Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|007280
Gene name
Locationscaffold_1:1731781..1732943
Strand+
Gene length (bp)1162
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ARV2|AIM6_ARTBC Altered inheritance of mitochondria protein 6 homolog ARB_06966 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06966 PE=1 SV=1 35 317 4.0E-57
sp|C5DYR9|AIM6_ZYGRC Altered inheritance of mitochondria protein 6 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM6 PE=3 SV=1 42 316 1.0E-31
sp|Q75E59|AIM6_ASHGO Altered inheritance of mitochondria protein 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AIM6 PE=3 SV=1 52 317 1.0E-30
sp|Q6CQ63|AIM6_KLULA Altered inheritance of mitochondria protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM6 PE=3 SV=1 42 317 1.0E-30
sp|C5DD45|AIM6_LACTC Altered inheritance of mitochondria protein 6 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=AIM6 PE=3 SV=1 47 315 1.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ARV2|AIM6_ARTBC Altered inheritance of mitochondria protein 6 homolog ARB_06966 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06966 PE=1 SV=1 35 317 4.0E-57
sp|C5DYR9|AIM6_ZYGRC Altered inheritance of mitochondria protein 6 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=AIM6 PE=3 SV=1 42 316 1.0E-31
sp|Q75E59|AIM6_ASHGO Altered inheritance of mitochondria protein 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AIM6 PE=3 SV=1 52 317 1.0E-30
sp|Q6CQ63|AIM6_KLULA Altered inheritance of mitochondria protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=AIM6 PE=3 SV=1 42 317 1.0E-30
sp|C5DD45|AIM6_LACTC Altered inheritance of mitochondria protein 6 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=AIM6 PE=3 SV=1 47 315 1.0E-29
sp|Q6FWH9|AIM6_CANGA Altered inheritance of mitochondria protein 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AIM6 PE=3 SV=1 42 317 2.0E-28
sp|Q07716|AIM6_YEAST Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AIM6 PE=1 SV=2 42 317 2.0E-27
sp|C8Z6N5|AIM6_YEAS8 Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=AIM6 PE=3 SV=1 42 317 4.0E-27
sp|B5VF44|AIM6_YEAS6 Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=AIM6 PE=3 SV=1 42 317 4.0E-27
sp|B3LHB3|AIM6_YEAS1 Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=AIM6 PE=3 SV=1 42 317 4.0E-27
sp|C7GJQ6|AIM6_YEAS2 Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain JAY291) GN=AIM6 PE=3 SV=1 42 317 4.0E-27
sp|A6ZX97|AIM6_YEAS7 Altered inheritance of mitochondria protein 6 OS=Saccharomyces cerevisiae (strain YJM789) GN=AIM6 PE=3 SV=1 42 317 4.0E-27
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|007280
MRTFKVLFAFTSLSVALAVPTIVADADNLVKHNPPSLRYPTQLTQGIIPAFIHSHNDYWRDVPLQDAIKFGVTSC
EADVWYEPDSGDHTIYVGHESNALSKDRTLDSLYLGPLMQFLDQQNTENHIAAKLNVTQNMVGIWDTSGGRTLQL
LVDVKVNGEQLTPALDKVLKPFADKGYLTKFENGVLTNGPLTIVGTGATDLSYILGKKGPRYIFFDAPLANLTTP
PAPNVNWSPELSPIASCDYEAVIGWRGITNITEQQQQTVNTLVDQAHKLGIKSRFWDTPATPIFARNNVWKVLLE
SGSDWLNADDLEAASSF*
Coding >AgabiH97|007280
ATGCGTACCTTCAAGGTCCTCTTCGCCTTCACGAGCTTGAGCGTCGCACTTGCTGTACCCACTATCGTGGCCGAT
GCGGATAACCTCGTCAAACACAATCCCCCGTCGCTCAGGTACCCTACCCAACTGACGCAGGGTATCATCCCGGCT
TTTATTCATTCTCACAATGACTATTGGCGCGACGTGCCCCTCCAAGATGCCATCAAGTTCGGTGTAACTAGTTGT
GAAGCGGATGTTTGGTATGAACCAGACAGTGGCGATCATACCATCTACGTCGGACATGAATCTAATGCCTTGTCA
AAAGATAGAACTCTCGACTCGCTCTACCTTGGGCCGCTTATGCAGTTCCTCGACCAGCAAAATACCGAGAACCAT
ATCGCAGCCAAACTGAACGTGACCCAAAACATGGTCGGAATATGGGATACCTCCGGTGGAAGGACTTTACAGCTT
TTGGTTGACGTCAAGGTTAATGGGGAACAGCTCACGCCCGCCCTTGATAAGGTTTTGAAGCCATTTGCCGACAAG
GGCTACTTGACCAAATTCGAGAATGGCGTGTTGACGAATGGCCCCTTGACTATCGTTGGCACAGGCGCCACAGAT
CTTAGTTATATTCTGGGGAAAAAAGGCCCGAGGTATATATTCTTCGATGCTCCTCTCGCAAATCTCACAACGCCT
CCGGCGCCAAATGTTAACTGGTCTCCTGAACTTTCGCCCATCGCGAGCTGTGATTACGAGGCAGTGATTGGTTGG
AGAGGCATCACCAACATAACCGAGCAGCAGCAGCAGACCGTCAACACTTTGGTTGACCAAGCACACAAGTTGGGT
ATTAAATCAAGGTTTTGGGATACTCCGGCGACTCCAATTTTCGCGCGTAACAACGTCTGGAAAGTCCTTCTAGAG
AGTGGTTCGGACTGGCTCAACGCTGATGATTTGGAGGCGGCGAGTAGCTTCTAG
Transcript >AgabiH97|007280
ATGCGTACCTTCAAGGTCCTCTTCGCCTTCACGAGCTTGAGCGTCGCACTTGCTGTACCCACTATCGTGGCCGAT
GCGGATAACCTCGTCAAACACAATCCCCCGTCGCTCAGGTACCCTACCCAACTGACGCAGGGTATCATCCCGGCT
TTTATTCATTCTCACAATGACTATTGGCGCGACGTGCCCCTCCAAGATGCCATCAAGTTCGGTGTAACTAGTTGT
GAAGCGGATGTTTGGTATGAACCAGACAGTGGCGATCATACCATCTACGTCGGACATGAATCTAATGCCTTGTCA
AAAGATAGAACTCTCGACTCGCTCTACCTTGGGCCGCTTATGCAGTTCCTCGACCAGCAAAATACCGAGAACCAT
ATCGCAGCCAAACTGAACGTGACCCAAAACATGGTCGGAATATGGGATACCTCCGGTGGAAGGACTTTACAGCTT
TTGGTTGACGTCAAGGTTAATGGGGAACAGCTCACGCCCGCCCTTGATAAGGTTTTGAAGCCATTTGCCGACAAG
GGCTACTTGACCAAATTCGAGAATGGCGTGTTGACGAATGGCCCCTTGACTATCGTTGGCACAGGCGCCACAGAT
CTTAGTTATATTCTGGGGAAAAAAGGCCCGAGGTATATATTCTTCGATGCTCCTCTCGCAAATCTCACAACGCCT
CCGGCGCCAAATGTTAACTGGTCTCCTGAACTTTCGCCCATCGCGAGCTGTGATTACGAGGCAGTGATTGGTTGG
AGAGGCATCACCAACATAACCGAGCAGCAGCAGCAGACCGTCAACACTTTGGTTGACCAAGCACACAAGTTGGGT
ATTAAATCAAGGTTTTGGGATACTCCGGCGACTCCAATTTTCGCGCGTAACAACGTCTGGAAAGTCCTTCTAGAG
AGTGGTTCGGACTGGCTCAACGCTGATGATTTGGAGGCGGCGAGTAGCTTCTAG
Gene >AgabiH97|007280
ATGCGTACCTTCAAGGTCCTCTTCGCCTTCACGAGCTTGAGCGTCGCACTTGCTGTACCCACTATCGTGGCCGAT
GCGGATAACCTCGTCAAACACAATCCCCCGTCGCTCAGGTACCCTACCCAACTGACGCAGGGTATCATCCCGGCT
TTTATTCATTCTCACAATGACTGTACGTTTCCTCATACCTGATGTCCTGATATACGAACTGAGTATTCCGAAAAA
GATTGGCGCGACGTGCCCCTCCAAGATGCCATCAAGTTCGGTGTAACTAGTTGTGAAGCGGATGTTTGGTATGAA
CCAGACAGTGGCGATCATACCATCTACGTCAGTCTCGAACTTTACGCGTCAACAATGGAAAACTGATCGCCATAA
TAGGTCGGACATGAATCTAATGCCTTGTCAAAAGATAGAACTCTCGACTCGCTCTACCTTGGGCCGCTTATGCAG
TTCCTCGACCAGCAAAATACCGAGAACCATATCGCAGCCAAACTGAACGTGACCCAAAACATGGTGTACGGTGCT
TCTCATCTACGCTGTTCTGTATCACTAAAAGAAGTAATAGCGGAATATGGGATACCTCCGGTGGAAGGACTTTAC
AGCTTTTGGTTGACGTCAAGGTTAATGGGGAACAGTGAGTTCAACGCTGTTGAATTTTGTAAGGAAGAACCTAAT
TTTAGCATTTAGGCTCACGCCCGCCCTTGATAAGGTTTTGAAGCCATTTGCCGACAAGGGCTACTTGACCAAATT
CGAGAATGGCGTGTTGACGAATGGCCCCTTGACTATCGTTGGCACAGGCGCCACAGATCTTAGTTATATTCTGGG
GAAAAAAGGCCCGAGGTATATATTCTTCGATGCTCCTCTCGCAAATCTCACAACGCCTCCGGCGCCAAATGTTAA
CTGGTCTCCTGAACTTTCGCCCATCGCGAGCTGTGATTACGAGGCAGTGATTGGTTGGAGAGGCATCACCAACAT
AACCGAGCAGCAGCAGCAGACCGTCAACACTTTGGTTGACCAAGCACACAAGTTGGGTATTAAATCAAGGTTTTG
GGATACTCCGGCGACTCCAATTTTCGCGCGTAACAACGTCTGGAAAGTCCTTCTAGAGAGTGGTTCGGACTGGCT
CAACGCTGATGATTTGGAGGCGGCGAGTAGCTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail