe_shell 0.895995 no
DIF_stipe_shell YFB_stipe_skin 0.003365 yes
DIF_stipe_shell YFB_cap_skin 0.148925 no
DIF_stipe_shell YFB_cap_tissue 0.005671 yes
DIF_stipe_shell YFB_gill_tissue 0.956919 no
DIF_stipe_shell YFB_veil 0.531128 no
DIF_stipe_shell DIF_stipe_skin 0.223147 no
DIF_stipe_shell DIF_cap_skin 0.094821 no
DIF_stipe_shell DIF_cap_tissue 0.086914 no
DIF_stipe_skin DIF_gill_tissue 0.940787 no
DIF_stipe_skin YFB_stipe_center 0.646617 no
DIF_stipe_skin YFB_stipe_shell 0.354556 no
DIF_stipe_skin YFB_stipe_skin 0.149625 no
DIF_stipe_skin YFB_cap_skin 0.936725 no
DIF_stipe_skin YFB_cap_tissue 0.180078 no
DIF_stipe_skin YFB_gill_tissue 0.292699 no
DIF_stipe_skin YFB_veil 0.731975 no
DIF_stipe_skin DIF_cap_skin 0.842186 no
DIF_stipe_skin DIF_cap_tissue 0.813099 no
DIF_cap_skin DIF_gill_tissue 0.755363 no
DIF_cap_skin YFB_stipe_center 0.845934 no
DIF_cap_skin YFB_stipe_shell 0.167754 no
DIF_cap_skin YFB_stipe_skin 0.270160 no
DIF_cap_skin YFB_cap_skin 0.922276 no
DIF_cap_skin YFB_cap_tissue 0.320818 no
DIF_cap_skin YFB_gill_tissue 0.130258 no
DIF_cap_skin YFB_veil 0.486632 no
DIF_cap_skin DIF_cap_tissue 0.977403 no
DIF_cap_tissue DIF_gill_tissue 0.725159 no
DIF_cap_tissue YFB_stipe_center 0.877533 no
DIF_cap_tissue YFB_stipe_shell 0.160907 no
DIF_cap_tissue YFB_stipe_skin 0.315681 no
DIF_cap_tissue YFB_cap_skin 0.896068 no
DIF_cap_tissue YFB_cap_tissue 0.370745 no
DIF_cap_tissue YFB_gill_tissue 0.122473 no
DIF_cap_tissue YFB_veil 0.458582 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|007740
MFALPLSLGLALLPFASAAVHDIQVGAEGKLQFWPEAIAAQPGDQVVFHFASKNHTATQSSFADPCGHSEGGFDS
GFMPVAANQTDSLPTFAFTVEDTKAVWVYCKQKVPVGHCGKGMVFSVNCPPDGDPNSFTNFKKSALAIGAAEASA
APPAAPPAAPSADSGSAPAGYGGYGGGYGDSGAPAPSSSDPAPAASASASTSASGAVHTVIVGESGSLAFNPPSI
QAKPSDTVIFEFRDKNHTVTQSSFADPCTKGASGFDSGFMPVANPAGPFPTWKLTVNDTTPIWAYCRQQVPKSHC
GTGMVFAINAVEDGPKNFTAFQNVAKALSGGASAGSAVSGDSNTADTNSALSIHLSPVTVTAMVSVAVALLL*
Coding >AgabiH97|007740
ATGTTTGCTCTTCCTCTCTCTTTGGGCCTGGCGCTTCTGCCCTTTGCTTCTGCTGCTGTTCATGATATTCAAGTT
GGTGCTGAGGGAAAGCTACAGTTCTGGCCAGAGGCCATTGCTGCCCAACCAGGTGATCAGGTCGTCTTCCATTTT
GCCTCCAAGAACCACACCGCCACACAATCTTCCTTTGCCGATCCCTGTGGACACAGTGAAGGTGGTTTTGACTCG
GGATTTATGCCCGTTGCCGCCAACCAGACGGACAGCCTCCCTACCTTTGCTTTTACCGTCGAAGACACAAAAGCA
GTCTGGGTTTACTGTAAGCAGAAAGTGCCAGTTGGTCACTGCGGGAAAGGCATGGTCTTTTCCGTCAACTGTCCA
CCCGATGGCGATCCAAATTCTTTCACAAACTTCAAGAAGTCTGCACTTGCTATTGGTGCTGCTGAGGCTAGCGCA
GCTCCCCCCGCAGCTCCCCCCGCAGCTCCCAGCGCTGACTCTGGATCAGCCCCTGCCGGATATGGTGGGTATGGC
GGTGGATATGGGGATTCCGGTGCCCCAGCCCCAAGTTCCTCGGACCCAGCTCCAGCAGCTTCAGCCTCTGCTTCA
ACTTCAGCTTCAGGCGCCGTTCACACCGTCATCGTCGGCGAATCCGGATCACTTGCCTTCAACCCACCCAGCATC
CAGGCCAAGCCCAGTGATACCGTGATCTTTGAATTCCGTGACAAAAACCATACTGTTACTCAATCATCATTTGCC
GACCCCTGTACCAAGGGCGCCTCTGGATTTGACTCTGGATTTATGCCTGTCGCAAATCCCGCCGGACCTTTCCCC
ACCTGGAAATTAACTGTCAATGATACCACACCTATCTGGGCCTATTGTCGCCAACAGGTCCCCAAGAGCCACTGT
GGGACTGGAATGGTCTTCGCCATTAATGCAGTTGAGGACGGTCCAAAGAACTTTACCGCTTTCCAAAACGTGGCC
AAGGCGTTAAGTGGGGGTGCTAGTGCAGGTAGCGCAGTTTCGGGAGACTCCAACACTGCAGACACAAACTCTGCG
CTGTCCATCCACCTCAGTCCAGTAACTGTCACTGCCATGGTATCTGTTGCTGTTGCTCTCCTTCTTTAA
Transcript >AgabiH97|007740
ATGTTTGCTCTTCCTCTCTCTTTGGGCCTGGCGCTTCTGCCCTTTGCTTCTGCTGCTGTTCATGATATTCAAGTT
GGTGCTGAGGGAAAGCTACAGTTCTGGCCAGAGGCCATTGCTGCCCAACCAGGTGATCAGGTCGTCTTCCATTTT
GCCTCCAAGAACCACACCGCCACACAATCTTCCTTTGCCGATCCCTGTGGACACAGTGAAGGTGGTTTTGACTCG
GGATTTATGCCCGTTGCCGCCAACCAGACGGACAGCCTCCCTACCTTTGCTTTTACCGTCGAAGACACAAAAGCA
GTCTGGGTTTACTGTAAGCAGAAAGTGCCAGTTGGTCACTGCGGGAAAGGCATGGTCTTTTCCGTCAACTGTCCA
CCCGATGGCGATCCAAATTCTTTCACAAACTTCAAGAAGTCTGCACTTGCTATTGGTGCTGCTGAGGCTAGCGCA
GCTCCCCCCGCAGCTCCCCCCGCAGCTCCCAGCGCTGACTCTGGATCAGCCCCTGCCGGATATGGTGGGTATGGC
GGTGGATATGGGGATTCCGGTGCCCCAGCCCCAAGTTCCTCGGACCCAGCTCCAGCAGCTTCAGCCTCTGCTTCA
ACTTCAGCTTCAGGCGCCGTTCACACCGTCATCGTCGGCGAATCCGGATCACTTGCCTTCAACCCACCCAGCATC
CAGGCCAAGCCCAGTGATACCGTGATCTTTGAATTCCGTGACAAAAACCATACTGTTACTCAATCATCATTTGCC
GACCCCTGTACCAAGGGCGCCTCTGGATTTGACTCTGGATTTATGCCTGTCGCAAATCCCGCCGGACCTTTCCCC
ACCTGGAAATTAACTGTCAATGATACCACACCTATCTGGGCCTATTGTCGCCAACAGGTCCCCAAGAGCCACTGT
GGGACTGGAATGGTCTTCGCCATTAATGCAGTTGAGGACGGTCCAAAGAACTTTACCGCTTTCCAAAACGTGGCC
AAGGCGTTAAGTGGGGGTGCTAGTGCAGGTAGCGCAGTTTCGGGAGACTCCAACACTGCAGACACAAACTCTGCG
CTGTCCATCCACCTCAGTCCAGTAACTGTCACTGCCATGGTATCTGTTGCTGTTGCTCTCCTTCTTTAA
Gene >AgabiH97|007740
ATGTTTGCTCTTCCTCTCTCTTTGGGCCTGGCGCTTCTGCCCTTTGCTTCTGCTGCTGTTCATGATATTCAAGTT
GGTGCTGAGGGAAAGCTACAGTTCTGGCCAGAGGCCATTGTGAGTCTTGCTAATTGGCCCCTTTGTGAAGCGCAT
CCTCATGCGTACCTATTAGGCTGCCCAACCAGGTGATCAGGTCGTCTTCCATTTTGCCTCCAAGAACCACACCGC
CACACAATCTTCCTTTGCCGATCCCTGTGGACACAGTGAAGGTGGTTTTGACTCGGGATTGTAAGTATCTACCTC
TTCGAATACCTCTTTAATTCACAATTTTTCTAGTATGCCCGTTGCCGCCAACCAGACGGACAGCCTCCCTACCTT
TGCTTTTACCGTCGAAGACGTGCGTGATGCTTCTGAAAATAACCCTTGATATTTATTCTGACTTTGCCAAAAAGA
CAAAAGCAGTCTGGGTTTACTGTAAGCAGAAAGTGCCAGTTGGTCACTGCGGGAAAGGCATGGTCTTTTCCGTCA
ACTGTCCACCCGATGGCGATCCAAATTCTTTCACAAACTTCAAGAAGTCTGCACTTGCTATTGGTGCTGCTGAGG
CTAGCGCAGCTCCCCCCGCAGCTCCCCCCGCAGCTCCCAGCGCTGACTCTGGATCAGCCCCTGCCGGATATGGTG
GGTATGGCGGTGGATATGGGGATTCCGGTGCCCCAGCCCCAAGTTCCTCGGACCCAGCTCCAGCAGCTTCAGCCT
CTGCTTCAACTTCAGCTTCAGGCGCCGTTCACACCGTCATCGTCGGCGAATCCGGATCACTTGCCTTCAACCCAC
CCAGCATCCAGGCCAAGCCCAGTGATACCGTGATCTTTGAATTGTAATCTCTTCCCCTGTTATCTCGCCCACTGA
AATTGATTCATCTTCTACTCATTCTAGCCGTGACAAAAACCATACTGTTACTCAATCATCATTTGCCGACCCCTG
TACCAAGGGCGCCTCTGGATTTGACTCTGGATTGTAAGTGCAAGTTCACTCGACTTGTCCGGCAATTTCGCTAAC
ATCTTGGTAGTATGCCTGTCGCAAATCCCGCCGGACCTTTCCCCACCTGGAAATTAACTGTCAATGATACCACAC
CTATCTGGGCCTATGTGAGCACTGACTATTGCCGTTTTCTCGTGTATCAAACTGATCATTTCCATTAGTGTCGCC
AACAGGTCCCCAAGAGCCACTGTGGGACTGGAATGGTCTTGTAAGTCATTCTCTGTTTACTTCGTACTTTACTCT
AAAACGCAATTTTAGCGCCATTAATGCAGTTGAGGACGGTCCAAAGAACTTTACCGCTTTCCAAAACGTGGCCAA
GGCGTTAAGTGGGGGTGCTAGTGCAGGTAGCGCAGTTTCGGGAGACTCCAACACTGCAGACACAAACTCTGCGCT
GTCCATCCACCTCAGTCCAGTAACTGTCACTGCCATGGTATCTGTTGCTGTTGCTCTCCTTCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail