© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|007440 |
| Gene name | |
| Location | scaffold_1:1766127..1767079 |
| Strand | - |
| Gene length (bp) | 952 |
| Transcript length (bp) | 588 |
| Coding sequence length (bp) | 588 |
| Protein length (aa) | 196 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00071 | Ras | Ras family | 5.1E-54 | 5 | 177 |
| PF08477 | Roc | Ras of Complex, Roc, domain of DAPkinase | 7.8E-21 | 5 | 118 |
| PF00025 | Arf | ADP-ribosylation factor family | 1.5E-06 | 2 | 170 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q6RUV5|RAC1_RAT | Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 | 1 | 194 | 1.0E-113 |
| sp|P63001|RAC1_MOUSE | Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 | 1 | 194 | 1.0E-113 |
| sp|P63000|RAC1_HUMAN | Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1 | 1 | 194 | 1.0E-113 |
| sp|P62999|RAC1_CANLF | Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris GN=RAC1 PE=2 SV=1 | 1 | 194 | 1.0E-113 |
| sp|P62998|RAC1_BOVIN | Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1 | 1 | 194 | 1.0E-113 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q6RUV5|RAC1_RAT | Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus GN=Rac1 PE=1 SV=1 | 1 | 194 | 1.0E-113 |
| sp|P63001|RAC1_MOUSE | Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus GN=Rac1 PE=1 SV=1 | 1 | 194 | 1.0E-113 |
| sp|P63000|RAC1_HUMAN | Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens GN=RAC1 PE=1 SV=1 | 1 | 194 | 1.0E-113 |
| sp|P62999|RAC1_CANLF | Ras-related C3 botulinum toxin substrate 1 OS=Canis lupus familiaris GN=RAC1 PE=2 SV=1 | 1 | 194 | 1.0E-113 |
| sp|P62998|RAC1_BOVIN | Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus GN=RAC1 PE=1 SV=1 | 1 | 194 | 1.0E-113 |
| sp|P40792|RAC1_DROME | Ras-related protein Rac1 OS=Drosophila melanogaster GN=Rac1 PE=1 SV=2 | 1 | 186 | 3.0E-113 |
| sp|P60764|RAC3_MOUSE | Ras-related C3 botulinum toxin substrate 3 OS=Mus musculus GN=Rac3 PE=1 SV=1 | 1 | 177 | 8.0E-112 |
| sp|P60763|RAC3_HUMAN | Ras-related C3 botulinum toxin substrate 3 OS=Homo sapiens GN=RAC3 PE=1 SV=1 | 1 | 177 | 8.0E-112 |
| sp|P15153|RAC2_HUMAN | Ras-related C3 botulinum toxin substrate 2 OS=Homo sapiens GN=RAC2 PE=1 SV=1 | 1 | 186 | 1.0E-111 |
| sp|Q9TU25|RAC2_BOVIN | Ras-related C3 botulinum toxin substrate 2 OS=Bos taurus GN=RAC2 PE=2 SV=1 | 1 | 194 | 3.0E-111 |
| sp|Q05144|RAC2_MOUSE | Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus GN=Rac2 PE=1 SV=1 | 1 | 186 | 8.0E-111 |
| sp|P48554|RAC2_DROME | Ras-related protein Rac2 OS=Drosophila melanogaster GN=Rac2 PE=1 SV=1 | 1 | 179 | 1.0E-110 |
| sp|O88931|RAC2_CAVPO | Ras-related C3 botulinum toxin substrate 2 OS=Cavia porcellus GN=RAC2 PE=2 SV=2 | 1 | 192 | 1.0E-109 |
| sp|P34144|RAC1A_DICDI | Rho-related protein rac1A OS=Dictyostelium discoideum GN=rac1A PE=1 SV=2 | 1 | 194 | 2.0E-108 |
| sp|Q03206|RAC1_CAEEL | Ras-related protein ced-10 OS=Caenorhabditis elegans GN=ced-10 PE=1 SV=2 | 1 | 194 | 6.0E-108 |
| sp|P34145|RAC1B_DICDI | Rho-related protein rac1B OS=Dictyostelium discoideum GN=rac1B PE=1 SV=2 | 1 | 194 | 1.0E-107 |
| sp|P34146|RAC1C_DICDI | Rho-related protein rac1C OS=Dictyostelium discoideum GN=rac1C PE=1 SV=2 | 1 | 194 | 1.0E-105 |
| sp|Q24814|RACA_ENTHI | Rho-related protein racA OS=Entamoeba histolytica GN=RACA PE=3 SV=1 | 1 | 194 | 1.0E-100 |
| sp|Q94124|RAC2_CAEEL | Ras-related protein rac-2 OS=Caenorhabditis elegans GN=rac-2 PE=3 SV=1 | 1 | 194 | 5.0E-99 |
| sp|P34148|RACB_DICDI | Rho-related protein racB OS=Dictyostelium discoideum GN=racB PE=1 SV=1 | 1 | 194 | 4.0E-98 |
| sp|Q16YG0|CDC42_AEDAE | Cdc42 homolog OS=Aedes aegypti GN=Cdc42 PE=3 SV=1 | 1 | 189 | 5.0E-95 |
| sp|P40793|CDC42_DROME | Cdc42 homolog OS=Drosophila melanogaster GN=Cdc42 PE=1 SV=1 | 1 | 189 | 3.0E-94 |
| sp|Q29HY3|CDC42_DROPS | Cdc42 homolog OS=Drosophila pseudoobscura pseudoobscura GN=Cdc42 PE=3 SV=1 | 1 | 189 | 6.0E-94 |
| sp|Q17031|CDC42_ANOGA | Cdc42 homolog OS=Anopheles gambiae GN=Cdc42 PE=2 SV=2 | 1 | 186 | 7.0E-94 |
| sp|Q8CFN2|CDC42_RAT | Cell division control protein 42 homolog OS=Rattus norvegicus GN=Cdc42 PE=1 SV=2 | 1 | 186 | 3.0E-93 |
| sp|Q007T2|CDC42_PIG | Cell division control protein 42 homolog OS=Sus scrofa GN=CDC42 PE=2 SV=2 | 1 | 186 | 3.0E-93 |
| sp|P60766|CDC42_MOUSE | Cell division control protein 42 homolog OS=Mus musculus GN=Cdc42 PE=1 SV=2 | 1 | 186 | 3.0E-93 |
| sp|P60953|CDC42_HUMAN | Cell division control protein 42 homolog OS=Homo sapiens GN=CDC42 PE=1 SV=2 | 1 | 186 | 3.0E-93 |
| sp|P60952|CDC42_CANLF | Cell division control protein 42 homolog OS=Canis lupus familiaris GN=CDC42 PE=2 SV=2 | 1 | 186 | 3.0E-93 |
| sp|Q2KJ93|CDC42_BOVIN | Cell division control protein 42 homolog OS=Bos taurus GN=CDC42 PE=1 SV=1 | 1 | 186 | 3.0E-93 |
| sp|Q90694|CDC42_CHICK | Cell division control protein 42 homolog OS=Gallus gallus GN=CDC42 PE=2 SV=1 | 1 | 186 | 3.0E-93 |
| sp|Q4R4R6|CDC42_MACFA | Cell division control protein 42 homolog OS=Macaca fascicularis GN=CDC42 PE=2 SV=1 | 1 | 186 | 1.0E-92 |
| sp|P84096|RHOG_MOUSE | Rho-related GTP-binding protein RhoG OS=Mus musculus GN=Rhog PE=1 SV=1 | 1 | 187 | 4.0E-92 |
| sp|P84095|RHOG_HUMAN | Rho-related GTP-binding protein RhoG OS=Homo sapiens GN=RHOG PE=1 SV=1 | 1 | 187 | 4.0E-92 |
| sp|P84097|RHOG_CRICR | Rho-related GTP-binding protein RhoG OS=Cricetus cricetus GN=RHOG PE=2 SV=1 | 1 | 187 | 4.0E-92 |
| sp|Q05062|CDC42_CAEEL | Cell division control protein 42 homolog OS=Caenorhabditis elegans GN=cdc-42 PE=1 SV=2 | 1 | 194 | 1.0E-90 |
| sp|Q9HF56|CDC42_ASHGO | Cell division control protein 42 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CDC42 PE=3 SV=1 | 1 | 179 | 5.0E-90 |
| sp|P19073|CDC42_YEAST | Cell division control protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC42 PE=1 SV=2 | 1 | 179 | 5.0E-90 |
| sp|Q01112|CDC42_SCHPO | Cell division control protein 42 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc42 PE=1 SV=1 | 1 | 194 | 9.0E-89 |
| sp|C4YDI6|CDC42_CANAW | Cell division control protein 42 homolog OS=Candida albicans (strain WO-1) GN=CDC42 PE=3 SV=1 | 1 | 179 | 9.0E-88 |
| sp|P0CY33|CDC42_CANAL | Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC42 PE=3 SV=1 | 1 | 179 | 9.0E-88 |
| sp|Q9GPS3|RACF2_DICDI | Rho-related protein racF2 OS=Dictyostelium discoideum GN=racF2 PE=3 SV=1 | 1 | 177 | 4.0E-87 |
| sp|O96390|RACF1_DICDI | Rho-related protein racF1 OS=Dictyostelium discoideum GN=racF1 PE=1 SV=1 | 1 | 180 | 1.0E-86 |
| sp|O76321|RECG_ENTHI | Rho-related protein racG OS=Entamoeba histolytica GN=RACG PE=3 SV=1 | 1 | 177 | 6.0E-85 |
| sp|Q24815|RACB_ENTHI | Rho-related protein racB (Fragment) OS=Entamoeba histolytica GN=RACB PE=3 SV=1 | 10 | 172 | 1.0E-82 |
| sp|P17081|RHOQ_HUMAN | Rho-related GTP-binding protein RhoQ OS=Homo sapiens GN=RHOQ PE=1 SV=2 | 4 | 194 | 8.0E-81 |
| sp|Q9JJL4|RHOQ_RAT | Rho-related GTP-binding protein RhoQ OS=Rattus norvegicus GN=Rhoq PE=2 SV=1 | 4 | 194 | 1.0E-80 |
| sp|Q8R527|RHOQ_MOUSE | Rho-related GTP-binding protein RhoQ OS=Mus musculus GN=Rhoq PE=1 SV=2 | 4 | 194 | 1.0E-80 |
| sp|Q6Z7L8|RAC7_ORYSJ | Rac-like GTP-binding protein 7 OS=Oryza sativa subsp. japonica GN=RAC7 PE=2 SV=1 | 4 | 190 | 2.0E-80 |
| sp|Q38912|RAC3_ARATH | Rac-like GTP-binding protein ARAC3 OS=Arabidopsis thaliana GN=ARAC3 PE=1 SV=1 | 4 | 179 | 4.0E-77 |
| sp|P34147|RACA_DICDI | Rho-related protein racA OS=Dictyostelium discoideum GN=racA PE=1 SV=2 | 1 | 188 | 2.0E-76 |
| sp|Q38903|RAC2_ARATH | Rac-like GTP-binding protein ARAC2 OS=Arabidopsis thaliana GN=ARAC2 PE=1 SV=1 | 4 | 177 | 2.0E-76 |
| sp|Q9H4E5|RHOJ_HUMAN | Rho-related GTP-binding protein RhoJ OS=Homo sapiens GN=RHOJ PE=1 SV=1 | 2 | 194 | 8.0E-76 |
| sp|Q9ER71|RHOJ_MOUSE | Rho-related GTP-binding protein RhoJ OS=Mus musculus GN=Rhoj PE=1 SV=2 | 4 | 179 | 2.0E-75 |
| sp|Q40220|RAC2_LOTJA | Rac-like GTP-binding protein RAC2 OS=Lotus japonicus GN=RAC2 PE=2 SV=1 | 4 | 177 | 2.0E-75 |
| sp|Q6Z808|RAC3_ORYSJ | Rac-like GTP-binding protein 3 OS=Oryza sativa subsp. japonica GN=RAC3 PE=2 SV=1 | 4 | 186 | 3.0E-75 |
| sp|Q6EP31|RAC5_ORYSJ | Rac-like GTP-binding protein 5 OS=Oryza sativa subsp. japonica GN=RAC5 PE=2 SV=2 | 4 | 177 | 3.0E-75 |
| sp|P92978|RAC11_ARATH | Rac-like GTP-binding protein ARAC11 OS=Arabidopsis thaliana GN=ARAC11 PE=1 SV=2 | 4 | 177 | 1.0E-74 |
| sp|Q67VP4|RAC4_ORYSJ | Rac-like GTP-binding protein 4 OS=Oryza sativa subsp. japonica GN=RAC4 PE=2 SV=1 | 4 | 179 | 1.0E-74 |
| sp|Q24817|RACD_ENTHI | Rho-related protein racD (Fragment) OS=Entamoeba histolytica GN=RACD PE=2 SV=1 | 2 | 180 | 2.0E-74 |
| sp|Q41254|RAC9_GOSHI | Rac-like GTP-binding protein RAC9 OS=Gossypium hirsutum GN=RAC9 PE=2 SV=1 | 4 | 177 | 2.0E-74 |
| sp|Q41253|RAC13_GOSHI | Rac-like GTP-binding protein RAC13 OS=Gossypium hirsutum GN=RAC13 PE=2 SV=1 | 4 | 177 | 2.0E-74 |
| sp|Q9XGU0|RAC9_ARATH | Rac-like GTP-binding protein ARAC9 OS=Arabidopsis thaliana GN=ARAC9 PE=1 SV=1 | 4 | 190 | 4.0E-74 |
| sp|Q38902|RAC1_ARATH | Rac-like GTP-binding protein ARAC1 OS=Arabidopsis thaliana GN=ARAC1 PE=1 SV=1 | 4 | 177 | 5.0E-74 |
| sp|Q6ZHA3|RAC6_ORYSJ | Rac-like GTP-binding protein 6 OS=Oryza sativa subsp. japonica GN=RAC6 PE=2 SV=1 | 4 | 177 | 8.0E-74 |
| sp|Q39435|RAC1_BETVU | Rac-like GTP-binding protein RHO1 OS=Beta vulgaris GN=RHO1 PE=2 SV=1 | 4 | 177 | 9.0E-74 |
| sp|P34149|RACC_DICDI | Rho-related protein racC OS=Dictyostelium discoideum GN=racC PE=1 SV=1 | 2 | 177 | 1.0E-73 |
| sp|Q38919|RAC4_ARATH | Rac-like GTP-binding protein ARAC4 OS=Arabidopsis thaliana GN=ARAC4 PE=1 SV=1 | 4 | 177 | 2.0E-73 |
| sp|O04369|RAC1_LOTJA | Rac-like GTP-binding protein RAC1 OS=Lotus japonicus GN=RAC1 PE=2 SV=1 | 4 | 177 | 2.0E-73 |
| sp|Q9SBJ6|RAC6_ARATH | Rac-like GTP-binding protein ARAC6 OS=Arabidopsis thaliana GN=ARAC6 PE=1 SV=2 | 4 | 177 | 4.0E-73 |
| sp|Q38937|RAC5_ARATH | Rac-like GTP-binding protein ARAC5 OS=Arabidopsis thaliana GN=ARAC5 PE=1 SV=1 | 4 | 177 | 4.0E-73 |
| sp|Q35638|RHO1_PEA | Rac-like GTP-binding protein RHO1 OS=Pisum sativum GN=RHO1 PE=2 SV=1 | 4 | 177 | 1.0E-72 |
| sp|O82481|RAC10_ARATH | Rac-like GTP-binding protein ARAC10 OS=Arabidopsis thaliana GN=ARAC10 PE=1 SV=1 | 4 | 179 | 2.0E-72 |
| sp|Q9SU67|RAC8_ARATH | Rac-like GTP-binding protein ARAC8 OS=Arabidopsis thaliana GN=ARAC8 PE=1 SV=2 | 4 | 179 | 2.0E-72 |
| sp|Q24816|RACC_ENTHI | Rho-related protein racC OS=Entamoeba histolytica GN=RACC PE=1 SV=1 | 3 | 186 | 4.0E-72 |
| sp|Q9SSX0|RAC1_ORYSJ | Rac-like GTP-binding protein 1 OS=Oryza sativa subsp. japonica GN=RAC1 PE=1 SV=1 | 4 | 191 | 2.0E-71 |
| sp|O82480|RAC7_ARATH | Rac-like GTP-binding protein ARAC7 OS=Arabidopsis thaliana GN=ARAC7 PE=1 SV=1 | 4 | 185 | 2.0E-70 |
| sp|Q68Y52|RAC2_ORYSJ | Rac-like GTP-binding protein 2 OS=Oryza sativa subsp. japonica GN=RAC2 PE=2 SV=1 | 4 | 179 | 2.0E-69 |
| sp|Q22038|RHO1_CAEEL | Ras-like GTP-binding protein rhoA OS=Caenorhabditis elegans GN=rho-1 PE=1 SV=1 | 5 | 178 | 2.0E-68 |
| sp|O94103|CDC42_COLGL | Cell division control protein 42 homolog OS=Colletotrichum gloeosporioides GN=CDC42 PE=3 SV=1 | 4 | 185 | 5.0E-68 |
| sp|Q6NUX8|RHOAA_DANRE | Rho-related GTP-binding protein RhoA-A OS=Danio rerio GN=rhoaa PE=1 SV=1 | 1 | 194 | 2.0E-67 |
| sp|P48148|RHO1_DROME | Ras-like GTP-binding protein Rho1 OS=Drosophila melanogaster GN=Rho1 PE=1 SV=1 | 5 | 186 | 5.0E-67 |
| sp|P24406|RHOA_CANLF | Transforming protein RhoA OS=Canis lupus familiaris GN=RHOA PE=2 SV=1 | 1 | 187 | 7.0E-67 |
| sp|Q9GPR7|RACH_DICDI | Rho-related protein racH OS=Dictyostelium discoideum GN=racH PE=3 SV=1 | 1 | 186 | 7.0E-67 |
| sp|P61589|RHOA_RAT | Transforming protein RhoA OS=Rattus norvegicus GN=Rhoa PE=1 SV=1 | 1 | 194 | 1.0E-66 |
| sp|Q9QUI0|RHOA_MOUSE | Transforming protein RhoA OS=Mus musculus GN=Rhoa PE=1 SV=1 | 1 | 194 | 1.0E-66 |
| sp|Q5REY6|RHOA_PONAB | Transforming protein RhoA OS=Pongo abelii GN=RHOA PE=2 SV=2 | 1 | 187 | 1.0E-66 |
| sp|P61586|RHOA_HUMAN | Transforming protein RhoA OS=Homo sapiens GN=RHOA PE=1 SV=1 | 1 | 187 | 1.0E-66 |
| sp|P61585|RHOA_BOVIN | Transforming protein RhoA OS=Bos taurus GN=RHOA PE=1 SV=1 | 1 | 187 | 1.0E-66 |
| sp|Q5RCK9|RHOC_PONAB | Rho-related GTP-binding protein RhoC OS=Pongo abelii GN=RHOC PE=2 SV=1 | 1 | 187 | 1.0E-66 |
| sp|Q62159|RHOC_MOUSE | Rho-related GTP-binding protein RhoC OS=Mus musculus GN=Rhoc PE=1 SV=2 | 1 | 187 | 1.0E-66 |
| sp|P08134|RHOC_HUMAN | Rho-related GTP-binding protein RhoC OS=Homo sapiens GN=RHOC PE=1 SV=1 | 1 | 187 | 1.0E-66 |
| sp|Q1RMJ6|RHOC_BOVIN | Rho-related GTP-binding protein RhoC OS=Bos taurus GN=RHOC PE=2 SV=1 | 1 | 187 | 1.0E-66 |
| sp|Q9PSX7|RHOC_CHICK | Rho-related GTP-binding protein RhoC OS=Gallus gallus GN=RHOC PE=1 SV=1 | 1 | 187 | 1.0E-66 |
| sp|P01122|RHO_APLCA | Ras-like GTP-binding protein RHO OS=Aplysia californica GN=RHO PE=2 SV=1 | 1 | 178 | 2.0E-66 |
| sp|Q7T2E8|RHOAC_DANRE | Rho-related GTP-binding protein RhoA-C OS=Danio rerio GN=rhoac PE=1 SV=1 | 1 | 194 | 3.0E-66 |
| sp|Q6DHM9|RHOAB_DANRE | Rho-related GTP-binding protein RhoA-B OS=Danio rerio GN=rhoab PE=1 SV=1 | 1 | 194 | 1.0E-65 |
| sp|O42825|RHO1_CANAL | GTP-binding protein RHO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RHO1 PE=3 SV=1 | 5 | 177 | 1.0E-65 |
| sp|Q9EQT3|RHOU_MOUSE | Rho-related GTP-binding protein RhoU OS=Mus musculus GN=Rhou PE=2 SV=1 | 4 | 175 | 1.0E-65 |
| sp|Q09914|RHO1_SCHPO | GTP-binding protein rho1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho1 PE=2 SV=1 | 5 | 194 | 2.0E-65 |
| sp|Q7L0Q8|RHOU_HUMAN | Rho-related GTP-binding protein RhoU OS=Homo sapiens GN=RHOU PE=1 SV=1 | 4 | 175 | 2.0E-65 |
| sp|Q9C3Y4|RHOA_EMENI | GTP-binding protein rhoA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoA PE=3 SV=1 | 5 | 194 | 6.0E-65 |
| sp|Q6DHE8|RHOAD_DANRE | Rho-related GTP-binding protein RhoA-D OS=Danio rerio GN=rhoad PE=1 SV=1 | 1 | 187 | 1.0E-64 |
| sp|P62747|RHOB_RAT | Rho-related GTP-binding protein RhoB OS=Rattus norvegicus GN=Rhob PE=1 SV=1 | 1 | 193 | 1.0E-64 |
| sp|P62746|RHOB_MOUSE | Rho-related GTP-binding protein RhoB OS=Mus musculus GN=Rhob PE=1 SV=1 | 1 | 193 | 1.0E-64 |
| sp|P62745|RHOB_HUMAN | Rho-related GTP-binding protein RhoB OS=Homo sapiens GN=RHOB PE=1 SV=1 | 1 | 193 | 1.0E-64 |
| sp|Q3ZBW5|RHOB_BOVIN | Rho-related GTP-binding protein RhoB OS=Bos taurus GN=RHOB PE=2 SV=1 | 1 | 193 | 1.0E-64 |
| sp|Q9HE04|RHO5_SCHPO | GTP-binding protein rho5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho5 PE=3 SV=1 | 5 | 194 | 2.0E-64 |
| sp|Q9GPS0|RACG_DICDI | Rho-related protein racG OS=Dictyostelium discoideum GN=racG PE=3 SV=1 | 1 | 175 | 3.0E-64 |
| sp|P06780|RHO1_YEAST | GTP-binding protein RHO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO1 PE=1 SV=3 | 5 | 177 | 8.0E-64 |
| sp|A5D7J5|RHOU_BOVIN | Rho-related GTP-binding protein RhoU OS=Bos taurus GN=RHOU PE=2 SV=1 | 2 | 175 | 1.0E-63 |
| sp|Q8J212|RHO1_KLULA | GTP-binding protein Rho1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RHO1 PE=3 SV=1 | 5 | 177 | 1.0E-63 |
| sp|Q9GPQ8|RACL_DICDI | Rho-related protein racL OS=Dictyostelium discoideum GN=racL PE=3 SV=1 | 1 | 194 | 2.0E-63 |
| sp|Q9HF54|RHO1_ASHGO | GTP-binding protein RHO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO1 PE=3 SV=1 | 5 | 177 | 6.0E-63 |
| sp|P97348|RHOD_MOUSE | Rho-related GTP-binding protein RhoD OS=Mus musculus GN=Rhod PE=1 SV=1 | 2 | 195 | 9.0E-63 |
| sp|Q8VDU1|RHOV_MOUSE | Rho-related GTP-binding protein RhoV OS=Mus musculus GN=Rhov PE=2 SV=1 | 3 | 191 | 1.0E-61 |
| sp|Q96L33|RHOV_HUMAN | Rho-related GTP-binding protein RhoV OS=Homo sapiens GN=RHOV PE=1 SV=1 | 3 | 191 | 1.0E-61 |
| sp|Q9Z1Y0|RHOV_RAT | Rho-related GTP-binding protein RhoV OS=Rattus norvegicus GN=Rhov PE=1 SV=1 | 3 | 191 | 2.0E-61 |
| sp|Q23862|RACE_DICDI | Rho-related protein racE OS=Dictyostelium discoideum GN=racE PE=1 SV=1 | 4 | 185 | 3.0E-61 |
| sp|Q17QI8|RHOV_BOVIN | Rho-related GTP-binding protein RhoV OS=Bos taurus GN=Rhov PE=2 SV=1 | 3 | 191 | 5.0E-61 |
| sp|Q24192|RHOL_DROME | Ras-like GTP-binding protein RhoL OS=Drosophila melanogaster GN=RhoL PE=2 SV=1 | 4 | 176 | 6.0E-61 |
| sp|P22122|RHO_DIPOM | Ras-like GTP-binding protein O-RHO OS=Diplobatis ommata PE=2 SV=1 | 1 | 178 | 3.0E-60 |
| sp|Q9HBH0|RHOF_HUMAN | Rho-related GTP-binding protein RhoF OS=Homo sapiens GN=RHOF PE=1 SV=1 | 2 | 194 | 6.0E-60 |
| sp|Q3SZA1|RHOF_BOVIN | Rho-related GTP-binding protein RhoF OS=Bos taurus GN=RHOF PE=2 SV=1 | 2 | 194 | 1.0E-59 |
| sp|P34150|RACD_DICDI | Rho-related protein racD OS=Dictyostelium discoideum GN=racD PE=2 SV=3 | 17 | 165 | 4.0E-59 |
| sp|Q10133|RHO2_SCHPO | GTP-binding protein rho2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho2 PE=1 SV=1 | 5 | 195 | 1.0E-58 |
| sp|Q8BYP3|RHOF_MOUSE | Rho-related GTP-binding protein RhoF OS=Mus musculus GN=Rhof PE=1 SV=1 | 2 | 194 | 8.0E-58 |
| sp|P53879|RHO5_YEAST | GTP-binding protein RHO5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO5 PE=1 SV=2 | 1 | 191 | 1.0E-57 |
| sp|O00212|RHOD_HUMAN | Rho-related GTP-binding protein RhoD OS=Homo sapiens GN=RHOD PE=1 SV=2 | 1 | 194 | 2.0E-57 |
| sp|Q96WY0|RHOC_EMENI | GTP-binding protein rhoC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rhoC PE=3 SV=2 | 5 | 178 | 2.0E-56 |
| sp|Q874R1|RHO4_SCHPO | GTP-binding protein rho4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho4 PE=1 SV=2 | 5 | 173 | 6.0E-56 |
| sp|Q6SA80|RND3_RAT | Rho-related GTP-binding protein RhoE OS=Rattus norvegicus GN=Rnd3 PE=2 SV=1 | 2 | 187 | 1.0E-52 |
| sp|P61588|RND3_MOUSE | Rho-related GTP-binding protein RhoE OS=Mus musculus GN=Rnd3 PE=1 SV=1 | 2 | 187 | 1.0E-52 |
| sp|P61587|RND3_HUMAN | Rho-related GTP-binding protein RhoE OS=Homo sapiens GN=RND3 PE=1 SV=1 | 2 | 187 | 1.0E-52 |
| sp|Q5R9F4|RND3_PONAB | Rho-related GTP-binding protein RhoE OS=Pongo abelii GN=RND3 PE=2 SV=1 | 2 | 187 | 1.0E-52 |
| sp|O13928|RHO3_SCHPO | GTP-binding protein rho3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rho3 PE=1 SV=2 | 5 | 195 | 1.0E-52 |
| sp|O77683|RND3_PIG | Rho-related GTP-binding protein RhoE OS=Sus scrofa GN=RND3 PE=2 SV=1 | 2 | 187 | 3.0E-52 |
| sp|Q9GPR2|RACI_DICDI | Rho-related protein racI OS=Dictyostelium discoideum GN=racI PE=3 SV=1 | 4 | 177 | 3.0E-51 |
| sp|Q00245|RHO3_YEAST | GTP-binding protein RHO3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO3 PE=1 SV=2 | 5 | 181 | 1.0E-50 |
| sp|P33153|CRL1_CANAW | GTP-binding RHO-like protein OS=Candida albicans (strain WO-1) GN=CRL1 PE=3 SV=2 | 4 | 173 | 1.0E-49 |
| sp|P06781|RHO2_YEAST | GTP-binding protein RHO2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO2 PE=1 SV=2 | 5 | 194 | 5.0E-49 |
| sp|Q9HF51|RHO3_ASHGO | GTP-binding protein RHO3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO3 PE=3 SV=1 | 5 | 181 | 5.0E-48 |
| sp|Q00246|RHO4_YEAST | GTP-binding protein RHO4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RHO4 PE=1 SV=2 | 4 | 178 | 1.0E-47 |
| sp|Q9D3G9|RHOH_MOUSE | Rho-related GTP-binding protein RhoH OS=Mus musculus GN=Rhoh PE=1 SV=1 | 1 | 186 | 2.0E-47 |
| sp|Q9QYM5|RND2_MOUSE | Rho-related GTP-binding protein RhoN OS=Mus musculus GN=Rnd2 PE=2 SV=1 | 5 | 157 | 3.0E-47 |
| sp|Q15669|RHOH_HUMAN | Rho-related GTP-binding protein RhoH OS=Homo sapiens GN=RHOH PE=1 SV=1 | 1 | 178 | 4.0E-47 |
| sp|P52198|RND2_HUMAN | Rho-related GTP-binding protein RhoN OS=Homo sapiens GN=RND2 PE=1 SV=2 | 5 | 157 | 4.0E-47 |
| sp|Q9P8J9|RHO3_SCHCO | GTP-binding protein Rho3 OS=Schizophyllum commune GN=RHO3 PE=2 SV=1 | 5 | 188 | 4.0E-47 |
| sp|Q2HJG3|RHOH_BOVIN | Rho-related GTP-binding protein RhoH OS=Bos taurus GN=RHOH PE=2 SV=1 | 1 | 178 | 9.0E-47 |
| sp|P31021|RHO1_ENTHI | Ras-like GTP-binding protein RHO1 OS=Entamoeba histolytica GN=RHO1 PE=3 SV=1 | 2 | 181 | 1.0E-44 |
| sp|Q54HZ7|RACM_DICDI | Rho-related protein racM OS=Dictyostelium discoideum GN=racM PE=3 SV=2 | 1 | 174 | 1.0E-44 |
| sp|Q92730|RND1_HUMAN | Rho-related GTP-binding protein Rho6 OS=Homo sapiens GN=RND1 PE=1 SV=1 | 5 | 182 | 2.0E-43 |
| sp|Q2HJ68|RND1_BOVIN | Rho-related GTP-binding protein Rho6 OS=Bos taurus GN=RND1 PE=2 SV=1 | 5 | 178 | 2.0E-43 |
| sp|Q8BLR7|RND1_MOUSE | Rho-related GTP-binding protein Rho6 OS=Mus musculus GN=Rnd1 PE=2 SV=1 | 5 | 183 | 4.0E-43 |
| sp|Q9P8V0|RHO4_ASHGO | GTP-binding protein RHO4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RHO4 PE=3 SV=1 | 4 | 191 | 1.0E-42 |
| sp|Q54YY4|RACN_DICDI | Rho-related protein racN OS=Dictyostelium discoideum GN=racN PE=3 SV=1 | 2 | 170 | 4.0E-42 |
| sp|P80236|RAC1_CAVPO | Ras-related C3 botulinum toxin substrate 1 (Fragment) OS=Cavia porcellus GN=RAC1 PE=1 SV=2 | 96 | 174 | 1.0E-33 |
| sp|Q91V93|RHBT2_MOUSE | Rho-related BTB domain-containing protein 2 OS=Mus musculus GN=Rhobtb2 PE=2 SV=2 | 1 | 177 | 7.0E-32 |
| sp|Q9BYZ6|RHBT2_HUMAN | Rho-related BTB domain-containing protein 2 OS=Homo sapiens GN=RHOBTB2 PE=2 SV=2 | 1 | 177 | 9.0E-32 |
| sp|O94844|RHBT1_HUMAN | Rho-related BTB domain-containing protein 1 OS=Homo sapiens GN=RHOBTB1 PE=2 SV=2 | 1 | 177 | 2.0E-31 |
| sp|Q9DAK3|RHBT1_MOUSE | Rho-related BTB domain-containing protein 1 OS=Mus musculus GN=Rhobtb1 PE=1 SV=2 | 1 | 177 | 3.0E-31 |
| sp|Q54Z85|RACO_DICDI | Rho-related protein racO OS=Dictyostelium discoideum GN=racO PE=3 SV=1 | 2 | 170 | 1.0E-29 |
| sp|Q9GPQ9|RACJ_DICDI | Rho-related protein racJ OS=Dictyostelium discoideum GN=racJ PE=3 SV=1 | 4 | 173 | 4.0E-27 |
| sp|P17609|YPT2_SCHPO | GTP-binding protein ypt2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt2 PE=3 SV=1 | 4 | 169 | 5.0E-24 |
| sp|P32253|RASC_DICDI | Ras-like protein rasC OS=Dictyostelium discoideum GN=rasC PE=2 SV=1 | 4 | 194 | 2.0E-22 |
| sp|Q1RMR4|RAB15_BOVIN | Ras-related protein Rab-15 OS=Bos taurus GN=RAB15 PE=2 SV=1 | 4 | 185 | 3.0E-22 |
| sp|P35289|RAB15_RAT | Ras-related protein Rab-15 OS=Rattus norvegicus GN=Rab15 PE=2 SV=1 | 4 | 192 | 3.0E-22 |
| sp|P59190|RAB15_HUMAN | Ras-related protein Rab-15 OS=Homo sapiens GN=RAB15 PE=1 SV=1 | 4 | 191 | 5.0E-22 |
| sp|P36861|YPTV2_VOLCA | GTP-binding protein yptV2 OS=Volvox carteri GN=YPTV2 PE=3 SV=1 | 4 | 177 | 8.0E-22 |
| sp|O24466|RAE1A_ARATH | Ras-related protein RABE1a OS=Arabidopsis thaliana GN=RABE1A PE=1 SV=1 | 4 | 169 | 1.0E-21 |
| sp|P36860|RALB_RAT | Ras-related protein Ral-B OS=Rattus norvegicus GN=Ralb PE=2 SV=1 | 5 | 189 | 2.0E-21 |
| sp|Q8K386|RAB15_MOUSE | Ras-related protein Rab-15 OS=Mus musculus GN=Rab15 PE=1 SV=1 | 4 | 180 | 3.0E-21 |
| sp|Q94694|RAP1_PHYPO | Ras-related protein Rap-1 OS=Physarum polycephalum GN=RAP1 PE=2 SV=1 | 1 | 194 | 4.0E-21 |
| sp|P22124|RAL_DIPOM | Ras-related protein O-RAL OS=Diplobatis ommata PE=2 SV=1 | 5 | 190 | 4.0E-21 |
| sp|P51151|RAB9A_HUMAN | Ras-related protein Rab-9A OS=Homo sapiens GN=RAB9A PE=1 SV=1 | 4 | 177 | 4.0E-21 |
| sp|P24408|RAB9A_CANLF | Ras-related protein Rab-9A OS=Canis lupus familiaris GN=RAB9A PE=1 SV=2 | 4 | 177 | 5.0E-21 |
| sp|Q9JIW9|RALB_MOUSE | Ras-related protein Ral-B OS=Mus musculus GN=Ralb PE=1 SV=1 | 5 | 189 | 6.0E-21 |
| sp|Q99P75|RAB9A_RAT | Ras-related protein Rab-9A OS=Rattus norvegicus GN=Rab9a PE=1 SV=2 | 4 | 177 | 1.0E-20 |
| sp|Q9R0M6|RAB9A_MOUSE | Ras-related protein Rab-9A OS=Mus musculus GN=Rab9a PE=1 SV=1 | 4 | 177 | 1.0E-20 |
| sp|Q8BHH2|RAB9B_MOUSE | Ras-related protein Rab-9B OS=Mus musculus GN=Rab9b PE=1 SV=1 | 4 | 177 | 1.0E-20 |
| sp|Q39433|RB1BV_BETVU | Ras-related protein RAB1BV OS=Beta vulgaris GN=RAB1BV PE=2 SV=1 | 4 | 169 | 1.0E-20 |
| sp|P28186|RAE1C_ARATH | Ras-related protein RABE1c OS=Arabidopsis thaliana GN=RABE1C PE=1 SV=1 | 4 | 169 | 1.0E-20 |
| sp|Q5R4W9|RAB9B_PONAB | Ras-related protein Rab-9B OS=Pongo abelii GN=RAB9B PE=2 SV=1 | 4 | 177 | 1.0E-20 |
| sp|O42819|SEC4_CANGA | Ras-related protein SEC4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC4 PE=3 SV=1 | 4 | 187 | 2.0E-20 |
| sp|Q6IP71|RALBB_XENLA | Ras-related protein ralB-B OS=Xenopus laevis GN=ralb-b PE=2 SV=1 | 5 | 176 | 2.0E-20 |
| sp|Q9YH09|RALBA_XENLA | Ras-related protein ralB-A OS=Xenopus laevis GN=ralb-a PE=1 SV=1 | 5 | 176 | 3.0E-20 |
| sp|Q9NP90|RAB9B_HUMAN | Ras-related protein Rab-9B OS=Homo sapiens GN=RAB9B PE=1 SV=1 | 4 | 177 | 3.0E-20 |
| sp|Q5F470|RAB8A_CHICK | Ras-related protein Rab-8A OS=Gallus gallus GN=RAB8A PE=2 SV=1 | 4 | 169 | 4.0E-20 |
| sp|F1PTE3|RAB13_CANLF | Ras-related protein Rab-13 OS=Canis lupus familiaris GN=RAB13 PE=1 SV=2 | 4 | 177 | 6.0E-20 |
| sp|P40392|RIC1_ORYSJ | Ras-related protein RIC1 OS=Oryza sativa subsp. japonica GN=RIC1 PE=2 SV=2 | 4 | 169 | 8.0E-20 |
| sp|P70550|RAB8B_RAT | Ras-related protein Rab-8B OS=Rattus norvegicus GN=Rab8b PE=1 SV=1 | 4 | 177 | 9.0E-20 |
| sp|P61028|RAB8B_MOUSE | Ras-related protein Rab-8B OS=Mus musculus GN=Rab8b PE=1 SV=1 | 4 | 177 | 9.0E-20 |
| sp|Q92930|RAB8B_HUMAN | Ras-related protein Rab-8B OS=Homo sapiens GN=RAB8B PE=1 SV=2 | 4 | 177 | 9.0E-20 |
| sp|Q2HJI8|RAB8B_BOVIN | Ras-related protein Rab-8B OS=Bos taurus GN=RAB8B PE=2 SV=1 | 4 | 177 | 1.0E-19 |
| sp|Q5REC9|RAB8B_PONAB | Ras-related protein Rab-8B OS=Pongo abelii GN=RAB8B PE=2 SV=1 | 4 | 177 | 1.0E-19 |
| sp|Q5ZIT5|RAB10_CHICK | Ras-related protein Rab-10 OS=Gallus gallus GN=RAB10 PE=2 SV=1 | 4 | 185 | 1.0E-19 |
| sp|Q55CB8|RASX_DICDI | Ras-like protein rasX OS=Dictyostelium discoideum GN=rasX PE=3 SV=1 | 4 | 188 | 2.0E-19 |
| sp|Q5KTJ6|RAB13_MESAU | Ras-related protein Rab-13 OS=Mesocricetus auratus GN=RAB13 PE=2 SV=1 | 4 | 177 | 2.0E-19 |
| sp|P22127|RAB10_DIPOM | Ras-related protein Rab-10 OS=Diplobatis ommata PE=2 SV=1 | 4 | 185 | 3.0E-19 |
| sp|P22128|RAB8_DIPOM | Ras-related protein Rab-8 OS=Diplobatis ommata PE=2 SV=1 | 4 | 177 | 3.0E-19 |
| sp|Q5R4B8|RALB_PONAB | Ras-related protein Ral-B OS=Pongo abelii GN=RALB PE=2 SV=1 | 5 | 176 | 3.0E-19 |
| sp|P11234|RALB_HUMAN | Ras-related protein Ral-B OS=Homo sapiens GN=RALB PE=1 SV=1 | 5 | 176 | 3.0E-19 |
| sp|Q4R379|RALB_MACFA | Ras-related protein Ral-B OS=Macaca fascicularis GN=RALB PE=2 SV=1 | 5 | 176 | 3.0E-19 |
| sp|Q5R4A3|RAB8A_PONAB | Ras-related protein Rab-8A OS=Pongo abelii GN=RAB8A PE=2 SV=1 | 4 | 169 | 3.0E-19 |
| sp|P34143|RABC_DICDI | Ras-related protein RabC OS=Dictyostelium discoideum GN=rabC PE=2 SV=2 | 5 | 192 | 3.0E-19 |
| sp|P35280|RAB8A_RAT | Ras-related protein Rab-8A OS=Rattus norvegicus GN=Rab8a PE=1 SV=2 | 4 | 169 | 3.0E-19 |
| sp|P55258|RAB8A_MOUSE | Ras-related protein Rab-8A OS=Mus musculus GN=Rab8a PE=1 SV=2 | 4 | 169 | 3.0E-19 |
| sp|A4FV54|RAB8A_BOVIN | Ras-related protein Rab-8A OS=Bos taurus GN=RAB8A PE=2 SV=1 | 4 | 169 | 4.0E-19 |
| sp|Q4R5P1|RAB8A_MACFA | Ras-related protein Rab-8A OS=Macaca fascicularis GN=RAB8A PE=2 SV=1 | 4 | 169 | 4.0E-19 |
| sp|P61006|RAB8A_HUMAN | Ras-related protein Rab-8A OS=Homo sapiens GN=RAB8A PE=1 SV=1 | 4 | 169 | 4.0E-19 |
| sp|P61007|RAB8A_CANLF | Ras-related protein Rab-8A OS=Canis lupus familiaris GN=RAB8A PE=2 SV=1 | 4 | 169 | 4.0E-19 |
| sp|Q55CC0|RASW_DICDI | Ras-like protein rasW OS=Dictyostelium discoideum GN=rasW PE=3 SV=1 | 3 | 190 | 4.0E-19 |
| sp|Q5R5U1|RAB10_PONAB | Ras-related protein Rab-10 OS=Pongo abelii GN=RAB10 PE=2 SV=1 | 4 | 185 | 5.0E-19 |
| sp|P61027|RAB10_MOUSE | Ras-related protein Rab-10 OS=Mus musculus GN=Rab10 PE=1 SV=1 | 4 | 185 | 5.0E-19 |
| sp|P61026|RAB10_HUMAN | Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 | 4 | 185 | 5.0E-19 |
| sp|P24409|RAB10_CANLF | Ras-related protein Rab-10 OS=Canis lupus familiaris GN=RAB10 PE=1 SV=1 | 4 | 185 | 6.0E-19 |
| sp|Q7T3A4|RAB13_DANRE | Ras-related protein Rab-13 OS=Danio rerio GN=rab13 PE=1 SV=1 | 4 | 185 | 6.0E-19 |
| sp|Q58DS5|RAB13_BOVIN | Ras-related protein Rab-13 OS=Bos taurus GN=RAB13 PE=1 SV=1 | 4 | 182 | 7.0E-19 |
| sp|P23175|RASH_MSVNS | GTPase HRas OS=Murine sarcoma virus NS.C58 GN=H-RAS PE=3 SV=1 | 1 | 192 | 7.0E-19 |
| sp|P0CY30|SEC4_CANAX | Ras-related protein SEC4 OS=Candida albicans GN=SEC4 PE=3 SV=1 | 4 | 180 | 7.0E-19 |
| sp|C4YL11|SEC4_CANAW | Ras-related protein SEC4 OS=Candida albicans (strain WO-1) GN=SEC4 PE=3 SV=1 | 4 | 180 | 7.0E-19 |
| sp|P0CY31|SEC4_CANAL | Ras-related protein SEC4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC4 PE=3 SV=1 | 4 | 180 | 7.0E-19 |
| sp|P51153|RAB13_HUMAN | Ras-related protein Rab-13 OS=Homo sapiens GN=RAB13 PE=1 SV=1 | 4 | 190 | 8.0E-19 |
| sp|P32254|RASS_DICDI | Ras-like protein rasS OS=Dictyostelium discoideum GN=rasS PE=2 SV=1 | 1 | 190 | 1.0E-18 |
| sp|Q18246|RAP1_CAEEL | Ras-related protein Rap-1 OS=Caenorhabditis elegans GN=rap-1 PE=3 SV=1 | 1 | 192 | 1.0E-18 |
| sp|Q9SF91|RAE1E_ARATH | Ras-related protein RABE1e OS=Arabidopsis thaliana GN=RABE1E PE=1 SV=1 | 4 | 169 | 1.0E-18 |
| sp|P48555|RALA_DROME | Ras-related protein Ral-a OS=Drosophila melanogaster GN=Rala PE=2 SV=2 | 5 | 176 | 1.0E-18 |
| sp|P01123|YPT1_YEAST | GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT1 PE=1 SV=2 | 4 | 188 | 1.0E-18 |
| sp|Q55FU9|RAB24_DICDI | Ras-related protein Rab-24 OS=Dictyostelium discoideum GN=rab24 PE=3 SV=1 | 4 | 119 | 2.0E-18 |
| sp|Q92928|RAB1C_HUMAN | Putative Ras-related protein Rab-1C OS=Homo sapiens GN=RAB1C PE=5 SV=2 | 4 | 190 | 2.0E-18 |
| sp|P28188|RAD2A_ARATH | Ras-related protein RABD2a OS=Arabidopsis thaliana GN=RABD2A PE=1 SV=3 | 4 | 169 | 2.0E-18 |
| sp|P01113|RASH_MSVMO | GTPase HRas OS=Moloney murine sarcoma virus GN=H-RAS PE=3 SV=1 | 1 | 192 | 2.0E-18 |
| sp|P22279|RAS2_MUCCL | Ras-like protein 2 OS=Mucor circinelloides f. lusitanicus GN=RAS2 PE=2 SV=2 | 1 | 124 | 2.0E-18 |
| sp|P07560|SEC4_YEAST | Ras-related protein SEC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC4 PE=1 SV=1 | 4 | 184 | 3.0E-18 |
| sp|P20790|RAB8A_DICDI | Ras-related protein Rab-8A OS=Dictyostelium discoideum GN=rab8A PE=3 SV=1 | 4 | 169 | 4.0E-18 |
| sp|Q5ZJN2|RB11A_CHICK | Ras-related protein Rab-11A OS=Gallus gallus GN=RAB11A PE=2 SV=1 | 4 | 169 | 4.0E-18 |
| sp|P62494|RB11A_RAT | Ras-related protein Rab-11A OS=Rattus norvegicus GN=Rab11a PE=1 SV=3 | 4 | 169 | 5.0E-18 |
| sp|P62493|RB11A_RABIT | Ras-related protein Rab-11A OS=Oryctolagus cuniculus GN=RAB11A PE=2 SV=3 | 4 | 169 | 5.0E-18 |
| sp|Q5R9M7|RB11A_PONAB | Ras-related protein Rab-11A OS=Pongo abelii GN=RAB11A PE=2 SV=3 | 4 | 169 | 5.0E-18 |
| sp|Q52NJ1|RB11A_PIG | Ras-related protein Rab-11A OS=Sus scrofa GN=RAB11A PE=2 SV=3 | 4 | 169 | 5.0E-18 |
| sp|P62492|RB11A_MOUSE | Ras-related protein Rab-11A OS=Mus musculus GN=Rab11a PE=1 SV=3 | 4 | 169 | 5.0E-18 |
| sp|P62491|RB11A_HUMAN | Ras-related protein Rab-11A OS=Homo sapiens GN=RAB11A PE=1 SV=3 | 4 | 169 | 5.0E-18 |
| sp|P62490|RB11A_CANLF | Ras-related protein Rab-11A OS=Canis lupus familiaris GN=RAB11A PE=2 SV=3 | 4 | 169 | 5.0E-18 |
| sp|Q9DD03|RAB13_MOUSE | Ras-related protein Rab-13 OS=Mus musculus GN=Rab13 PE=1 SV=1 | 4 | 177 | 5.0E-18 |
| sp|Q9CB01|RABF1_ARATH | Ras-related protein RABF1 OS=Arabidopsis thaliana GN=RABF1 PE=1 SV=1 | 4 | 181 | 5.0E-18 |
| sp|Q9JKM7|RAB37_MOUSE | Ras-related protein Rab-37 OS=Mus musculus GN=Rab37 PE=1 SV=2 | 5 | 169 | 5.0E-18 |
| sp|O23657|RABC1_ARATH | Ras-related protein RABC1 OS=Arabidopsis thaliana GN=RABC1 PE=1 SV=1 | 4 | 190 | 6.0E-18 |
| sp|P01114|RASH_RRASV | Transforming protein p29 OS=Rasheed rat sarcoma virus GN=RAS PE=3 SV=1 | 1 | 192 | 6.0E-18 |
| sp|P16976|YPTM1_MAIZE | GTP-binding protein YPTM1 OS=Zea mays GN=YPTM1 PE=2 SV=2 | 4 | 169 | 6.0E-18 |
| sp|Q54KM9|RB11B_DICDI | Ras-related protein Rab-11B OS=Dictyostelium discoideum GN=rab11B PE=2 SV=1 | 5 | 184 | 6.0E-18 |
| sp|P35286|RAB13_RAT | Ras-related protein Rab-13 OS=Rattus norvegicus GN=Rab13 PE=1 SV=2 | 4 | 177 | 6.0E-18 |
| sp|P18613|RAPA_DICDI | Ras-related protein rapA OS=Dictyostelium discoideum GN=rapA PE=1 SV=1 | 1 | 194 | 7.0E-18 |
| sp|O35509|RB11B_RAT | Ras-related protein Rab-11B OS=Rattus norvegicus GN=Rab11b PE=1 SV=4 | 4 | 169 | 7.0E-18 |
| sp|Q15907|RB11B_HUMAN | Ras-related protein Rab-11B OS=Homo sapiens GN=RAB11B PE=1 SV=4 | 4 | 169 | 7.0E-18 |
| sp|Q3MHP2|RB11B_BOVIN | Ras-related protein Rab-11B OS=Bos taurus GN=RAB11B PE=2 SV=3 | 4 | 169 | 7.0E-18 |
| sp|P46638|RB11B_MOUSE | Ras-related protein Rab-11B OS=Mus musculus GN=Rab11b PE=1 SV=3 | 4 | 169 | 7.0E-18 |
| sp|Q54DA7|RAB4_DICDI | Ras-related protein Rab-4 OS=Dictyostelium discoideum GN=rab4 PE=3 SV=1 | 4 | 177 | 7.0E-18 |
| sp|P28187|RAA5C_ARATH | Ras-related protein RABA5c OS=Arabidopsis thaliana GN=RABA5C PE=1 SV=1 | 4 | 176 | 8.0E-18 |
| sp|Q55CB7|RASY_DICDI | Ras-like protein rasY OS=Dictyostelium discoideum GN=rasY PE=3 SV=1 | 4 | 176 | 9.0E-18 |
| sp|Q2TA29|RB11A_BOVIN | Ras-related protein Rab-11A OS=Bos taurus GN=RAB11A PE=2 SV=3 | 4 | 176 | 1.0E-17 |
| sp|Q96AX2|RAB37_HUMAN | Ras-related protein Rab-37 OS=Homo sapiens GN=RAB37 PE=1 SV=3 | 5 | 169 | 1.0E-17 |
| sp|Q54FL2|RABG2_DICDI | Ras-related protein RabG2 OS=Dictyostelium discoideum GN=rabG2 PE=3 SV=2 | 4 | 189 | 1.0E-17 |
| sp|B4PUP5|RAS1_DROYA | Ras-like protein 1 OS=Drosophila yakuba GN=Ras85D PE=3 SV=1 | 16 | 191 | 1.0E-17 |
| sp|P83831|RAS1_DROSI | Ras-like protein 1 OS=Drosophila simulans GN=Ras85D PE=3 SV=1 | 16 | 191 | 1.0E-17 |
| sp|B4HKC7|RAS1_DROSE | Ras-like protein 1 OS=Drosophila sechellia GN=Ras85D PE=3 SV=1 | 16 | 191 | 1.0E-17 |
| sp|P08646|RAS1_DROME | Ras-like protein 1 OS=Drosophila melanogaster GN=Ras85D PE=1 SV=2 | 16 | 191 | 1.0E-17 |
| sp|P83832|RAS1_DROMA | Ras-like protein 1 OS=Drosophila mauritiana GN=Ras85D PE=3 SV=1 | 16 | 191 | 1.0E-17 |
| sp|B3NZR4|RAS1_DROER | Ras-like protein 1 OS=Drosophila erecta GN=Ras85D PE=3 SV=1 | 16 | 191 | 1.0E-17 |
| sp|B3M185|RAS1_DROAN | Ras-like protein 1 OS=Drosophila ananassae GN=Ras85D PE=3 SV=1 | 16 | 191 | 1.0E-17 |
| sp|P22129|RB11B_DIPOM | Ras-related protein Rab-11B OS=Diplobatis ommata PE=2 SV=1 | 4 | 169 | 1.0E-17 |
| sp|Q9YH37|RAP1B_CYPCA | Ras-related protein Rap-1b OS=Cyprinus carpio GN=rap1b PE=2 SV=1 | 1 | 186 | 1.0E-17 |
| sp|Q55CA9|RASZ_DICDI | Ras-like protein rasZ OS=Dictyostelium discoideum GN=rasZ PE=3 SV=1 | 4 | 176 | 2.0E-17 |
| sp|Q9LZD4|RAE1D_ARATH | Ras-related protein RABE1d OS=Arabidopsis thaliana GN=RABE1D PE=1 SV=1 | 4 | 169 | 2.0E-17 |
| sp|Q9SMR4|RAH1C_ARATH | Ras-related protein RABH1c OS=Arabidopsis thaliana GN=RABH1C PE=1 SV=1 | 1 | 169 | 2.0E-17 |
| sp|O80501|RAH1B_ARATH | Ras-related protein RABH1b OS=Arabidopsis thaliana GN=RABH1B PE=1 SV=1 | 5 | 169 | 2.0E-17 |
| sp|P01115|RASH_MSVHA | Transforming protein p29 OS=Harvey murine sarcoma virus GN=H-RAS PE=1 SV=1 | 1 | 192 | 3.0E-17 |
| sp|Q39571|YPTC1_CHLRE | GTP-binding protein YPTC1 OS=Chlamydomonas reinhardtii GN=YPTC1 PE=3 SV=1 | 4 | 169 | 3.0E-17 |
| sp|P20791|RAB8B_DICDI | Ras-related protein Rab-8B OS=Dictyostelium discoideum GN=rab8B PE=2 SV=1 | 4 | 183 | 3.0E-17 |
| sp|Q9SEH3|RAD2C_ARATH | Ras-related protein RABD2c OS=Arabidopsis thaliana GN=RABD2C PE=2 SV=1 | 4 | 190 | 3.0E-17 |
| sp|P70426|RIT1_MOUSE | GTP-binding protein Rit1 OS=Mus musculus GN=Rit1 PE=1 SV=1 | 5 | 176 | 4.0E-17 |
| sp|P18262|RAS_ARTSA | Ras-like protein (Fragment) OS=Artemia salina PE=3 SV=1 | 12 | 190 | 4.0E-17 |
| sp|P25228|RAB3_DROME | Ras-related protein Rab-3 OS=Drosophila melanogaster GN=Rab3 PE=1 SV=1 | 4 | 173 | 4.0E-17 |
| sp|P31584|YPTV1_VOLCA | GTP-binding protein yptV1 OS=Volvox carteri GN=YPTV1 PE=3 SV=1 | 4 | 169 | 4.0E-17 |
| sp|Q92963|RIT1_HUMAN | GTP-binding protein Rit1 OS=Homo sapiens GN=RIT1 PE=1 SV=1 | 5 | 176 | 4.0E-17 |
| sp|Q295X7|RAS1_DROPS | Ras-like protein 1 OS=Drosophila pseudoobscura pseudoobscura GN=Ras85D PE=3 SV=1 | 16 | 191 | 5.0E-17 |
| sp|B4GFJ8|RAS1_DROPE | Ras-like protein 1 OS=Drosophila persimilis GN=Ras85D PE=3 SV=1 | 16 | 191 | 5.0E-17 |
| sp|Q9SID8|RAH1D_ARATH | Ras-related protein RABH1d OS=Arabidopsis thaliana GN=RABH1D PE=3 SV=1 | 5 | 169 | 5.0E-17 |
| sp|Q9ZRE2|RABD1_ARATH | Ras-related protein RABD1 OS=Arabidopsis thaliana GN=RABD1 PE=1 SV=1 | 4 | 169 | 5.0E-17 |
| sp|Q9FPJ4|RAD2B_ARATH | Ras-related protein RABD2b OS=Arabidopsis thaliana GN=RABD2B PE=2 SV=1 | 4 | 190 | 6.0E-17 |
| sp|P38545|RAN_PLAFA | GTP-binding nuclear protein Ran OS=Plasmodium falciparum PE=2 SV=1 | 5 | 139 | 6.0E-17 |
| sp|O04486|RAA2A_ARATH | Ras-related protein RABA2a OS=Arabidopsis thaliana GN=RABA2A PE=2 SV=1 | 4 | 176 | 6.0E-17 |
| sp|Q5U316|RAB35_RAT | Ras-related protein Rab-35 OS=Rattus norvegicus GN=Rab35 PE=1 SV=1 | 4 | 118 | 8.0E-17 |
| sp|Q6PHN9|RAB35_MOUSE | Ras-related protein Rab-35 OS=Mus musculus GN=Rab35 PE=1 SV=1 | 4 | 118 | 8.0E-17 |
| sp|Q15286|RAB35_HUMAN | Ras-related protein Rab-35 OS=Homo sapiens GN=RAB35 PE=1 SV=1 | 4 | 118 | 8.0E-17 |
| sp|P10536|RAB1B_RAT | Ras-related protein Rab-1B OS=Rattus norvegicus GN=Rab1b PE=1 SV=1 | 4 | 190 | 8.0E-17 |
| sp|Q9D1G1|RAB1B_MOUSE | Ras-related protein Rab-1B OS=Mus musculus GN=Rab1b PE=1 SV=1 | 4 | 190 | 8.0E-17 |
| sp|Q2HJH2|RAB1B_BOVIN | Ras-related protein Rab-1B OS=Bos taurus GN=RAB1B PE=2 SV=1 | 4 | 190 | 8.0E-17 |
| sp|Q640R7|RAP1B_XENTR | Ras-related protein Rap-1b OS=Xenopus tropicalis GN=rap1b PE=2 SV=1 | 1 | 186 | 9.0E-17 |
| sp|Q7ZXH7|RAP1B_XENLA | Ras-related protein Rap-1b OS=Xenopus laevis GN=rap1b PE=2 SV=1 | 1 | 186 | 9.0E-17 |
| sp|Q6TEN1|RAP1B_DANRE | Ras-related protein Rap-1b OS=Danio rerio GN=rap1b PE=2 SV=1 | 1 | 192 | 9.0E-17 |
| sp|P11233|RALA_HUMAN | Ras-related protein Ral-A OS=Homo sapiens GN=RALA PE=1 SV=1 | 5 | 176 | 1.0E-16 |
| sp|B4LY29|RAS1_DROVI | Ras-like protein 1 OS=Drosophila virilis GN=Ras85D PE=3 SV=1 | 16 | 190 | 1.0E-16 |
| sp|P36017|VPS21_YEAST | Vacuolar protein sorting-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS21 PE=1 SV=1 | 3 | 169 | 1.0E-16 |
| sp|P40393|RIC2_ORYSJ | Ras-related protein RIC2 OS=Oryza sativa subsp. japonica GN=RIC2 PE=2 SV=2 | 4 | 173 | 1.0E-16 |
| sp|Q5RE13|RAB1B_PONAB | Ras-related protein Rab-1B OS=Pongo abelii GN=RAB1B PE=2 SV=1 | 4 | 190 | 1.0E-16 |
| sp|Q9H0U4|RAB1B_HUMAN | Ras-related protein Rab-1B OS=Homo sapiens GN=RAB1B PE=1 SV=1 | 4 | 190 | 1.0E-16 |
| sp|Q99260|YPT6_YEAST | GTP-binding protein YPT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT6 PE=1 SV=1 | 5 | 185 | 1.0E-16 |
| sp|P55745|RAB21_CANLF | Ras-related protein Rab-21 OS=Canis lupus familiaris GN=RAB21 PE=3 SV=3 | 3 | 169 | 1.0E-16 |
| sp|P22123|RAPA_DIPOM | Ras-related protein O-Krev OS=Diplobatis ommata PE=2 SV=1 | 1 | 194 | 1.0E-16 |
| sp|P22125|RAB1_DIPOM | Ras-related protein ORAB-1 OS=Diplobatis ommata PE=2 SV=1 | 4 | 190 | 1.0E-16 |
| sp|P19892|RAA5E_ARATH | Ras-related protein RABA5e OS=Arabidopsis thaliana GN=RABA5E PE=2 SV=1 | 4 | 178 | 1.0E-16 |
| sp|O76173|RAB1C_DICDI | Ras-related protein Rab-1C OS=Dictyostelium discoideum GN=Rab1C PE=2 SV=1 | 4 | 137 | 1.0E-16 |
| sp|Q6AXT5|RAB21_RAT | Ras-related protein Rab-21 OS=Rattus norvegicus GN=Rab21 PE=2 SV=1 | 3 | 169 | 2.0E-16 |
| sp|Q4R8X3|RAB1B_MACFA | Ras-related protein Rab-1B OS=Macaca fascicularis GN=RAB1B PE=2 SV=1 | 4 | 190 | 2.0E-16 |
| sp|B4NJ72|RAS1_DROWI | Ras-like protein 1 OS=Drosophila willistoni GN=Ras85D PE=3 SV=1 | 16 | 191 | 2.0E-16 |
| sp|Q504M8|RAB26_MOUSE | Ras-related protein Rab-26 OS=Mus musculus GN=Rab26 PE=1 SV=1 | 3 | 169 | 2.0E-16 |
| sp|Q01111|YPT3_NICPL | Ras-related protein YPT3 OS=Nicotiana plumbaginifolia GN=YPT3 PE=2 SV=1 | 4 | 176 | 2.0E-16 |
| sp|P32939|YPT7_YEAST | GTP-binding protein YPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT7 PE=1 SV=1 | 4 | 185 | 2.0E-16 |
| sp|Q39572|YPTC6_CHLRE | Ras-related protein YPTC6 OS=Chlamydomonas reinhardtii GN=YPTC6 PE=3 SV=1 | 4 | 176 | 2.0E-16 |
| sp|P01117|RASK_MSVKI | GTPase KRas OS=Kirsten murine sarcoma virus GN=K-RAS PE=1 SV=1 | 1 | 176 | 2.0E-16 |
| sp|Q54FK8|RABM_DICDI | Ras-related protein RabM OS=Dictyostelium discoideum GN=rabM PE=3 SV=2 | 2 | 185 | 2.0E-16 |
| sp|Q9UL25|RAB21_HUMAN | Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 | 3 | 169 | 2.0E-16 |
| sp|O49841|RAC2A_ARATH | Ras-related protein RABC2a OS=Arabidopsis thaliana GN=RABC2A PE=1 SV=1 | 3 | 171 | 2.0E-16 |
| sp|P35282|RAB21_MOUSE | Ras-related protein Rab-21 OS=Mus musculus GN=Rab21 PE=1 SV=4 | 3 | 169 | 2.0E-16 |
| sp|Q54FK5|RABN1_DICDI | Ras-related protein RabN1 OS=Dictyostelium discoideum GN=rabN1 PE=3 SV=1 | 2 | 178 | 3.0E-16 |
| sp|Q6NYB7|RAB1A_RAT | Ras-related protein Rab-1A OS=Rattus norvegicus GN=Rab1A PE=1 SV=3 | 4 | 188 | 3.0E-16 |
| sp|P62821|RAB1A_MOUSE | Ras-related protein Rab-1A OS=Mus musculus GN=Rab1A PE=1 SV=3 | 4 | 188 | 3.0E-16 |
| sp|P62820|RAB1A_HUMAN | Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 | 4 | 188 | 3.0E-16 |
| sp|P62822|RAB1A_CANLF | Ras-related protein Rab-1A OS=Canis lupus familiaris GN=RAB1A PE=1 SV=3 | 4 | 188 | 3.0E-16 |
| sp|Q17R06|RAB21_BOVIN | Ras-related protein Rab-21 OS=Bos taurus GN=RAB21 PE=2 SV=1 | 3 | 169 | 3.0E-16 |
| sp|P17610|YPT3_SCHPO | GTP-binding protein ypt3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt3 PE=1 SV=1 | 4 | 178 | 3.0E-16 |
| sp|B4JFU8|RAS1_DROGR | Ras-like protein 1 OS=Drosophila grimshawi GN=Ras85D PE=3 SV=1 | 16 | 190 | 3.0E-16 |
| sp|P22126|RAS1_NEUCR | Protein ras-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-1 PE=2 SV=1 | 14 | 188 | 3.0E-16 |
| sp|P63320|RALA_SAGOE | Ras-related protein Ral-A OS=Saguinus oedipus GN=RALA PE=1 SV=1 | 5 | 176 | 3.0E-16 |
| sp|P63322|RALA_RAT | Ras-related protein Ral-A OS=Rattus norvegicus GN=Rala PE=1 SV=1 | 5 | 176 | 3.0E-16 |
| sp|P63321|RALA_MOUSE | Ras-related protein Ral-A OS=Mus musculus GN=Rala PE=1 SV=1 | 5 | 176 | 3.0E-16 |
| sp|P41914|RAN_TETPY | GTP-binding nuclear protein Ran OS=Tetrahymena pyriformis PE=2 SV=1 | 4 | 139 | 4.0E-16 |
| sp|Q05737|YPTM2_MAIZE | GTP-binding protein YPTM2 OS=Zea mays GN=YPTM2 PE=2 SV=1 | 4 | 169 | 4.0E-16 |
| sp|Q52NJ2|RAB1A_PIG | Ras-related protein Rab-1A OS=Sus scrofa GN=RAB1A PE=2 SV=3 | 4 | 188 | 4.0E-16 |
| sp|Q9ERI2|RB27A_MOUSE | Ras-related protein Rab-27A OS=Mus musculus GN=Rab27a PE=1 SV=1 | 4 | 136 | 4.0E-16 |
| sp|Q62636|RAP1B_RAT | Ras-related protein Rap-1b OS=Rattus norvegicus GN=Rap1b PE=1 SV=2 | 1 | 186 | 4.0E-16 |
| sp|Q8WQ53|RAB21_GEOCY | Ras-related protein Rab-21 OS=Geodia cydonium GN=RAB21 PE=2 SV=1 | 5 | 180 | 5.0E-16 |
| sp|P23640|RB27A_RAT | Ras-related protein Rab-27A OS=Rattus norvegicus GN=Rab27a PE=1 SV=1 | 4 | 136 | 5.0E-16 |
| sp|Q5RDM6|RAP1B_PONAB | Ras-related protein Rap-1b OS=Pongo abelii GN=RAP1B PE=2 SV=1 | 1 | 186 | 5.0E-16 |
| sp|A5A6J7|RAP1B_PANTR | Ras-related protein Rap-1b OS=Pan troglodytes GN=RAP1B PE=2 SV=1 | 1 | 186 | 5.0E-16 |
| sp|Q99JI6|RAP1B_MOUSE | Ras-related protein Rap-1b OS=Mus musculus GN=Rap1b PE=1 SV=2 | 1 | 186 | 5.0E-16 |
| sp|Q4R9D4|RAP1B_MACFA | Ras-related protein Rap-1b OS=Macaca fascicularis GN=RAP1B PE=2 SV=1 | 1 | 186 | 5.0E-16 |
| sp|P61224|RAP1B_HUMAN | Ras-related protein Rap-1b OS=Homo sapiens GN=RAP1B PE=1 SV=1 | 1 | 186 | 5.0E-16 |
| sp|Q5ZHX1|RAP1B_CHICK | Ras-related protein Rap-1b OS=Gallus gallus GN=RAP1B PE=2 SV=1 | 1 | 186 | 5.0E-16 |
| sp|P61223|RAP1B_BOVIN | Ras-related protein Rap-1b OS=Bos taurus GN=RAP1B PE=2 SV=1 | 1 | 186 | 5.0E-16 |
| sp|P22278|RAS1_MUCCL | Ras-like protein 1 OS=Mucor circinelloides f. lusitanicus GN=RAS1 PE=2 SV=1 | 5 | 193 | 5.0E-16 |
| sp|Q9SIP0|RAA5D_ARATH | Ras-related protein RABA5d OS=Arabidopsis thaliana GN=RABA5D PE=1 SV=1 | 4 | 176 | 5.0E-16 |
| sp|P35281|RAB10_RAT | Ras-related protein Rab-10 OS=Rattus norvegicus GN=Rab10 PE=1 SV=1 | 4 | 185 | 5.0E-16 |
| sp|P10949|RAB3C_BOVIN | Ras-related protein Rab-3C OS=Bos taurus GN=RAB3C PE=2 SV=3 | 4 | 173 | 6.0E-16 |
| sp|P51156|RAB26_RAT | Ras-related protein Rab-26 OS=Rattus norvegicus GN=Rab26 PE=2 SV=2 | 3 | 159 | 7.0E-16 |
| sp|Q96E17|RAB3C_HUMAN | Ras-related protein Rab-3C OS=Homo sapiens GN=RAB3C PE=2 SV=1 | 4 | 173 | 7.0E-16 |
| sp|Q9ULW5|RAB26_HUMAN | Ras-related protein Rab-26 OS=Homo sapiens GN=RAB26 PE=1 SV=3 | 3 | 128 | 7.0E-16 |
| sp|Q06AU7|RAB1B_PIG | Ras-related protein Rab-1B OS=Sus scrofa GN=RAB1B PE=2 SV=1 | 4 | 190 | 7.0E-16 |
| sp|Q39434|RB2BV_BETVU | Ras-related protein Rab2BV OS=Beta vulgaris GN=RAB2BV PE=2 SV=1 | 4 | 171 | 7.0E-16 |
| sp|Q01387|RAS2_NEUCR | Protein ras-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ras-2 PE=3 SV=2 | 5 | 176 | 7.0E-16 |
| sp|P41924|RYL1_YARLI | Ras-like GTP-binding protein RYL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL1 PE=3 SV=1 | 4 | 169 | 7.0E-16 |
| sp|Q99P74|RB27B_RAT | Ras-related protein Rab-27B OS=Rattus norvegicus GN=Rab27b PE=2 SV=3 | 4 | 170 | 8.0E-16 |
| sp|Q05974|RAB1A_LYMST | Ras-related protein Rab-1A OS=Lymnaea stagnalis GN=RAB1A PE=2 SV=1 | 4 | 182 | 8.0E-16 |
| sp|Q29RR0|RAB26_BOVIN | Ras-related protein Rab-26 OS=Bos taurus GN=RAB26 PE=2 SV=1 | 3 | 128 | 8.0E-16 |
| sp|Q01890|YPT1_PHYIN | Ras-like GTP-binding protein YPT1 OS=Phytophthora infestans GN=YPT1 PE=3 SV=1 | 4 | 119 | 8.0E-16 |
| sp|P13856|RSR1_YEAST | Ras-related protein RSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSR1 PE=3 SV=1 | 1 | 177 | 9.0E-16 |
| sp|Q5BJQ5|RIT2_RAT | GTP-binding protein Rit2 OS=Rattus norvegicus GN=Rit2 PE=2 SV=1 | 5 | 176 | 9.0E-16 |
| sp|P51159|RB27A_HUMAN | Ras-related protein Rab-27A OS=Homo sapiens GN=RAB27A PE=1 SV=3 | 4 | 186 | 1.0E-15 |
| sp|Q9TVU5|RAB1_THEPA | Ras-related protein Rab-1 OS=Theileria parva GN=rab1 PE=1 SV=1 | 4 | 183 | 1.0E-15 |
| sp|P33519|RAN_DICDI | GTP-binding nuclear protein Ran OS=Dictyostelium discoideum GN=ranA PE=1 SV=1 | 2 | 139 | 1.0E-15 |
| sp|Q39222|RAA1B_ARATH | Ras-related protein RABA1b OS=Arabidopsis thaliana GN=RABA1B PE=2 SV=1 | 4 | 120 | 1.0E-15 |
| sp|Q9WVB1|RAB6A_RAT | Ras-related protein Rab-6A OS=Rattus norvegicus GN=Rab6a PE=1 SV=2 | 1 | 194 | 1.0E-15 |
| sp|P35279|RAB6A_MOUSE | Ras-related protein Rab-6A OS=Mus musculus GN=Rab6a PE=1 SV=4 | 1 | 194 | 1.0E-15 |
| sp|Q99P58|RB27B_MOUSE | Ras-related protein Rab-27B OS=Mus musculus GN=Rab27b PE=1 SV=3 | 4 | 170 | 1.0E-15 |
| sp|Q5RAV6|RAB6A_PONAB | Ras-related protein Rab-6A OS=Pongo abelii GN=RAB6A PE=2 SV=3 | 1 | 194 | 1.0E-15 |
| sp|P20340|RAB6A_HUMAN | Ras-related protein Rab-6A OS=Homo sapiens GN=RAB6A PE=1 SV=3 | 1 | 194 | 1.0E-15 |
| sp|P70425|RIT2_MOUSE | GTP-binding protein Rit2 OS=Mus musculus GN=Rit2 PE=1 SV=1 | 5 | 176 | 1.0E-15 |
| sp|Q4LE85|RB27A_PIG | Ras-related protein Rab-27A OS=Sus scrofa GN=RAB27A PE=2 SV=1 | 4 | 135 | 1.0E-15 |
| sp|O23561|RAB1A_ARATH | Ras-related protein RABB1a OS=Arabidopsis thaliana GN=RABB1A PE=2 SV=1 | 4 | 171 | 1.0E-15 |
| sp|Q8WUD1|RAB2B_HUMAN | Ras-related protein Rab-2B OS=Homo sapiens GN=RAB2B PE=1 SV=1 | 4 | 169 | 1.0E-15 |
| sp|P41925|RYL2_YARLI | Ras-like GTP-binding protein RYL2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RYL2 PE=3 SV=2 | 5 | 186 | 1.0E-15 |
| sp|P61294|RAB6B_MOUSE | Ras-related protein Rab-6B OS=Mus musculus GN=Rab6b PE=1 SV=1 | 1 | 193 | 2.0E-15 |
| sp|Q9NRW1|RAB6B_HUMAN | Ras-related protein Rab-6B OS=Homo sapiens GN=RAB6B PE=1 SV=1 | 1 | 193 | 2.0E-15 |
| sp|A6QR46|RAB6B_BOVIN | Ras-related protein Rab-6B OS=Bos taurus GN=RAB6B PE=2 SV=1 | 1 | 193 | 2.0E-15 |
| sp|Q1HE58|RB27A_CANLF | Ras-related protein Rab-27A OS=Canis lupus familiaris GN=RAB27A PE=2 SV=1 | 4 | 136 | 2.0E-15 |
| sp|P22280|RAS3_MUCCL | Ras-like protein 3 OS=Mucor circinelloides f. lusitanicus GN=RAS3 PE=2 SV=1 | 16 | 190 | 2.0E-15 |
| sp|Q9SRS5|RAA5B_ARATH | Ras-related protein RABA5b OS=Arabidopsis thaliana GN=RABA5B PE=2 SV=1 | 4 | 178 | 2.0E-15 |
| sp|Q38922|RAB1B_ARATH | Ras-related protein RABB1b OS=Arabidopsis thaliana GN=RABB1B PE=2 SV=1 | 4 | 177 | 2.0E-15 |
| sp|P41915|RAN_TETTH | GTP-binding nuclear protein Ran OS=Tetrahymena thermophila PE=2 SV=1 | 4 | 139 | 2.0E-15 |
| sp|O94655|YPT7_SCHPO | GTP-binding protein ypt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt7 PE=3 SV=1 | 4 | 177 | 2.0E-15 |
| sp|Q4UB16|RAB1_THEAN | Ras-related protein Rab-1 OS=Theileria annulata GN=rab1 PE=3 SV=1 | 4 | 183 | 2.0E-15 |
| sp|Q5R6B6|RAB2A_PONAB | Ras-related protein Rab-2A OS=Pongo abelii GN=RAB2A PE=2 SV=1 | 4 | 169 | 2.0E-15 |
| sp|P53994|RAB2A_MOUSE | Ras-related protein Rab-2A OS=Mus musculus GN=Rab2a PE=1 SV=1 | 4 | 169 | 2.0E-15 |
| sp|Q4R4X6|RAB2A_MACFA | Ras-related protein Rab-2A OS=Macaca fascicularis GN=RAB2A PE=2 SV=1 | 4 | 169 | 2.0E-15 |
| sp|P61019|RAB2A_HUMAN | Ras-related protein Rab-2A OS=Homo sapiens GN=RAB2A PE=1 SV=1 | 4 | 169 | 2.0E-15 |
| sp|P61105|RAB2A_CANLF | Ras-related protein Rab-2A OS=Canis lupus familiaris GN=RAB2A PE=1 SV=1 | 4 | 169 | 2.0E-15 |
| sp|P34140|RAB1B_DICDI | Ras-related protein Rab-1B OS=Dictyostelium discoideum GN=rab1B PE=2 SV=2 | 4 | 169 | 2.0E-15 |
| sp|Q94986|RAB3_CAEEL | Ras-related protein Rab-3 OS=Caenorhabditis elegans GN=rab-3 PE=2 SV=1 | 4 | 189 | 2.0E-15 |
| sp|Q6DHC1|RB18B_DANRE | Ras-related protein Rab-18-B OS=Danio rerio GN=rab18b PE=2 SV=1 | 1 | 177 | 2.0E-15 |
| sp|Q90965|RAB2A_CHICK | Ras-related protein Rab-2A OS=Gallus gallus GN=RAB2A PE=2 SV=1 | 4 | 169 | 2.0E-15 |
| sp|Q01971|RAB2A_RABIT | Ras-related protein Rab-2A OS=Oryctolagus cuniculus GN=RAB2A PE=2 SV=1 | 4 | 169 | 2.0E-15 |
| sp|P34141|RABA_DICDI | Ras-related protein RabA OS=Dictyostelium discoideum GN=rabA PE=2 SV=2 | 4 | 119 | 2.0E-15 |
| sp|P62824|RAB3C_RAT | Ras-related protein Rab-3C OS=Rattus norvegicus GN=Rab3c PE=1 SV=1 | 4 | 185 | 3.0E-15 |
| sp|P62823|RAB3C_MOUSE | Ras-related protein Rab-3C OS=Mus musculus GN=Rab3c PE=1 SV=1 | 4 | 185 | 3.0E-15 |
| sp|Q54E92|RABG1_DICDI | Ras-related protein RabG1 OS=Dictyostelium discoideum GN=rabG1 PE=3 SV=1 | 4 | 182 | 3.0E-15 |
| sp|P33723|YPT1_NEUCR | GTP-binding protein ypt1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ypt-1 PE=3 SV=1 | 4 | 191 | 3.0E-15 |
| sp|P49104|RAB2B_MAIZE | Ras-related protein Rab-2-B OS=Zea mays GN=RAB2B PE=2 SV=1 | 4 | 169 | 3.0E-15 |
| sp|P38976|RAS2_HYDVU | Ras-like protein RAS2 OS=Hydra vulgaris GN=RAS2 PE=2 SV=1 | 13 | 194 | 3.0E-15 |
| sp|Q9LV79|RAH1A_ARATH | Ras-related protein RABH1a OS=Arabidopsis thaliana GN=RABH1A PE=2 SV=1 | 5 | 169 | 3.0E-15 |
| sp|Q8BHD0|RB39A_MOUSE | Ras-related protein Rab-39A OS=Mus musculus GN=Rab39a PE=1 SV=1 | 4 | 159 | 3.0E-15 |
| sp|P49103|RAB2A_MAIZE | Ras-related protein Rab-2-A OS=Zea mays GN=RAB2A PE=2 SV=1 | 4 | 169 | 3.0E-15 |
| sp|Q9LFT9|RAH1E_ARATH | Ras-related protein RABH1e OS=Arabidopsis thaliana GN=RABH1E PE=2 SV=1 | 5 | 169 | 3.0E-15 |
| sp|Q40193|RB11C_LOTJA | Ras-related protein Rab11C OS=Lotus japonicus GN=RAB11C PE=2 SV=1 | 4 | 169 | 3.0E-15 |
| sp|P05712|RAB2A_RAT | Ras-related protein Rab-2A OS=Rattus norvegicus GN=Rab2a PE=2 SV=1 | 4 | 169 | 3.0E-15 |
| sp|Q8BHC1|RB39B_MOUSE | Ras-related protein Rab-39B OS=Mus musculus GN=Rab39b PE=1 SV=1 | 1 | 176 | 4.0E-15 |
| sp|Q96DA2|RB39B_HUMAN | Ras-related protein Rab-39B OS=Homo sapiens GN=RAB39B PE=1 SV=1 | 1 | 176 | 4.0E-15 |
| sp|Q550H6|RB11C_DICDI | Ras-related protein Rab-11C OS=Dictyostelium discoideum GN=rab11C PE=1 SV=1 | 4 | 170 | 4.0E-15 |
| sp|Q17QU4|RB39B_BOVIN | Ras-related protein Rab-39B OS=Bos taurus GN=RAB39B PE=2 SV=1 | 1 | 176 | 4.0E-15 |
| sp|Q9FK68|RAA1C_ARATH | Ras-related protein RABA1c OS=Arabidopsis thaliana GN=RABA1C PE=2 SV=1 | 4 | 120 | 4.0E-15 |
| sp|Q05975|RAB2_LYMST | Ras-related protein Rab-2 OS=Lymnaea stagnalis GN=RAB2 PE=2 SV=1 | 4 | 169 | 4.0E-15 |
| sp|Q9ULC3|RAB23_HUMAN | Ras-related protein Rab-23 OS=Homo sapiens GN=RAB23 PE=1 SV=1 | 3 | 122 | 5.0E-15 |
| sp|B4KB60|RAS1_DROMO | Ras-like protein 1 OS=Drosophila mojavensis GN=Ras85D PE=3 SV=1 | 16 | 190 | 5.0E-15 |
| sp|Q95UJ0|RAB7A_PAROT | Ras-related protein Rab-7a OS=Paramecium octaurelia GN=Rab7a PE=1 SV=2 | 2 | 176 | 5.0E-15 |
| sp|Q40195|RB11E_LOTJA | Ras-related protein Rab11E OS=Lotus japonicus GN=RAB11E PE=2 SV=1 | 4 | 173 | 5.0E-15 |
| sp|P62836|RAP1A_RAT | Ras-related protein Rap-1A OS=Rattus norvegicus GN=Rap1a PE=1 SV=1 | 1 | 194 | 6.0E-15 |
| sp|P62835|RAP1A_MOUSE | Ras-related protein Rap-1A OS=Mus musculus GN=Rap1a PE=1 SV=1 | 1 | 194 | 6.0E-15 |
| sp|P62834|RAP1A_HUMAN | Ras-related protein Rap-1A OS=Homo sapiens GN=RAP1A PE=1 SV=1 | 1 | 194 | 6.0E-15 |
| sp|P62833|RAP1A_BOVIN | Ras-related protein Rap-1A OS=Bos taurus GN=RAP1A PE=1 SV=1 | 1 | 194 | 6.0E-15 |
| sp|Q6DUB4|RAB7B_PAROT | Ras-related protein Rab-7b OS=Paramecium octaurelia GN=Rab7b PE=1 SV=1 | 2 | 176 | 6.0E-15 |
| sp|Q54GY8|RAB18_DICDI | Ras-related protein Rab-18 OS=Dictyostelium discoideum GN=rab18 PE=3 SV=1 | 5 | 177 | 6.0E-15 |
| sp|A6NIZ1|RP1BL_HUMAN | Ras-related protein Rap-1b-like protein OS=Homo sapiens PE=2 SV=1 | 1 | 186 | 6.0E-15 |
| sp|O00194|RB27B_HUMAN | Ras-related protein Rab-27B OS=Homo sapiens GN=RAB27B PE=1 SV=4 | 4 | 170 | 6.0E-15 |
| sp|Q1KME6|RAB6A_CHICK | Ras-related protein Rab-6A OS=Gallus gallus GN=RAB6A PE=2 SV=3 | 1 | 169 | 6.0E-15 |
| sp|P11620|YPT1_SCHPO | GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt1 PE=1 SV=2 | 4 | 127 | 6.0E-15 |
| sp|Q9LNW1|RAA2B_ARATH | Ras-related protein RABA2b OS=Arabidopsis thaliana GN=RABA2B PE=2 SV=2 | 4 | 189 | 7.0E-15 |
| sp|P59279|RAB2B_MOUSE | Ras-related protein Rab-2B OS=Mus musculus GN=Rab2b PE=1 SV=1 | 4 | 161 | 7.0E-15 |
| sp|O49513|RAA1E_ARATH | Ras-related protein RABA1e OS=Arabidopsis thaliana GN=RABA1E PE=2 SV=1 | 4 | 121 | 7.0E-15 |
| sp|Q9HDY0|YPT71_SCHPO | GTP-binding protein ypt71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ypt71 PE=3 SV=1 | 4 | 118 | 7.0E-15 |
| sp|Q54NU2|RAB1D_DICDI | Ras-related protein Rab-1D OS=Dictyostelium discoideum GN=rab1D PE=1 SV=1 | 4 | 178 | 7.0E-15 |
| sp|P36411|RAB7A_DICDI | Ras-related protein Rab-7A OS=Dictyostelium discoideum GN=rab7A PE=1 SV=1 | 4 | 183 | 8.0E-15 |
| sp|P34139|RAB1A_DICDI | Ras-related protein Rab-1A OS=Dictyostelium discoideum GN=rab1A PE=2 SV=2 | 4 | 119 | 8.0E-15 |
| sp|P20171|RASH_RAT | GTPase HRas OS=Rattus norvegicus GN=Hras PE=1 SV=2 | 16 | 192 | 9.0E-15 |
| sp|Q61411|RASH_MOUSE | GTPase HRas OS=Mus musculus GN=Hras PE=1 SV=2 | 16 | 192 | 9.0E-15 |
| sp|P01112|RASH_HUMAN | GTPase HRas OS=Homo sapiens GN=HRAS PE=1 SV=1 | 16 | 192 | 9.0E-15 |
| sp|P51152|RAB12_CANLF | Ras-related protein Rab-12 (Fragment) OS=Canis lupus familiaris GN=RAB12 PE=2 SV=1 | 4 | 181 | 9.0E-15 |
| sp|O18334|RAB6_DROME | Ras-related protein Rab6 OS=Drosophila melanogaster GN=Rab6 PE=1 SV=1 | 1 | 169 | 9.0E-15 |
| sp|P63012|RAB3A_RAT | Ras-related protein Rab-3A OS=Rattus norvegicus GN=Rab3a PE=1 SV=1 | 4 | 176 | 9.0E-15 |
| sp|Q06AU3|RAB3A_PIG | Ras-related protein Rab-3A OS=Sus scrofa GN=RAB3A PE=2 SV=1 | 4 | 176 | 9.0E-15 |
| sp|P63011|RAB3A_MOUSE | Ras-related protein Rab-3A OS=Mus musculus GN=Rab3a PE=1 SV=1 | 4 | 176 | 9.0E-15 |
| sp|E2RQ15|RAB25_CANLF | Ras-related protein Rab-25 OS=Canis lupus familiaris GN=RAB25 PE=3 SV=1 | 4 | 193 | 9.0E-15 |
| sp|O95716|RAB3D_HUMAN | Ras-related protein Rab-3D OS=Homo sapiens GN=RAB3D PE=1 SV=1 | 4 | 176 | 1.0E-14 |
| sp|Q8HZJ5|RB27B_BOVIN | Ras-related protein Rab-27B OS=Bos taurus GN=RAB27B PE=2 SV=3 | 4 | 170 | 1.0E-14 |
| sp|P38555|YPT31_YEAST | GTP-binding protein YPT31/YPT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT31 PE=1 SV=3 | 4 | 176 | 1.0E-14 |
| sp|P11023|RAB3A_BOVIN | Ras-related protein Rab-3A OS=Bos taurus GN=RAB3A PE=1 SV=3 | 4 | 176 | 1.0E-14 |
| sp|Q4R4R9|RAB3A_MACFA | Ras-related protein Rab-3A OS=Macaca fascicularis GN=RAB3A PE=2 SV=1 | 4 | 176 | 1.0E-14 |
| sp|P20336|RAB3A_HUMAN | Ras-related protein Rab-3A OS=Homo sapiens GN=RAB3A PE=1 SV=1 | 4 | 176 | 1.0E-14 |
| sp|P34142|RAB21_DICDI | Ras-related protein Rab-21 OS=Dictyostelium discoideum GN=rab21 PE=1 SV=2 | 2 | 179 | 1.0E-14 |
| sp|Q54FK7|RABL_DICDI | Ras-related protein RabL OS=Dictyostelium discoideum GN=rabL PE=3 SV=1 | 4 | 177 | 1.0E-14 |
| sp|P17608|RYH1_SCHPO | GTP-binding protein ryh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ryh1 PE=1 SV=1 | 1 | 169 | 1.0E-14 |
| sp|O97572|RAB7A_RABIT | Ras-related protein Rab-7a OS=Oryctolagus cuniculus GN=RAB7A PE=2 SV=1 | 4 | 177 | 1.0E-14 |
| sp|P36863|YPTV4_VOLCA | GTP-binding protein yptV4 OS=Volvox carteri GN=YPTV4 PE=3 SV=1 | 4 | 169 | 1.0E-14 |
| sp|Q68EK7|RAB4B_DANRE | Ras-related protein Rab-4B OS=Danio rerio GN=rab4b PE=2 SV=1 | 4 | 189 | 1.0E-14 |
| sp|P01119|RAS1_YEAST | Ras-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS1 PE=1 SV=2 | 16 | 189 | 1.0E-14 |
| sp|P35283|RAB12_MOUSE | Ras-related protein Rab-12 OS=Mus musculus GN=Rab12 PE=1 SV=3 | 4 | 181 | 1.0E-14 |
| sp|P35284|RAB12_RAT | Ras-related protein Rab-12 OS=Rattus norvegicus GN=Rab12 PE=1 SV=2 | 4 | 181 | 1.0E-14 |
| sp|Q58DW6|RAB25_BOVIN | Ras-related protein Rab-25 OS=Bos taurus GN=RAB25 PE=2 SV=1 | 4 | 193 | 1.0E-14 |
| sp|Q5R5H5|RAB18_PONAB | Ras-related protein Rab-18 OS=Pongo abelii GN=RAB18 PE=2 SV=1 | 1 | 189 | 1.0E-14 |
| sp|Q9NP72|RAB18_HUMAN | Ras-related protein Rab-18 OS=Homo sapiens GN=RAB18 PE=1 SV=1 | 1 | 189 | 1.0E-14 |
| sp|E9Q9D5|RBL2A_MOUSE | Rab-like protein 2A OS=Mus musculus GN=Rabl2 PE=1 SV=1 | 2 | 118 | 1.0E-14 |
| sp|P38146|YPT10_YEAST | GTP-binding protein YPT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPT10 PE=1 SV=2 | 1 | 119 | 1.0E-14 |
| sp|Q9GP33|RAB4A_ECHMU | Probable Ras-related protein Rab-4A OS=Echinococcus multilocularis PE=2 SV=1 | 4 | 193 | 1.0E-14 |
| sp|Q9VP48|RAB26_DROME | Ras-related protein Rab-26 OS=Drosophila melanogaster GN=Rab26 PE=2 SV=2 | 5 | 174 | 1.0E-14 |
| sp|Q0IIG8|RAB18_BOVIN | Ras-related protein Rab-18 OS=Bos taurus GN=RAB18 PE=2 SV=1 | 1 | 189 | 1.0E-14 |
| sp|Q99578|RIT2_HUMAN | GTP-binding protein Rit2 OS=Homo sapiens GN=RIT2 PE=1 SV=1 | 5 | 176 | 1.0E-14 |
| sp|P01120|RAS2_YEAST | Ras-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAS2 PE=1 SV=4 | 16 | 159 | 2.0E-14 |
| sp|Q9FIF9|RAA2D_ARATH | Ras-related protein RABA2d OS=Arabidopsis thaliana GN=RABA2D PE=2 SV=1 | 4 | 171 | 2.0E-14 |
| sp|Q55ET3|RABQ_DICDI | Ras-related protein RabQ OS=Dictyostelium discoideum GN=rabQ PE=3 SV=1 | 4 | 178 | 2.0E-14 |
| sp|P34213|RAB6A_CAEEL | Ras-related protein Rab-6.1 OS=Caenorhabditis elegans GN=rab-6.1 PE=3 SV=1 | 1 | 169 | 2.0E-14 |
| sp|Q40723|RLGP2_ORYSJ | Ras-related protein RGP2 OS=Oryza sativa subsp. japonica GN=RGP2 PE=2 SV=2 | 4 | 176 | 2.0E-14 |
| sp|Q9FJH0|RAA1F_ARATH | Ras-related protein RABA1f OS=Arabidopsis thaliana GN=RABA1F PE=2 SV=1 | 4 | 176 | 2.0E-14 |
| sp|Q39570|YPTC4_CHLRE | GTP-binding protein YPTC4 OS=Chlamydomonas reinhardtii GN=YPTC4 PE=3 SV=1 | 4 | 169 | 2.0E-14 |
| sp|Q923S9|RAB30_MOUSE | Ras-related protein Rab-30 OS=Mus musculus GN=Rab30 PE=1 SV=1 | 4 | 176 | 2.0E-14 |
| sp|Q15771|RAB30_HUMAN | Ras-related protein Rab-30 OS=Homo sapiens GN=RAB30 PE=1 SV=2 | 4 | 176 | 2.0E-14 |
| sp|Q17QB7|RAB30_BOVIN | Ras-related protein Rab-30 OS=Bos taurus GN=RAB30 PE=2 SV=1 | 4 | 176 | 2.0E-14 |
| sp|Q22782|RAB6B_CAEEL | Ras-related protein Rab-6.2 OS=Caenorhabditis elegans GN=rab-6.2 PE=3 SV=1 | 1 | 169 | 2.0E-14 |
| sp|Q9LK99|RAA1G_ARATH | Ras-related protein RABA1g OS=Arabidopsis thaliana GN=RABA1G PE=2 SV=1 | 5 | 176 | 2.0E-14 |
| sp|P08642|RASH_CHICK | GTPase HRas OS=Gallus gallus GN=HRAS PE=1 SV=1 | 16 | 192 | 2.0E-14 |
| sp|P28185|RAA1A_ARATH | Ras-related protein RABA1a OS=Arabidopsis thaliana GN=RABA1A PE=1 SV=1 | 4 | 173 | 2.0E-14 |
| sp|Q6IQ22|RAB12_HUMAN | Ras-related protein Rab-12 OS=Homo sapiens GN=RAB12 PE=1 SV=3 | 4 | 181 | 2.0E-14 |
| sp|P35293|RAB18_MOUSE | Ras-related protein Rab-18 OS=Mus musculus GN=Rab18 PE=1 SV=2 | 1 | 189 | 2.0E-14 |
| sp|P35288|RAB23_MOUSE | Ras-related protein Rab-23 OS=Mus musculus GN=Rab23 PE=1 SV=2 | 3 | 122 | 2.0E-14 |
| sp|P35276|RAB3D_MOUSE | Ras-related protein Rab-3D OS=Mus musculus GN=Rab3d PE=1 SV=1 | 4 | 178 | 2.0E-14 |
| sp|Q54FK4|RABK1_DICDI | Ras-related protein RabK1 OS=Dictyostelium discoideum GN=rabK1 PE=3 SV=3 | 2 | 193 | 2.0E-14 |
| sp|Q55CB0|RASU_DICDI | Ras-like protein rasU OS=Dictyostelium discoideum GN=rasU PE=3 SV=1 | 4 | 171 | 2.0E-14 |
| sp|P61227|RAP2B_RAT | Ras-related protein Rap-2b OS=Rattus norvegicus GN=Rap2b PE=2 SV=1 | 1 | 194 | 2.0E-14 |
| sp|P61226|RAP2B_MOUSE | Ras-related protein Rap-2b OS=Mus musculus GN=Rap2b PE=1 SV=1 | 1 | 194 | 2.0E-14 |
| sp|P61225|RAP2B_HUMAN | Ras-related protein Rap-2b OS=Homo sapiens GN=RAP2B PE=1 SV=1 | 1 | 194 | 2.0E-14 |
| sp|Q06AU2|RAP2A_PIG | Ras-related protein Rap-2a OS=Sus scrofa GN=RAP2A PE=2 SV=1 | 1 | 194 | 2.0E-14 |
| sp|Q3T0F5|RAB7A_BOVIN | Ras-related protein Rab-7a OS=Bos taurus GN=RAB7A PE=2 SV=1 | 4 | 177 | 3.0E-14 |
| sp|Q5ZLG1|RAB18_CHICK | Ras-related protein Rab-18 OS=Gallus gallus GN=RAB18 PE=2 SV=1 | 1 | 177 | 3.0E-14 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005525 | GTP binding | Yes |
| GO:0003924 | GTPase activity | Yes |
| GO:0097367 | carbohydrate derivative binding | No |
| GO:0032561 | guanyl ribonucleotide binding | No |
| GO:0036094 | small molecule binding | No |
| GO:0019001 | guanyl nucleotide binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:0016462 | pyrophosphatase activity | No |
| GO:0043168 | anion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0017111 | nucleoside-triphosphatase activity | No |
| GO:0017076 | purine nucleotide binding | No |
| GO:0035639 | purine ribonucleoside triphosphate binding | No |
| GO:0003674 | molecular_function | No |
| GO:1901265 | nucleoside phosphate binding | No |
| GO:0032553 | ribonucleotide binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0016817 | hydrolase activity, acting on acid anhydrides | No |
| GO:0032555 | purine ribonucleotide binding | No |
| GO:0016818 | hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides | No |
| GO:0000166 | nucleotide binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 28 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 487.82 | 283.04 | 692.59 |
| Initials | Initials knots | 290.43 | 174.41 | 406.44 |
| Pileal_Stipeal_center | Stage I stipe center | 395.92 | 236.45 | 555.38 |
| Pileal_Stipeal_shell | Stage I stipe shell | 428.01 | 254.46 | 601.55 |
| DIF_stipe_center | Stage II stipe center | 480.22 | 284.90 | 675.54 |
| DIF_stipe_shell | Stage II stipe shell | 439.19 | 261.30 | 617.08 |
| DIF_stipe_skin | Stage II stipe skin | 388.24 | 231.40 | 545.08 |
| DIF_cap_skin | Stage II cap skin | 493.46 | 289.87 | 697.05 |
| DIF_cap_tissue | Stage II cap tissue | 485.18 | 286.60 | 683.75 |
| DIF_gill_tissue | Stage II gill tissue | 455.58 | 271.04 | 640.11 |
| YFB_stipe_center | Young fruiting body stipe center | 460.57 | 273.48 | 647.66 |
| YFB_stipe_shell | Young fruiting body stipe shell | 458.74 | 272.48 | 644.99 |
| YFB_stipe_skin | Young fruiting body stipe skin | 385.68 | 230.40 | 540.97 |
| YFB_cap_skin | Young fruiting body cap skin | 477.48 | 282.51 | 672.46 |
| YFB_cap_tissue | Young fruiting body cap tissue | 512.33 | 301.37 | 723.28 |
| YFB_gill_tissue | Young fruiting body gill tissue | 404.97 | 241.61 | 568.33 |
| YFB_veil | Young fruiting body veil | 416.63 | 247.85 | 585.41 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.892077 | no |
| Casing | YFB_stipe_center | 0.913475 | no |
| Casing | YFB_stipe_shell | 0.905662 | no |
| Casing | YFB_stipe_skin | 0.521451 | no |
| Casing | YFB_cap_skin | 0.968244 | no |
| Casing | YFB_cap_tissue | 0.928069 | no |
| Casing | YFB_gill_tissue | 0.633359 | no |
| Casing | YFB_veil | 0.698454 | no |
| Casing | Initials | 0.056367 | no |
| Casing | Pileal_Stipeal_center | 0.579754 | no |
| Casing | Pileal_Stipeal_shell | 0.768668 | no |
| Casing | DIF_stipe_center | 0.977900 | no |
| Casing | DIF_stipe_shell | 0.819669 | no |
| Casing | DIF_stipe_skin | 0.537701 | no |
| Casing | DIF_cap_skin | 0.983274 | no |
| Casing | DIF_cap_tissue | 0.991451 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.984209 | no |
| DIF_gill_tissue | YFB_stipe_shell | 0.990194 | no |
| DIF_gill_tissue | YFB_stipe_skin | 0.677387 | no |
| DIF_gill_tissue | YFB_cap_skin | 0.928303 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.797513 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.792498 | no |
| DIF_gill_tissue | YFB_veil | 0.852254 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.993704 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.647664 | no |
| YFB_stipe_center | YFB_cap_skin | 0.945318 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.816937 | no |
| YFB_stipe_center | YFB_gill_tissue | 0.764560 | no |
| YFB_stipe_center | YFB_veil | 0.825244 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.658772 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.939504 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.812322 | no |
| YFB_stipe_shell | YFB_gill_tissue | 0.777569 | no |
| YFB_stipe_shell | YFB_veil | 0.838421 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.553908 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.395511 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.926693 | no |
| YFB_stipe_skin | YFB_veil | 0.875444 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.890234 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.679200 | no |
| YFB_cap_skin | YFB_veil | 0.743491 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.506875 | no |
| YFB_cap_tissue | YFB_veil | 0.577482 | no |
| YFB_gill_tissue | YFB_veil | 0.959147 | no |
| Initials | DIF_gill_tissue | 0.100086 | no |
| Initials | YFB_stipe_center | 0.094162 | no |
| Initials | YFB_stipe_shell | 0.091998 | no |
| Initials | YFB_stipe_skin | 0.374879 | no |
| Initials | YFB_cap_skin | 0.062038 | no |
| Initials | YFB_cap_tissue | 0.027943 | yes |
| Initials | YFB_gill_tissue | 0.270753 | no |
| Initials | YFB_veil | 0.214821 | no |
| Initials | Pileal_Stipeal_center | 0.317790 | no |
| Initials | Pileal_Stipeal_shell | 0.175423 | no |
| Initials | DIF_stipe_center | 0.057550 | no |
| Initials | DIF_stipe_shell | 0.142080 | no |
| Initials | DIF_stipe_skin | 0.368152 | no |
| Initials | DIF_cap_skin | 0.051723 | no |
| Initials | DIF_cap_tissue | 0.052745 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.737672 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.717531 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.723910 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.962855 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.618630 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.460239 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.968104 | no |
| Pileal_Stipeal_center | YFB_veil | 0.923027 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.875284 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.613986 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.820972 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.971764 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.551514 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.586609 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.901062 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.883358 | no |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.890395 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.824098 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.808719 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.650521 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.915583 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.961158 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.798913 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.962135 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.834557 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.742346 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.774007 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.917939 | no |
| DIF_stipe_center | YFB_stipe_center | 0.937270 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.930817 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.543603 | no |
| DIF_stipe_center | YFB_cap_skin | 0.990639 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.898323 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.665704 | no |
| DIF_stipe_center | YFB_veil | 0.731202 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.849092 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.558591 | no |
| DIF_stipe_center | DIF_cap_skin | 0.960287 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.984649 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.944481 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.928614 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.934784 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.765703 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.861769 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.713239 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.868950 | no |
| DIF_stipe_shell | YFB_veil | 0.920085 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.778671 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.799556 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.829637 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.696294 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.673977 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.681876 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.990120 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.572275 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.415435 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.937631 | no |
| DIF_stipe_skin | YFB_veil | 0.890615 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.506143 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.540745 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.871197 | no |
| DIF_cap_skin | YFB_stipe_center | 0.893347 | no |
| DIF_cap_skin | YFB_stipe_shell | 0.885187 | no |
| DIF_cap_skin | YFB_stipe_skin | 0.489586 | no |
| DIF_cap_skin | YFB_cap_skin | 0.950430 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.946288 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.604756 | no |
| DIF_cap_skin | YFB_veil | 0.673479 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.974478 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.899325 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.920732 | no |
| DIF_cap_tissue | YFB_stipe_shell | 0.913393 | no |
| DIF_cap_tissue | YFB_stipe_skin | 0.523069 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.975970 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.917851 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.641197 | no |
| DIF_cap_tissue | YFB_veil | 0.707940 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|007440 MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSATVMVDGKTISLGLWDTAGQEDYDRLRPLSYPQT DVFLICFSLVSPPSYENVRTKWYPEITHHAPATQIVLVGTKLDLREDQQTIEKLRDRRMAPISYSQGVAMGREIG AVKYLECSALTQKGLKTVFDEAIRAVLNPHPPNKERGGKKMCIIA* |
| Coding | >AgabiH97|007440 ATGCAAGCTATTAAATGTGTCGTCGTTGGAGACGGTGCTGTAGGAAAGACATGTCTGCTCATCTCATATACCACA AATGCTTTCCCGGGAGAGTACATTCCAACGGTGTTCGACAATTATTCAGCGACGGTTATGGTGGATGGAAAGACT ATTTCTCTCGGGTTGTGGGATACCGCTGGTCAAGAAGATTATGATCGACTCCGACCTCTATCATACCCGCAGACA GATGTTTTTCTGATCTGCTTCTCCTTGGTTAGCCCTCCTAGCTATGAGAACGTCAGGACTAAGTGGTATCCTGAG ATCACTCACCATGCTCCAGCAACTCAGATCGTGCTGGTGGGCACTAAGCTCGATCTACGTGAAGACCAGCAAACT ATCGAGAAATTGCGGGACCGACGTATGGCGCCCATTTCATATTCTCAAGGTGTCGCTATGGGCAGAGAAATCGGG GCAGTGAAGTATTTGGAATGTTCTGCACTCACCCAGAAAGGTCTTAAGACAGTTTTTGATGAAGCGATTAGAGCA GTCCTGAACCCTCACCCGCCCAACAAGGAGAGAGGAGGCAAGAAGATGTGTATCATTGCCTGA |
| Transcript | >AgabiH97|007440 ATGCAAGCTATTAAATGTGTCGTCGTTGGAGACGGTGCTGTAGGAAAGACATGTCTGCTCATCTCATATACCACA AATGCTTTCCCGGGAGAGTACATTCCAACGGTGTTCGACAATTATTCAGCGACGGTTATGGTGGATGGAAAGACT ATTTCTCTCGGGTTGTGGGATACCGCTGGTCAAGAAGATTATGATCGACTCCGACCTCTATCATACCCGCAGACA GATGTTTTTCTGATCTGCTTCTCCTTGGTTAGCCCTCCTAGCTATGAGAACGTCAGGACTAAGTGGTATCCTGAG ATCACTCACCATGCTCCAGCAACTCAGATCGTGCTGGTGGGCACTAAGCTCGATCTACGTGAAGACCAGCAAACT ATCGAGAAATTGCGGGACCGACGTATGGCGCCCATTTCATATTCTCAAGGTGTCGCTATGGGCAGAGAAATCGGG GCAGTGAAGTATTTGGAATGTTCTGCACTCACCCAGAAAGGTCTTAAGACAGTTTTTGATGAAGCGATTAGAGCA GTCCTGAACCCTCACCCGCCCAACAAGGAGAGAGGAGGCAAGAAGATGTGTATCATTGCCTGA |
| Gene | >AgabiH97|007440 ATGCAAGCTATTAAATGTGCGTTTCTATACGCTGACCAAAGTATAAACCACTCAGCTAACTTCGTTTAGGTGTCG TCGTTGGAGACGGTGCTGTAGGAAAGGTGTGCCAATTTCGCAAACTGTTCAAGACGACAACTCATATAAATGGGT ATCTAGACATGTCTGCTCATCTCATATACCACAAATGCTTTCCCGGTATGTAGCTAGGCTCTTACCATTCCATCT GTAATTGAAACAATCTCAGGGAGAGTACATTCCAACGGGTATATCAACAACATTATTGCACGGAAACAGTCCTGA CACAATTCCACCTAGTGTTCGACAATTATTCAGCGACGGTTATGGTGGATGGAAAGACTATTTCTCTCGGGTTGT GGGATACCGCTGGTCAAGAAGATTATGATCGACTCCGACCTCTATCATACCCGCAGACAGATGTTTTTCTGATCT GCTTCTCCTTGGTTAGCCCTCCTAGCTATGAGAACGTCAGGACTAAGGTCGGTGCAAGTCCCGCTGCAGGAATTA CCACTGACAACTCCGGGTTCAGTGGTATCCTGAGATCACTCACCATGCTCCAGCAACTCAGATCGTGCTGGTGGG CACTAAGCTCGATCTACGTGAAGACCAGCAAACTATCGAGAAATTGCGGGACCGGTAAATCGTTTTTTAAGGCAA GCGGATGGCTTGCTGAAATTTTTCATTAGACGTATGGCGCCCATTTCATATTCTCAAGGTGTCGCTATGGGCAGA GAAATCGGGGCAGTGAAGTATTTGGAATGTTCTGCACTCACCCAGAAAGGTCTTAAGACAGTTTTTGATGAAGCG ATTAGAGCAGTCCGTAAGTTGAAAATAAATCGTCATACTATCACGACATCCTAATGATTTATCATCAGTGAACCC TCACCCGCCCAACAAGGAGAGAGGAGGCAAGAAGATGTGTATCATTGCCTGA |