Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|007590
Gene name
Locationscaffold_1:1801001..1803200
Strand-
Gene length (bp)2199
Transcript length (bp)1995
Coding sequence length (bp)1995
Protein length (aa) 665

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04880 NUDE_C NUDE protein, C-terminal conserved region 4.0E-09 149 280

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CP38|NDE1_CRYNJ Nuclear distribution protein nudE homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NDE1 PE=3 SV=1 20 205 2.0E-52
sp|P0CP39|NDE1_CRYNB Nuclear distribution protein nudE homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NDE1 PE=3 SV=1 20 205 2.0E-52
sp|Q4P0N6|NDE1_USTMA Nuclear distribution protein nudE homolog 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NDE1 PE=3 SV=2 33 200 9.0E-39
sp|O13335|NDE1_NEUCR Nuclear distribution protein nudE homolog 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-11 PE=3 SV=1 46 202 1.0E-30
sp|Q4I877|NDE1_GIBZE Nuclear distribution protein nudE homolog 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NDE1 PE=3 SV=1 30 202 4.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CP38|NDE1_CRYNJ Nuclear distribution protein nudE homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=NDE1 PE=3 SV=1 20 205 2.0E-52
sp|P0CP39|NDE1_CRYNB Nuclear distribution protein nudE homolog 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=NDE1 PE=3 SV=1 20 205 2.0E-52
sp|Q4P0N6|NDE1_USTMA Nuclear distribution protein nudE homolog 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NDE1 PE=3 SV=2 33 200 9.0E-39
sp|O13335|NDE1_NEUCR Nuclear distribution protein nudE homolog 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-11 PE=3 SV=1 46 202 1.0E-30
sp|Q4I877|NDE1_GIBZE Nuclear distribution protein nudE homolog 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NDE1 PE=3 SV=1 30 202 4.0E-28
sp|Q4X1V0|NDE1_ASPFU Nuclear distribution protein nudE homolog 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nde1 PE=3 SV=1 27 205 3.0E-26
sp|O46480|NDEL1_RABIT Nuclear distribution protein nudE-like 1 OS=Oryctolagus cuniculus GN=NDEL1 PE=1 SV=3 25 216 3.0E-23
sp|Q78PB6|NDEL1_RAT Nuclear distribution protein nudE-like 1 OS=Rattus norvegicus GN=Ndel1 PE=1 SV=1 25 216 3.0E-23
sp|Q9ERR1|NDEL1_MOUSE Nuclear distribution protein nudE-like 1 OS=Mus musculus GN=Ndel1 PE=1 SV=2 25 216 3.0E-23
sp|Q5R8T7|NDEL1_PONAB Nuclear distribution protein nudE-like 1 OS=Pongo abelii GN=NDEL1 PE=2 SV=1 25 216 5.0E-23
sp|Q9GZM8|NDEL1_HUMAN Nuclear distribution protein nudE-like 1 OS=Homo sapiens GN=NDEL1 PE=1 SV=1 25 216 5.0E-23
sp|Q4R4S6|NDEL1_MACFA Nuclear distribution protein nudE-like 1 OS=Macaca fascicularis GN=NDEL1 PE=2 SV=2 25 216 1.0E-22
sp|Q803Q2|NDL1B_DANRE Nuclear distribution protein nudE-like 1-B OS=Danio rerio GN=ndel1b PE=2 SV=1 17 222 9.0E-22
sp|Q5ZKH4|NDEL1_CHICK Nuclear distribution protein nudE-like 1 OS=Gallus gallus GN=NDEL1 PE=2 SV=1 30 216 2.0E-21
sp|Q66J96|NDE1A_XENLA Nuclear distribution protein nudE homolog 1-A OS=Xenopus laevis GN=nde1-a PE=1 SV=1 33 201 3.0E-21
sp|Q28CJ6|NDEL1_XENTR Nuclear distribution protein nudE-like 1 OS=Xenopus tropicalis GN=ndel1 PE=2 SV=1 33 222 5.0E-21
sp|Q6DK98|NDL1A_XENLA Nuclear distribution protein nudE-like 1-A OS=Xenopus laevis GN=ndel1-a PE=2 SV=1 33 222 7.0E-21
sp|Q66IZ7|NDL1B_XENLA Nuclear distribution protein nudE-like 1-B OS=Xenopus laevis GN=ndel1-b PE=2 SV=1 33 222 2.0E-20
sp|Q66JL0|NDE1_XENTR Nuclear distribution protein nudE homolog 1 OS=Xenopus tropicalis GN=nde1 PE=2 SV=1 33 201 1.0E-19
sp|Q7SXI6|NDL1A_DANRE Nuclear distribution protein nudE-like 1-A OS=Danio rerio GN=ndel1a PE=2 SV=1 33 219 2.0E-18
sp|Q6C3S1|NDE1_YARLI Nuclear distribution protein nudE homolog 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NDE1 PE=3 SV=1 36 203 3.0E-18
sp|Q9CZA6|NDE1_MOUSE Nuclear distribution protein nudE homolog 1 OS=Mus musculus GN=Nde1 PE=1 SV=1 30 201 4.0E-18
sp|Q6NRJ5|NDE1B_XENLA Nuclear distribution protein nudE homolog 1-B OS=Xenopus laevis GN=nde1-b PE=2 SV=2 33 201 5.0E-18
sp|Q9NXR1|NDE1_HUMAN Nuclear distribution protein nudE homolog 1 OS=Homo sapiens GN=NDE1 PE=1 SV=2 47 201 3.0E-17
sp|Q9ES39|NDE1_RAT Nuclear distribution protein nudE homolog 1 OS=Rattus norvegicus GN=Nde1 PE=1 SV=1 30 201 4.0E-17
sp|Q5ZMC9|NDE1_CHICK Nuclear distribution protein nudE homolog 1 OS=Gallus gallus GN=NDE1 PE=2 SV=1 20 201 9.0E-16
sp|Q9VT70|NDE1_DROME Nuclear distribution protein nudE homolog OS=Drosophila melanogaster GN=nudE PE=2 SV=2 33 197 5.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|007590
MTAVFSPTDALRHDRHLSRDDSQFDYSSATTDWRAKYHEVVDMLAETRNELEEFQATSKELEAELEADLLRSDKQ
EKELKAKAEKAESERDEWKSKYMSLQTTHNSTTTSLQRELDQLRQEHQRIKVELRDLELGADDLERSKRATSSSL
VDMEAKYTKTLEEKIILEHELLEKASLEEEMQRVRDELRDSQDEVSILREQLASATTSSTSSSPPLPENSSDKHL
AFSEQQFPNISLASEDDLLHSSLPSELQLSELSSIKEPAFATVTTPKATAAAKASGQNLLLQRAGFNPNRPTGLP
SPVSGITRSTTLPSLSMARNPIARAPTIQASSSASSTARNKGVQMVSEMRAKVRNLEQKIHTRVPRIRMGSITGR
ANAATSPINALGSSSSSSSGSLASTAKTSLDSIRRSIDSRKSHEKNGAKDTGDSSGWVLIMEDSPSPQKQRERER
QKERRRVSSPSGPSVYRSGITAPSPTFNKSSGIGVRRPASRLSGASLSTATTGSSLPTPTSRPSTPTFLPLPSST
MSPGAAMKRSMAGVHPVAGNAKRTSLGTTSNGSFAESFRDRSSTISSPRPGPSTPSSINPSRSYKYDEMKSLPYL
PTQFNPTSSVTSPRQSRLPSSANGALSKSRIGRPAGTGPRRSGGTVSDSGEALDIKDLRPRYAS*
Coding >AgabiH97|007590
ATGACCGCTGTCTTTTCCCCGACAGATGCCCTTCGTCATGACAGGCATCTGTCCCGGGATGATTCCCAGTTCGAC
TACTCCTCAGCCACAACTGACTGGCGGGCCAAGTATCATGAAGTTGTTGATATGCTGGCTGAAACTAGGAACGAA
CTAGAAGAATTCCAGGCTACGAGTAAGGAGCTTGAAGCAGAGCTCGAGGCAGATCTCCTCCGCTCCGACAAGCAG
GAAAAGGAACTCAAAGCCAAGGCGGAAAAGGCAGAGTCGGAACGAGACGAGTGGAAGAGCAAGTACATGTCCCTT
CAAACAACCCACAATTCCACCACTACTTCCCTTCAACGAGAGCTCGACCAGCTGCGGCAGGAACACCAGCGAATC
AAAGTCGAACTCAGAGACCTCGAGCTCGGGGCAGACGATCTAGAACGAAGCAAACGAGCCACTTCGTCCAGTCTC
GTCGATATGGAGGCAAAGTATACTAAAACACTCGAGGAGAAAATCATTCTTGAACACGAGCTATTGGAGAAAGCC
AGTTTGGAAGAAGAGATGCAAAGAGTTAGAGATGAACTGCGAGATTCCCAAGATGAAGTATCCATCCTCAGGGAA
CAATTAGCATCTGCAACTACTTCCTCTACTAGCTCTTCACCACCGTTGCCAGAGAATTCGTCAGACAAACATTTG
GCCTTCTCTGAGCAGCAGTTCCCCAATATCTCCTTAGCATCTGAAGATGACCTCCTTCATTCTAGCCTACCAAGC
GAGCTCCAGCTCTCCGAACTTTCTTCTATTAAAGAACCTGCGTTTGCGACTGTAACTACACCGAAGGCCACCGCG
GCGGCCAAAGCCTCCGGTCAAAACTTACTATTGCAGCGCGCAGGGTTTAATCCCAATAGACCCACCGGTCTACCA
TCACCTGTTTCAGGCATAACCCGCTCAACTACTCTGCCATCCTTGTCGATGGCCCGGAACCCAATTGCCCGTGCT
CCGACCATCCAAGCTTCTTCCTCAGCCTCAAGCACCGCAAGGAACAAAGGGGTACAAATGGTCTCGGAAATGCGA
GCAAAGGTTCGCAATCTCGAGCAGAAGATACATACGCGGGTTCCAAGGATCAGAATGGGCAGCATCACGGGCAGA
GCCAATGCGGCAACTTCACCGATCAACGCGTTGGGGAGCTCTTCTTCTTCTTCATCCGGCTCTCTGGCATCTACG
GCCAAAACGAGTCTCGATAGCATCCGAAGAAGCATAGACTCCCGCAAGAGCCACGAGAAAAATGGAGCGAAGGAT
ACTGGCGATTCATCGGGATGGGTACTCATTATGGAAGACTCACCTTCTCCCCAAAAGCAGCGGGAAAGGGAACGT
CAAAAAGAGAGGCGGCGAGTCTCAAGTCCCAGTGGTCCGAGCGTCTATCGCTCCGGAATTACAGCTCCTTCGCCA
ACTTTTAATAAATCTTCAGGCATAGGTGTCCGTCGGCCAGCCTCGCGCCTTTCTGGGGCAAGTTTGAGCACGGCA
ACAACTGGCAGTTCTTTGCCCACTCCCACTTCTCGTCCAAGTACCCCTACATTTCTTCCGCTACCTTCATCAACA
ATGTCACCCGGTGCCGCAATGAAGCGATCGATGGCAGGAGTTCATCCAGTTGCAGGAAATGCAAAGCGAACGTCA
CTGGGTACGACTTCGAATGGTTCCTTTGCGGAATCGTTCCGTGATAGATCATCGACTATCTCCTCGCCACGACCC
GGGCCAAGCACTCCCTCTTCAATTAATCCCTCAAGGTCATATAAGTATGACGAAATGAAGTCTTTACCATATTTG
CCTACCCAATTTAATCCCACTTCGAGCGTCACATCTCCTCGACAGAGCAGGTTGCCATCAAGCGCTAATGGCGCC
CTCTCGAAGAGTCGGATTGGACGACCGGCTGGCACGGGACCGAGGAGAAGTGGGGGTACCGTGAGTGATTCAGGA
GAAGCGCTTGATATCAAAGACTTGCGTCCAAGGTACGCGAGCTGA
Transcript >AgabiH97|007590
ATGACCGCTGTCTTTTCCCCGACAGATGCCCTTCGTCATGACAGGCATCTGTCCCGGGATGATTCCCAGTTCGAC
TACTCCTCAGCCACAACTGACTGGCGGGCCAAGTATCATGAAGTTGTTGATATGCTGGCTGAAACTAGGAACGAA
CTAGAAGAATTCCAGGCTACGAGTAAGGAGCTTGAAGCAGAGCTCGAGGCAGATCTCCTCCGCTCCGACAAGCAG
GAAAAGGAACTCAAAGCCAAGGCGGAAAAGGCAGAGTCGGAACGAGACGAGTGGAAGAGCAAGTACATGTCCCTT
CAAACAACCCACAATTCCACCACTACTTCCCTTCAACGAGAGCTCGACCAGCTGCGGCAGGAACACCAGCGAATC
AAAGTCGAACTCAGAGACCTCGAGCTCGGGGCAGACGATCTAGAACGAAGCAAACGAGCCACTTCGTCCAGTCTC
GTCGATATGGAGGCAAAGTATACTAAAACACTCGAGGAGAAAATCATTCTTGAACACGAGCTATTGGAGAAAGCC
AGTTTGGAAGAAGAGATGCAAAGAGTTAGAGATGAACTGCGAGATTCCCAAGATGAAGTATCCATCCTCAGGGAA
CAATTAGCATCTGCAACTACTTCCTCTACTAGCTCTTCACCACCGTTGCCAGAGAATTCGTCAGACAAACATTTG
GCCTTCTCTGAGCAGCAGTTCCCCAATATCTCCTTAGCATCTGAAGATGACCTCCTTCATTCTAGCCTACCAAGC
GAGCTCCAGCTCTCCGAACTTTCTTCTATTAAAGAACCTGCGTTTGCGACTGTAACTACACCGAAGGCCACCGCG
GCGGCCAAAGCCTCCGGTCAAAACTTACTATTGCAGCGCGCAGGGTTTAATCCCAATAGACCCACCGGTCTACCA
TCACCTGTTTCAGGCATAACCCGCTCAACTACTCTGCCATCCTTGTCGATGGCCCGGAACCCAATTGCCCGTGCT
CCGACCATCCAAGCTTCTTCCTCAGCCTCAAGCACCGCAAGGAACAAAGGGGTACAAATGGTCTCGGAAATGCGA
GCAAAGGTTCGCAATCTCGAGCAGAAGATACATACGCGGGTTCCAAGGATCAGAATGGGCAGCATCACGGGCAGA
GCCAATGCGGCAACTTCACCGATCAACGCGTTGGGGAGCTCTTCTTCTTCTTCATCCGGCTCTCTGGCATCTACG
GCCAAAACGAGTCTCGATAGCATCCGAAGAAGCATAGACTCCCGCAAGAGCCACGAGAAAAATGGAGCGAAGGAT
ACTGGCGATTCATCGGGATGGGTACTCATTATGGAAGACTCACCTTCTCCCCAAAAGCAGCGGGAAAGGGAACGT
CAAAAAGAGAGGCGGCGAGTCTCAAGTCCCAGTGGTCCGAGCGTCTATCGCTCCGGAATTACAGCTCCTTCGCCA
ACTTTTAATAAATCTTCAGGCATAGGTGTCCGTCGGCCAGCCTCGCGCCTTTCTGGGGCAAGTTTGAGCACGGCA
ACAACTGGCAGTTCTTTGCCCACTCCCACTTCTCGTCCAAGTACCCCTACATTTCTTCCGCTACCTTCATCAACA
ATGTCACCCGGTGCCGCAATGAAGCGATCGATGGCAGGAGTTCATCCAGTTGCAGGAAATGCAAAGCGAACGTCA
CTGGGTACGACTTCGAATGGTTCCTTTGCGGAATCGTTCCGTGATAGATCATCGACTATCTCCTCGCCACGACCC
GGGCCAAGCACTCCCTCTTCAATTAATCCCTCAAGGTCATATAAGTATGACGAAATGAAGTCTTTACCATATTTG
CCTACCCAATTTAATCCCACTTCGAGCGTCACATCTCCTCGACAGAGCAGGTTGCCATCAAGCGCTAATGGCGCC
CTCTCGAAGAGTCGGATTGGACGACCGGCTGGCACGGGACCGAGGAGAAGTGGGGGTACCGTGAGTGATTCAGGA
GAAGCGCTTGATATCAAAGACTTGCGTCCAAGGTACGCGAGCTGA
Gene >AgabiH97|007590
ATGACCGCTGTCTTTTCCCCGACAGATGCCCTTCGTCATGACAGGCATCTGTCCCGGGATGATTCCCAGTTCGAG
TCTGTACTCCTCTCTCCTCGTGCCGCAGTCATTGACCCCAGTATCGCAGCTACTCCTCAGCCACAACTGACTGGC
GGGCCAAGTATCATGAAGTGCGGCCCGTCTCTCCCATCCCTAGTCCCACTCGCTCATCTCGCCCTAGGTTGTTGA
TATGCTGGCTGAAACTAGGAACGAACTAGAAGAATTCCAGGCTACGAGTAAGGAGCTTGAAGCAGAGCTCGAGGC
AGATCTCCTCCGCTCCGACAAGCAGGAAAAGGAACTCAAAGCCAAGGCGGAAAAGGCAGAGTCGGAACGAGACGA
GTGGAAGGTGAGTCTCCCTGTGCTGCCCAATCCCCAGCATGCACATTCTCTCCAACAGAGCAAGTACATGTCCCT
TCAAACAACCCACAATTCCACCACTACTTCCCTTCAACGAGAGCTCGACCAGCTGCGGCAGGAACACCAGCGAAT
CAAAGTCGAACTCAGAGACCTCGAGCTCGGGGCAGACGATCTAGAACGAAGCAAACGAGCCACTTCGTCCAGTCT
CGTCGATATGGAGGCAAAGTATACTAAAACACTCGAGGAGAAAATCATTCTTGAACACGAGCTATTGGAGAAAGC
CAGTTTGGAAGAAGAGATGCAAAGAGTTAGAGATGAACTGCGAGGTACTCTCGCGAGACTTTTTCCTCCTCTCTT
TTCTAATATTCCTTTACTGTAGATTCCCAAGATGAAGTATCCATCCTCAGGGAACAATTAGCATCTGCAACTACT
TCCTCTACTAGCTCTTCACCACCGTTGCCAGAGAATTCGTCAGACAAACATTTGGCCTTCTCTGAGCAGCAGTTC
CCCAATATCTCCTTAGCATCTGAAGATGACCTCCTTCATTCTAGCCTACCAAGCGAGCTCCAGCTCTCCGAACTT
TCTTCTATTAAAGAACCTGCGTTTGCGACTGTAACTACACCGAAGGCCACCGCGGCGGCCAAAGCCTCCGGTCAA
AACTTACTATTGCAGCGCGCAGGGTTTAATCCCAATAGACCCACCGGTCTACCATCACCTGTTTCAGGCATAACC
CGCTCAACTACTCTGCCATCCTTGTCGATGGCCCGGAACCCAATTGCCCGTGCTCCGACCATCCAAGCTTCTTCC
TCAGCCTCAAGCACCGCAAGGAACAAAGGGGTACAAATGGTCTCGGAAATGCGAGCAAAGGTTCGCAATCTCGAG
CAGAAGATACATACGCGGGTTCCAAGGATCAGAATGGGCAGCATCACGGGCAGAGCCAATGCGGCAACTTCACCG
ATCAACGCGTTGGGGAGCTCTTCTTCTTCTTCATCCGGCTCTCTGGCATCTACGGCCAAAACGAGTCTCGATAGC
ATCCGAAGAAGCATAGACTCCCGCAAGAGCCACGAGAAAAATGGAGCGAAGGATACTGGCGATTCATCGGGATGG
GTACTCATTATGGAAGACTCACCTTCTCCCCAAAAGCAGCGGGAAAGGGAACGTCAAAAAGAGAGGCGGCGAGTC
TCAAGTCCCAGTGGTCCGAGCGTCTATCGCTCCGGAATTACAGCTCCTTCGCCAACTTTTAATAAATCTTCAGGC
ATAGGTGTCCGTCGGCCAGCCTCGCGCCTTTCTGGGGCAAGTTTGAGCACGGCAACAACTGGCAGTTCTTTGCCC
ACTCCCACTTCTCGTCCAAGTACCCCTACATTTCTTCCGCTACCTTCATCAACAATGTCACCCGGTGCCGCAATG
AAGCGATCGATGGCAGGAGTTCATCCAGTTGCAGGAAATGCAAAGCGAACGTCACTGGGTACGACTTCGAATGGT
TCCTTTGCGGAATCGTTCCGTGATAGATCATCGACTATCTCCTCGCCACGACCCGGGCCAAGCACTCCCTCTTCA
ATTAATCCCTCAAGGTCATATAAGTATGACGAAATGAAGTCTTTACCATATTTGCCTACCCAATTTAATCCCACT
TCGAGCGTCACATCTCCTCGACAGAGCAGGTTGCCATCAAGCGCTAATGGCGCCCTCTCGAAGAGTCGGATTGGA
CGACCGGCTGGCACGGGACCGAGGAGAAGTGGGGGTACCGTGAGTGATTCAGGAGAAGCGCTTGATATCAAAGAC
TTGCGTCCAAGGTACGCGAGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail