Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|007330
Gene name
Locationscaffold_1:1738181..1739308
Strand+
Gene length (bp)1127
Transcript length (bp)1023
Coding sequence length (bp)1023
Protein length (aa) 341

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 9.7E-11 28 88
PF00013 KH_1 KH domain 2.6E-12 112 174
PF00013 KH_1 KH domain 2.1E-15 252 316

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74919|RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnc1 PE=1 SV=1 25 326 5.0E-105
sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=1 SV=1 24 323 7.0E-42
sp|P57723|PCBP4_HUMAN Poly(rC)-binding protein 4 OS=Homo sapiens GN=PCBP4 PE=2 SV=1 24 337 2.0E-41
sp|Q0VCU0|PCBP4_BOVIN Poly(rC)-binding protein 4 OS=Bos taurus GN=PCBP4 PE=2 SV=1 24 323 2.0E-41
sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 16 322 4.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74919|RNC1_SCHPO RNA-binding protein rnc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnc1 PE=1 SV=1 25 326 5.0E-105
sp|P57724|PCBP4_MOUSE Poly(rC)-binding protein 4 OS=Mus musculus GN=Pcbp4 PE=1 SV=1 24 323 7.0E-42
sp|P57723|PCBP4_HUMAN Poly(rC)-binding protein 4 OS=Homo sapiens GN=PCBP4 PE=2 SV=1 24 337 2.0E-41
sp|Q0VCU0|PCBP4_BOVIN Poly(rC)-binding protein 4 OS=Bos taurus GN=PCBP4 PE=2 SV=1 24 323 2.0E-41
sp|P57721|PCBP3_HUMAN Poly(rC)-binding protein 3 OS=Homo sapiens GN=PCBP3 PE=2 SV=2 16 322 4.0E-41
sp|P57722|PCBP3_MOUSE Poly(rC)-binding protein 3 OS=Mus musculus GN=Pcbp3 PE=1 SV=3 24 322 6.0E-41
sp|Q61990|PCBP2_MOUSE Poly(rC)-binding protein 2 OS=Mus musculus GN=Pcbp2 PE=1 SV=1 24 322 2.0E-33
sp|O19048|PCBP1_RABIT Poly(rC)-binding protein 1 OS=Oryctolagus cuniculus GN=PCBP1 PE=2 SV=1 24 323 1.0E-32
sp|P60335|PCBP1_MOUSE Poly(rC)-binding protein 1 OS=Mus musculus GN=Pcbp1 PE=1 SV=1 24 323 1.0E-32
sp|Q15365|PCBP1_HUMAN Poly(rC)-binding protein 1 OS=Homo sapiens GN=PCBP1 PE=1 SV=2 24 323 1.0E-32
sp|Q5E9A3|PCBP1_BOVIN Poly(rC)-binding protein 1 OS=Bos taurus GN=PCBP1 PE=2 SV=1 24 323 1.0E-32
sp|P38151|PBP2_YEAST PAB1-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBP2 PE=1 SV=1 16 326 8.0E-32
sp|C5DIR2|HEK2_LACTC Heterogeneous nuclear rnp K-like protein 2 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=HEK2 PE=3 SV=1 22 326 9.0E-31
sp|Q6CNI6|HEK2_KLULA Heterogeneous nuclear rnp K-like protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HEK2 PE=3 SV=1 23 331 4.0E-26
sp|Q756R8|HEK2_ASHGO Heterogeneous nuclear rnp K-like protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HEK2 PE=3 SV=1 34 330 5.0E-26
sp|C5E0I9|HEK2_ZYGRC Heterogeneous nuclear rnp K-like protein 2 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=HEK2 PE=3 SV=1 22 333 1.0E-24
sp|A7TT46|HEK2_VANPO Heterogeneous nuclear rnp K-like protein 2 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=HEK2 PE=3 SV=1 28 326 1.0E-24
sp|B3LNH0|HEK2_YEAS1 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=HEK2 PE=3 SV=1 22 326 5.0E-23
sp|P38199|HEK2_YEAST Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEK2 PE=1 SV=1 22 326 6.0E-23
sp|A6ZKR5|HEK2_YEAS7 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=HEK2 PE=3 SV=1 22 326 6.0E-23
sp|C8Z3W4|HEK2_YEAS8 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=HEK2 PE=3 SV=1 22 326 8.0E-23
sp|C7GND0|HEK2_YEAS2 Heterogeneous nuclear rnp K-like protein 2 OS=Saccharomyces cerevisiae (strain JAY291) GN=HEK2 PE=3 SV=1 22 326 8.0E-23
sp|O57526|IF23B_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-B OS=Xenopus laevis GN=igf2bp3-b PE=1 SV=1 19 322 4.0E-22
sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 24 180 5.0E-22
sp|Q6FUD8|HEK2_CANGA Heterogeneous nuclear rnp K-like protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HEK2 PE=3 SV=1 28 329 4.0E-21
sp|Q5RB68|IF2B2_PONAB Insulin-like growth factor 2 mRNA-binding protein 2 OS=Pongo abelii GN=IGF2BP2 PE=2 SV=1 1 322 9.0E-21
sp|O73932|IF23A_XENLA Insulin-like growth factor 2 mRNA-binding protein 3-A OS=Xenopus laevis GN=igf2bp3-a PE=1 SV=1 19 322 8.0E-20
sp|Q9PW80|IF2B3_DANRE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Danio rerio GN=igf2bp3 PE=1 SV=1 9 322 6.0E-19
sp|O00425|IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens GN=IGF2BP3 PE=1 SV=2 25 322 5.0E-18
sp|Q5SF07|IF2B2_MOUSE Insulin-like growth factor 2 mRNA-binding protein 2 OS=Mus musculus GN=Igf2bp2 PE=1 SV=1 1 322 6.0E-18
sp|Q5ZLP8|IF2B3_CHICK Insulin-like growth factor 2 mRNA-binding protein 3 OS=Gallus gallus GN=IGF2BP3 PE=2 SV=1 9 322 7.0E-18
sp|O42254|IF2B1_CHICK Insulin-like growth factor 2 mRNA-binding protein 1 OS=Gallus gallus GN=IGF2BP1 PE=1 SV=1 27 322 7.0E-18
sp|Q9Y6M1|IF2B2_HUMAN Insulin-like growth factor 2 mRNA-binding protein 2 OS=Homo sapiens GN=IGF2BP2 PE=1 SV=2 1 322 3.0E-17
sp|Q9CPN8|IF2B3_MOUSE Insulin-like growth factor 2 mRNA-binding protein 3 OS=Mus musculus GN=Igf2bp3 PE=1 SV=1 25 322 4.0E-16
sp|Q9NZI8|IF2B1_HUMAN Insulin-like growth factor 2 mRNA-binding protein 1 OS=Homo sapiens GN=IGF2BP1 PE=1 SV=2 10 322 6.0E-16
sp|Q8CGX0|IF2B1_RAT Insulin-like growth factor 2 mRNA-binding protein 1 OS=Rattus norvegicus GN=Igf2bp1 PE=1 SV=1 10 322 6.0E-16
sp|O88477|IF2B1_MOUSE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Mus musculus GN=Igf2bp1 PE=1 SV=1 18 322 7.0E-16
sp|Q08CK7|IF2B1_DANRE Insulin-like growth factor 2 mRNA-binding protein 1 OS=Danio rerio GN=igf2bp1 PE=1 SV=1 24 322 2.0E-15
sp|Q9LZ82|BTR1_ARATH Protein BTR1 OS=Arabidopsis thaliana GN=BTR1 PE=1 SV=1 2 325 3.0E-15
sp|Q3T0D0|HNRPK_BOVIN Heterogeneous nuclear ribonucleoprotein K OS=Bos taurus GN=HNRNPK PE=2 SV=1 25 180 2.0E-14
sp|O19049|HNRPK_RABIT Heterogeneous nuclear ribonucleoprotein K OS=Oryctolagus cuniculus GN=HNRNPK PE=2 SV=1 25 180 6.0E-14
sp|Q5ZIQ3|HNRPK_CHICK Heterogeneous nuclear ribonucleoprotein K OS=Gallus gallus GN=HNRNPK PE=2 SV=1 25 180 6.0E-14
sp|P61980|HNRPK_RAT Heterogeneous nuclear ribonucleoprotein K OS=Rattus norvegicus GN=Hnrnpk PE=1 SV=1 25 180 6.0E-14
sp|P61979|HNRPK_MOUSE Heterogeneous nuclear ribonucleoprotein K OS=Mus musculus GN=Hnrnpk PE=1 SV=1 25 180 6.0E-14
sp|P61978|HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens GN=HNRNPK PE=1 SV=1 25 180 6.0E-14
sp|Q4R4M6|HNRPK_MACFA Heterogeneous nuclear ribonucleoprotein K OS=Macaca fascicularis GN=HNRNPK PE=2 SV=1 25 180 7.0E-14
sp|Q5R5H8|HNRPK_PONAB Heterogeneous nuclear ribonucleoprotein K OS=Pongo abelii GN=HNRNPK PE=2 SV=1 25 180 7.0E-14
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 10 321 7.0E-14
sp|Q9SR13|FLK_ARATH Flowering locus K homology domain OS=Arabidopsis thaliana GN=FLK PE=1 SV=1 27 317 6.0E-13
sp|Q9UNW9|NOVA2_HUMAN RNA-binding protein Nova-2 OS=Homo sapiens GN=NOVA2 PE=1 SV=1 27 181 2.0E-12
sp|Q2PFW9|NOVA1_MACFA RNA-binding protein Nova-1 OS=Macaca fascicularis GN=NOVA1 PE=2 SV=1 8 185 2.0E-12
sp|Q80WA4|NOVA1_RAT RNA-binding protein Nova-1 (Fragment) OS=Rattus norvegicus GN=Nova1 PE=2 SV=1 8 185 3.0E-12
sp|Q99PF5|FUBP2_RAT Far upstream element-binding protein 2 OS=Rattus norvegicus GN=Khsrp PE=1 SV=1 15 321 2.0E-11
sp|Q92945|FUBP2_HUMAN Far upstream element-binding protein 2 OS=Homo sapiens GN=KHSRP PE=1 SV=4 15 321 2.0E-11
sp|Q3U0V1|FUBP2_MOUSE Far upstream element-binding protein 2 OS=Mus musculus GN=Khsrp PE=1 SV=2 15 321 2.0E-11
sp|Q9JKN6|NOVA1_MOUSE RNA-binding protein Nova-1 OS=Mus musculus GN=Nova1 PE=1 SV=2 8 185 4.0E-11
sp|P51513|NOVA1_HUMAN RNA-binding protein Nova-1 OS=Homo sapiens GN=NOVA1 PE=1 SV=1 8 185 7.0E-11
sp|Q96I24|FUBP3_HUMAN Far upstream element-binding protein 3 OS=Homo sapiens GN=FUBP3 PE=1 SV=2 17 315 4.0E-10
sp|Q9JKN6|NOVA1_MOUSE RNA-binding protein Nova-1 OS=Mus musculus GN=Nova1 PE=1 SV=2 112 322 9.0E-10
sp|P51513|NOVA1_HUMAN RNA-binding protein Nova-1 OS=Homo sapiens GN=NOVA1 PE=1 SV=1 112 322 3.0E-09
sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 248 322 4.0E-09
sp|Q15366|PCBP2_HUMAN Poly(rC)-binding protein 2 OS=Homo sapiens GN=PCBP2 PE=1 SV=1 111 307 5.0E-09
sp|Q9SZH4|PEP_ARATH RNA-binding KH domain-containing protein PEPPER OS=Arabidopsis thaliana GN=PEP PE=2 SV=1 27 291 6.0E-09
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 15 321 1.0E-08
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 15 321 6.0E-08
sp|Q91WJ8|FUBP1_MOUSE Far upstream element-binding protein 1 OS=Mus musculus GN=Fubp1 PE=1 SV=1 215 315 4.0E-07
sp|Q9Y2W6|TDRKH_HUMAN Tudor and KH domain-containing protein OS=Homo sapiens GN=TDRKH PE=1 SV=2 22 148 1.0E-06
sp|Q32PX7|FUBP1_RAT Far upstream element-binding protein 1 OS=Rattus norvegicus GN=Fubp1 PE=1 SV=1 215 315 2.0E-06
sp|Q80VL1|TDRKH_MOUSE Tudor and KH domain-containing protein OS=Mus musculus GN=Tdrkh PE=1 SV=1 22 148 5.0E-06
sp|Q96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 215 315 6.0E-06
sp|Q8UVD9|FUBP2_CHICK Far upstream element-binding protein 2 OS=Gallus gallus GN=KHSRP PE=1 SV=1 228 315 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|007330
MPSDQAPSPPPSRSPSHSPAPQDSLTLRALVSTKDAGVIIGKAGKNVADLREQTGVKAGVSKVIPGVHERVLTVS
GSVDAVAKAYTLIITQLVTASPASPVVSSPSTIHTSIRLLISHNLMGTIIGRNGLKIKAIQDNSGARMVASKEML
PQSTERIVEVQGAPEAIGRAVEEIGKCLLEDWERGLGTVLFHPGTVDDRSGGNRRQGSYSASPQYGAQRRANGDG
NVRARASPPASPTHSPISSQPPANLRTQNISIPSDMVGCIIGRSGTKITEIRRLSGSKISIAKAPHDETGERMFT
IVGTPEANEKALFLLYNQLESEKERRVGREAQQQQELQQE*
Coding >AgabiH97|007330
ATGCCCTCAGACCAAGCCCCCTCTCCCCCGCCCTCCCGTTCCCCCTCCCACTCCCCCGCGCCCCAGGACTCCCTC
ACCCTCCGCGCCCTCGTCAGCACAAAGGACGCAGGTGTCATCATCGGCAAGGCCGGCAAAAACGTCGCTGACCTG
CGCGAACAGACTGGCGTCAAGGCCGGCGTCAGCAAGGTCATCCCCGGCGTCCACGAACGCGTTCTCACCGTCTCC
GGCTCTGTCGACGCGGTTGCAAAGGCCTATACTCTTATCATCACTCAGCTCGTCACTGCTAGCCCTGCCTCTCCC
GTCGTCTCGTCCCCCTCCACCATTCACACTTCCATCCGCCTCCTTATCTCCCATAATCTTATGGGCACCATCATA
GGTCGCAACGGCCTCAAAATCAAGGCCATTCAAGACAACTCTGGCGCACGCATGGTAGCCTCCAAAGAAATGCTC
CCTCAATCAACCGAGCGCATCGTTGAGGTTCAGGGTGCTCCCGAGGCGATTGGACGCGCAGTCGAAGAAATCGGA
AAATGCTTGCTTGAGGACTGGGAACGAGGCCTTGGCACTGTTCTTTTCCATCCAGGCACCGTTGACGACCGCTCA
GGGGGCAATCGTCGTCAAGGTAGTTATTCCGCCTCTCCACAGTACGGCGCCCAGCGCCGTGCTAATGGCGACGGC
AATGTCCGTGCTCGCGCTTCACCTCCTGCTTCACCTACTCACTCCCCAATCTCCTCCCAACCGCCGGCCAATCTG
CGGACGCAGAACATATCGATTCCCTCTGACATGGTCGGGTGCATCATTGGACGTAGTGGCACTAAAATCACCGAG
ATCAGACGACTATCCGGTTCCAAAATCTCGATTGCCAAAGCTCCACACGACGAAACAGGCGAGCGTATGTTCACG
ATAGTCGGCACTCCTGAGGCAAATGAGAAAGCTTTGTTCCTGCTTTACAACCAACTCGAAAGCGAGAAGGAGAGG
AGAGTTGGAAGAGAGGCTCAGCAACAACAGGAACTCCAACAGGAATGA
Transcript >AgabiH97|007330
ATGCCCTCAGACCAAGCCCCCTCTCCCCCGCCCTCCCGTTCCCCCTCCCACTCCCCCGCGCCCCAGGACTCCCTC
ACCCTCCGCGCCCTCGTCAGCACAAAGGACGCAGGTGTCATCATCGGCAAGGCCGGCAAAAACGTCGCTGACCTG
CGCGAACAGACTGGCGTCAAGGCCGGCGTCAGCAAGGTCATCCCCGGCGTCCACGAACGCGTTCTCACCGTCTCC
GGCTCTGTCGACGCGGTTGCAAAGGCCTATACTCTTATCATCACTCAGCTCGTCACTGCTAGCCCTGCCTCTCCC
GTCGTCTCGTCCCCCTCCACCATTCACACTTCCATCCGCCTCCTTATCTCCCATAATCTTATGGGCACCATCATA
GGTCGCAACGGCCTCAAAATCAAGGCCATTCAAGACAACTCTGGCGCACGCATGGTAGCCTCCAAAGAAATGCTC
CCTCAATCAACCGAGCGCATCGTTGAGGTTCAGGGTGCTCCCGAGGCGATTGGACGCGCAGTCGAAGAAATCGGA
AAATGCTTGCTTGAGGACTGGGAACGAGGCCTTGGCACTGTTCTTTTCCATCCAGGCACCGTTGACGACCGCTCA
GGGGGCAATCGTCGTCAAGGTAGTTATTCCGCCTCTCCACAGTACGGCGCCCAGCGCCGTGCTAATGGCGACGGC
AATGTCCGTGCTCGCGCTTCACCTCCTGCTTCACCTACTCACTCCCCAATCTCCTCCCAACCGCCGGCCAATCTG
CGGACGCAGAACATATCGATTCCCTCTGACATGGTCGGGTGCATCATTGGACGTAGTGGCACTAAAATCACCGAG
ATCAGACGACTATCCGGTTCCAAAATCTCGATTGCCAAAGCTCCACACGACGAAACAGGCGAGCGTATGTTCACG
ATAGTCGGCACTCCTGAGGCAAATGAGAAAGCTTTGTTCCTGCTTTACAACCAACTCGAAAGCGAGAAGGAGAGG
AGAGTTGGAAGAGAGGCTCAGCAACAACAGGAACTCCAACAGGAATGA
Gene >AgabiH97|007330
ATGCCCTCAGACCAAGGTTAGTCCCCTCCCCCCATCCCCCGCCCCGCGTCCTCACCGTCCCGCCCAGCCCCCTCT
CCCCCGCCCTCCCGTTCCCCCTCCCACTCCCCCGCGCCCCAGGACTCCCTCACCCTCCGCGCCCTCGTCAGCACA
AAGGACGCAGGTGTCATCATCGGCAAGGCCGGCAAAAACGTCGCTGACCTGCGCGAACAGACTGGCGTCAAGGCC
GGCGTCAGCAAGGTCATCCCCGGCGTCCACGAACGCGTTCTCACCGTCTCCGGCTCTGTCGACGCGGTTGCAAAG
GCGCGTCCTTGTTTTCTTTGTTCACTTTGATCGCTCCCTGACTTCATCCCCAGGCCTATACTCTTATCATCACTC
AGCTCGTCACTGCTAGCCCTGCCTCTCCCGTCGTCTCGTCCCCCTCCACCATTCACACTTCCATCCGCCTCCTTA
TCTCCCATAATCTTATGGGCACCATCATAGGTCGCAACGGCCTCAAAATCAAGGCCATTCAAGACAACTCTGGCG
CACGCATGGTAGCCTCCAAAGAAATGCTCCCTCAATCAACCGAGCGCATCGTTGAGGTTCAGGGTGCTCCCGAGG
CGATTGGACGCGCAGTCGAAGAAATCGGAAAATGCTTGCTTGAGGACTGGGAACGAGGCCTTGGCACTGTTCTTT
TCCATCCAGGCACCGTTGACGACCGCTCAGGGGGCAATCGTCGTCAAGGTAGTTATTCCGCCTCTCCACAGTACG
GCGCCCAGCGCCGTGCTAATGGCGACGGCAATGTCCGTGCTCGCGCTTCACCTCCTGCTTCACCTACTCACTCCC
CAATCTCCTCCCAACCGCCGGCCAATCTGCGGACGCAGAACATATCGATTCCCTCTGACATGGTCGGGTGCATCA
TTGGACGTAGTGGCACTAAAATCACCGAGATCAGACGACTATCCGGTTCCAAAATCTCGATTGCCAAAGCTCCAC
ACGACGAAACAGGCGAGCGTATGTTCACGATAGTCGGCACTCCTGAGGCAAATGAGAAAGCTTTGTTCCTGCTTT
ACAACCAACTCGAAAGCGAGAAGGAGAGGAGAGTTGGAAGAGAGGCTCAGCAACAACAGGAACTCCAACAGGAAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail