Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|007360
Gene name
Locationscaffold_1:1745604..1747300
Strand+
Gene length (bp)1696
Transcript length (bp)1323
Coding sequence length (bp)1323
Protein length (aa) 441

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family 1.2E-25 67 428

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7M8|YNTB_SCHPO Probable RNA exonuclease C9B6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC9B6.11c PE=3 SV=1 18 433 7.0E-43
sp|Q03264|NGL2_YEAST RNA exonuclease NGL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGL2 PE=1 SV=1 63 435 5.0E-39
sp|Q03210|NGL3_YEAST Probable RNA exonuclease NGL3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGL3 PE=1 SV=1 45 435 6.0E-38
sp|P31384|CCR4_YEAST Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCR4 PE=1 SV=2 60 261 1.0E-20
sp|Q6AXU9|CNOT6_RAT CCR4-NOT transcription complex subunit 6 OS=Rattus norvegicus GN=Cnot6 PE=2 SV=1 48 435 5.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7M8|YNTB_SCHPO Probable RNA exonuclease C9B6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC9B6.11c PE=3 SV=1 18 433 7.0E-43
sp|Q03264|NGL2_YEAST RNA exonuclease NGL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGL2 PE=1 SV=1 63 435 5.0E-39
sp|Q03210|NGL3_YEAST Probable RNA exonuclease NGL3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NGL3 PE=1 SV=1 45 435 6.0E-38
sp|P31384|CCR4_YEAST Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCR4 PE=1 SV=2 60 261 1.0E-20
sp|Q6AXU9|CNOT6_RAT CCR4-NOT transcription complex subunit 6 OS=Rattus norvegicus GN=Cnot6 PE=2 SV=1 48 435 5.0E-18
sp|Q8K3P5|CNOT6_MOUSE CCR4-NOT transcription complex subunit 6 OS=Mus musculus GN=Cnot6 PE=1 SV=2 48 435 5.0E-18
sp|Q5BJ41|CNOT6_XENLA CCR4-NOT transcription complex subunit 6 OS=Xenopus laevis GN=cnot6 PE=1 SV=1 48 435 6.0E-18
sp|Q9ULM6|CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 OS=Homo sapiens GN=CNOT6 PE=1 SV=2 8 435 1.0E-17
sp|Q96LI5|CNO6L_HUMAN CCR4-NOT transcription complex subunit 6-like OS=Homo sapiens GN=CNOT6L PE=1 SV=2 8 434 2.0E-17
sp|Q8VEG6|CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-like OS=Mus musculus GN=Cnot6l PE=1 SV=2 8 434 1.0E-16
sp|Q5XH73|CN6LB_XENLA CCR4-NOT transcription complex subunit 6-like-B OS=Xenopus laevis GN=cnot6l-b PE=2 SV=1 8 435 2.0E-16
sp|A8MS41|CCR4D_ARATH Carbon catabolite repressor protein 4 homolog 4 OS=Arabidopsis thaliana GN=CCR4-4 PE=1 SV=1 63 263 3.0E-16
sp|Q75BI3|CCR4_ASHGO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CCR4 PE=3 SV=1 60 272 7.0E-16
sp|Q6CJU4|CCR4_KLULA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCR4 PE=3 SV=1 60 272 1.0E-15
sp|Q6IR85|CN6LA_XENLA CCR4-NOT transcription complex subunit 6-like-A OS=Xenopus laevis GN=cnot6l-a PE=2 SV=1 8 272 2.0E-15
sp|Q24239|ANGEL_DROME Protein angel OS=Drosophila melanogaster GN=angel PE=1 SV=2 48 264 7.0E-15
sp|Q3TIU4|PDE12_MOUSE 2',5'-phosphodiesterase 12 OS=Mus musculus GN=Pde12 PE=1 SV=2 61 284 9.0E-15
sp|Q08DF7|PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus GN=PDE12 PE=1 SV=1 61 277 2.0E-14
sp|Q6FRT2|CCR4_CANGA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CCR4 PE=3 SV=1 59 262 2.0E-14
sp|Q5A761|CCR4_CANAL Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCR4 PE=3 SV=1 58 262 3.0E-14
sp|A6H7I3|ANGE2_BOVIN Protein angel homolog 2 OS=Bos taurus GN=ANGEL2 PE=2 SV=1 52 267 3.0E-14
sp|Q5VTE6|ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens GN=ANGEL2 PE=2 SV=1 57 267 5.0E-14
sp|Q6L8Q7|PDE12_HUMAN 2',5'-phosphodiesterase 12 OS=Homo sapiens GN=PDE12 PE=1 SV=2 61 277 5.0E-14
sp|Q6AXQ5|PDE12_RAT 2',5'-phosphodiesterase 12 OS=Rattus norvegicus GN=Pde12 PE=2 SV=1 61 277 7.0E-14
sp|Q9LS39|CCR4C_ARATH Carbon catabolite repressor protein 4 homolog 3 OS=Arabidopsis thaliana GN=CCR4-3 PE=2 SV=2 44 435 8.0E-14
sp|A2BHJ4|CNO6L_DANRE CCR4-NOT transcription complex subunit 6-like OS=Danio rerio GN=cnot6l PE=2 SV=1 8 437 1.0E-13
sp|Q5RGT6|ANGE2_DANRE Protein angel homolog 2 OS=Danio rerio GN=angel2 PE=2 SV=1 63 269 1.0E-13
sp|Q8K1C0|ANGE2_MOUSE Protein angel homolog 2 OS=Mus musculus GN=Angel2 PE=1 SV=1 58 267 1.0E-13
sp|P0CP23|CCR4_CRYNB Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCR4 PE=3 SV=1 47 276 1.0E-12
sp|P0CP22|CCR4_CRYNJ Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCR4 PE=3 SV=1 47 276 1.0E-12
sp|Q6BMM5|CCR4_DEBHA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCR4 PE=3 SV=2 63 272 3.0E-12
sp|B7XK66|CCR4_ENTBH Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Enterocytozoon bieneusi (strain H348) GN=CCR4 PE=3 SV=1 48 266 3.0E-12
sp|Q9M2F8|CCR4B_ARATH Carbon catabolite repressor protein 4 homolog 2 OS=Arabidopsis thaliana GN=CCR4-2 PE=2 SV=2 16 272 4.0E-12
sp|Q4P9T3|CCR4_USTMA Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CCR4 PE=3 SV=1 60 276 2.0E-11
sp|Q8W0Z9|CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana GN=CCR4-1 PE=2 SV=1 44 281 4.0E-11
sp|A2Q9L0|CCR4_ASPNC Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ccr4 PE=3 SV=1 92 295 5.0E-11
sp|Q8VYU4|CCR4F_ARATH Carbon catabolite repressor protein 4 homolog 6 OS=Arabidopsis thaliana GN=CCR4-6 PE=2 SV=2 54 267 8.0E-11
sp|P79942|NOCT_XENLA Nocturnin OS=Xenopus laevis GN=noct PE=1 SV=1 55 267 1.0E-10
sp|Q1EA11|CCR4_COCIM Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Coccidioides immitis (strain RS) GN=CCR4 PE=3 SV=2 63 436 3.0E-10
sp|C4V7I7|CCR4_NOSCE Probable glucose-repressible alcohol dehydrogenase transcriptional effector homolog OS=Nosema ceranae (strain BRL01) GN=CCR4 PE=3 SV=1 48 268 3.0E-10
sp|Q6CEJ6|CCR4_YARLI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCR4 PE=3 SV=1 63 272 4.0E-10
sp|Q0CT27|CCR4_ASPTN Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ccr4 PE=3 SV=1 48 272 1.0E-09
sp|O35710|NOCT_MOUSE Nocturnin OS=Mus musculus GN=Noct PE=1 SV=3 61 267 1.0E-09
sp|O74874|CCR4_SCHPO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccr4 PE=3 SV=1 54 276 2.0E-09
sp|Q9ET55|NOCT_RAT Nocturnin OS=Rattus norvegicus GN=Noct PE=2 SV=2 63 267 3.0E-09
sp|Q5B778|CCR4_EMENI Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccr4 PE=3 SV=1 81 272 4.0E-09
sp|Q9UK39|NOCT_HUMAN Nocturnin OS=Homo sapiens GN=NOCT PE=2 SV=2 63 267 5.0E-09
sp|Q0WKY2|CCR4E_ARATH Carbon catabolite repressor protein 4 homolog 5 OS=Arabidopsis thaliana GN=CCR4-5 PE=2 SV=2 87 282 1.0E-08
sp|Q0U7W4|CCR4_PHANO Glucose-repressible alcohol dehydrogenase transcriptional effector OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CCR4 PE=3 SV=2 47 272 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|007360
MFSPSTRMSTRPLSQADLAKQAARLKKRLANADSANVAVHVLRSIIQRPWIPVPSPAEKRSTFKVFTWNLLAQCL
VRRELFPTSDCLKAAQREKMLKDELLSTDADILCLQEVDRLEKVLPILDKAGYSHRYAAGKDKKHGCLIAFKRQR
FEQIHERVVFYDDQTVRDATDERAQRGHSFRTKNIGLILALRNQHDPTCGIIVATTHLFWHPKYTYERARQAGIL
VREVVDLQKQQHAEGWPCIIAGDFNCTPNDAAYSLLTGQPLNNDHKDHLSHSRVTHVSVDPTVPKSSVNSAEDEG
ESEESDPDRIITNARSATETDGLLNNAELVSLYTKGHVLQSAYNEGLSRIDSPGIALYGGREHLPTTQPGFHEPS
YTCYTHYWKSVLDYIFFIPPQHQSLNVTSLLAPHRTEDFGNGLPMNGVCASDHISLAAEFSWTRQ*
Coding >AgabiH97|007360
ATGTTCTCACCCTCCACCCGCATGTCCACTCGCCCCCTTTCACAGGCCGACCTCGCAAAGCAAGCAGCCCGTCTC
AAAAAGAGGCTCGCCAACGCTGACTCTGCGAATGTCGCCGTCCACGTTCTGCGCTCGATCATCCAACGACCTTGG
ATTCCAGTTCCGTCACCCGCGGAAAAGCGCTCGACTTTCAAGGTCTTTACATGGAATCTTTTAGCCCAATGCCTA
GTTCGGAGAGAGCTTTTCCCTACTAGCGACTGTCTAAAGGCTGCACAGAGAGAGAAAATGCTAAAGGACGAACTA
TTATCCACGGACGCCGACATTCTTTGTCTTCAGGAAGTCGATCGCCTCGAAAAGGTCCTTCCCATTCTCGACAAA
GCCGGCTACTCTCACAGATATGCCGCCGGTAAAGACAAAAAGCATGGGTGTTTGATTGCCTTCAAGAGGCAGCGT
TTCGAACAGATACATGAACGAGTCGTTTTCTATGACGATCAAACCGTTAGGGATGCGACCGACGAAAGAGCGCAA
CGGGGACATAGTTTTAGGACGAAGAACATAGGTTTAATTCTGGCCTTGCGTAACCAGCATGACCCGACTTGTGGC
ATCATTGTTGCCACCACTCATTTGTTTTGGCACCCCAAATATACCTACGAACGAGCTAGACAAGCTGGCATACTC
GTCAGAGAGGTCGTTGACTTGCAAAAACAGCAGCATGCCGAAGGTTGGCCATGCATCATTGCAGGAGATTTTAAC
TGCACACCCAATGACGCAGCATACAGTCTTTTAACCGGTCAACCTCTAAATAACGACCACAAAGATCACCTTTCT
CATTCGCGCGTCACTCACGTTTCAGTCGATCCTACGGTCCCAAAATCCTCCGTAAACTCTGCTGAAGACGAAGGT
GAATCCGAGGAATCCGATCCTGACCGGATAATAACCAATGCACGTAGTGCAACGGAAACGGATGGTCTTTTAAAT
AATGCGGAATTGGTTTCCTTATATACCAAAGGACATGTTTTACAAAGCGCATATAACGAAGGGTTGTCACGAATT
GATTCCCCTGGCATCGCCTTGTACGGTGGACGCGAACATTTGCCTACTACACAACCAGGATTCCATGAACCTTCT
TACACATGTTATACGCATTACTGGAAGTCAGTCTTAGATTACATATTTTTCATCCCACCTCAACACCAGTCGTTA
AATGTCACGAGTCTTTTGGCTCCCCATCGTACTGAGGACTTTGGCAACGGTCTTCCGATGAATGGTGTCTGTGCC
AGTGATCACATTTCCCTTGCTGCTGAATTTTCCTGGACGAGACAGTAG
Transcript >AgabiH97|007360
ATGTTCTCACCCTCCACCCGCATGTCCACTCGCCCCCTTTCACAGGCCGACCTCGCAAAGCAAGCAGCCCGTCTC
AAAAAGAGGCTCGCCAACGCTGACTCTGCGAATGTCGCCGTCCACGTTCTGCGCTCGATCATCCAACGACCTTGG
ATTCCAGTTCCGTCACCCGCGGAAAAGCGCTCGACTTTCAAGGTCTTTACATGGAATCTTTTAGCCCAATGCCTA
GTTCGGAGAGAGCTTTTCCCTACTAGCGACTGTCTAAAGGCTGCACAGAGAGAGAAAATGCTAAAGGACGAACTA
TTATCCACGGACGCCGACATTCTTTGTCTTCAGGAAGTCGATCGCCTCGAAAAGGTCCTTCCCATTCTCGACAAA
GCCGGCTACTCTCACAGATATGCCGCCGGTAAAGACAAAAAGCATGGGTGTTTGATTGCCTTCAAGAGGCAGCGT
TTCGAACAGATACATGAACGAGTCGTTTTCTATGACGATCAAACCGTTAGGGATGCGACCGACGAAAGAGCGCAA
CGGGGACATAGTTTTAGGACGAAGAACATAGGTTTAATTCTGGCCTTGCGTAACCAGCATGACCCGACTTGTGGC
ATCATTGTTGCCACCACTCATTTGTTTTGGCACCCCAAATATACCTACGAACGAGCTAGACAAGCTGGCATACTC
GTCAGAGAGGTCGTTGACTTGCAAAAACAGCAGCATGCCGAAGGTTGGCCATGCATCATTGCAGGAGATTTTAAC
TGCACACCCAATGACGCAGCATACAGTCTTTTAACCGGTCAACCTCTAAATAACGACCACAAAGATCACCTTTCT
CATTCGCGCGTCACTCACGTTTCAGTCGATCCTACGGTCCCAAAATCCTCCGTAAACTCTGCTGAAGACGAAGGT
GAATCCGAGGAATCCGATCCTGACCGGATAATAACCAATGCACGTAGTGCAACGGAAACGGATGGTCTTTTAAAT
AATGCGGAATTGGTTTCCTTATATACCAAAGGACATGTTTTACAAAGCGCATATAACGAAGGGTTGTCACGAATT
GATTCCCCTGGCATCGCCTTGTACGGTGGACGCGAACATTTGCCTACTACACAACCAGGATTCCATGAACCTTCT
TACACATGTTATACGCATTACTGGAAGTCAGTCTTAGATTACATATTTTTCATCCCACCTCAACACCAGTCGTTA
AATGTCACGAGTCTTTTGGCTCCCCATCGTACTGAGGACTTTGGCAACGGTCTTCCGATGAATGGTGTCTGTGCC
AGTGATCACATTTCCCTTGCTGCTGAATTTTCCTGGACGAGACAGTAG
Gene >AgabiH97|007360
ATGTTCTCACCCTCCACCCGCATGTCCACTCGCCCCCTTTCACAGGCCGACCTCGCAAAGCAAGCAGCCCGTCTC
AAAAAGAGGCTCGCCAACGCTGACTCTGCGAATGTCGCCGTCCACGTTCTGCGCTCGATCATCCAACGACCTTGG
ATTCCAGTTCCGTCACCCGCGGAAAAGCGCTCGACTTTCAAGGTCTTTACATGGAATGCGAGTGTGCACAGTTTT
TCTCCCTTCCATATATCCCTAACATACCCACAGCTTTTAGCCCAATGCCTAGTTCGTATGTCAGCTGCACCACTT
CCCGTCGCGAACTGCTTCAATCGGTCGTCCTTTAGGGAGAGAGCTTTTCCCTACTAGCGACTGTCTAAAGGCTGC
ACAGAGAGAGAAAATGCTAAAGGACGAACTATTATCCACGGACGCCGACATTCTTTGTCTTCAGGTCCGTCATCA
AAATCCTCATTCAATTGTAATTCAAGACGCCGAAACCCTACCAGGAAGTCGATCGCCTCGAAAAGGTCCTTCCCA
TTCTCGACAAAGCCGGCTACTCTCACAGATATGCCGCCGGTAAAGACAAAAAGCATGGGTGTTTGATTGCCTTCA
AGAGGCAGCGTTTCGAACAGATACATGAACGAGTCGTTTTCTATGACGATCAAACCGTTAGGGATGCGACCGACG
AAAGAGCGCAACGGGGACATAGTTTTAGGACGAAGAACATAGGTTTAATTCTGGCCTTGCGTAACCAGCATGACC
CGACTTGTGGCATCATTGTTGCCACCACTCATTTGTTTTGGCACCCCAAGTGTGTTCGCACCTCATTCTTATCTA
TTCATTTACTGACTAGATCATAGATATACCTACGAACGAGCTAGGTGACCAAGTTGTCCCCATTTTCTTTTTTAC
GCCATCTAAATCTGGATTGTTAGACAAGCTGGCATACTCGTCAGAGAGGTCGTTGACTTGCAAAAACAGCAGCAT
GCCGAAGGTTGGCCATGCATCATTGCAGGAGGTACTTTCTCCTTTACCATCCTTCGCAGTACATCATGACATCCG
CTCTCAACAGATTTTAACTGCACACCCAATGACGCAGCATACAGTCTTTTAACCGGTCAACCTCTAAATAACGAC
CACAAAGATCACCTTTCTCATTCGCGCGTCACTCACGTTTCAGTCGATCCTACGGTCCCAAAATCCTCCGTAAAC
TCTGCTGAAGACGAAGGTGAATCCGAGGAATCCGATCCTGACCGGATAATAACCAATGCACGTAGTGCAACGGAA
ACGGATGGTCTTTTAAATAATGCGGAATTGGTTTCCTTATATACCAAAGGACATGTTTTACAAAGCGCATATAAC
GAAGGGTTGTCACGAATTGATTCCCCTGGCATCGCCTTGTACGGTGGACGCGAACATTTGCCTACTACACAACCA
GGATTCCATGAACCTTCTTACACATGTTATACGCATTACTGGAAGTCAGTCTTAGGTGAGTTTAGATTTTAACCG
TCAGAACCATCTTCTTGATGATAACGCAATCCAAGATTACATATTTTTCATCCCACCTCAACACCAGTCGTTAAA
TGTCACGAGTCTTTTGGCTCCCCATCGTACTGAGGACTTTGGCAACGGTCTTCCGATGAATGGTGTCTGTGCCAG
TGATCACATTTCCCTTGCTGCTGAATTTTCCTGGACGAGACAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail