© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|007240 |
| Gene name | |
| Location | scaffold_1:1723181..1724137 |
| Strand | + |
| Gene length (bp) | 956 |
| Transcript length (bp) | 798 |
| Coding sequence length (bp) | 798 |
| Protein length (aa) | 266 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF03330 | DPBB_1 | Lytic transglycolase | 1.9E-07 | 163 | 256 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P86242|PAPI_STRMB | Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 | 162 | 265 | 8.0E-14 |
| sp|D4B2H3|ALL7_ARTBC | Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 | 162 | 265 | 1.0E-11 |
| sp|O42799|ALL7_ASPFU | Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 | 163 | 264 | 4.0E-08 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 20 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 1684.11 | 677.92 | 2690.31 |
| Initials | Initials knots | 950.47 | 500.38 | 1400.56 |
| Pileal_Stipeal_center | Stage I stipe center | 1639.16 | 748.62 | 2529.71 |
| Pileal_Stipeal_shell | Stage I stipe shell | 1001.03 | 520.45 | 1481.62 |
| DIF_stipe_center | Stage II stipe center | 1430.68 | 682.48 | 2178.88 |
| DIF_stipe_shell | Stage II stipe shell | 2154.55 | 928.55 | 3380.56 |
| DIF_stipe_skin | Stage II stipe skin | 2080.61 | 896.81 | 3264.42 |
| DIF_cap_skin | Stage II cap skin | 1103.75 | 561.42 | 1646.07 |
| DIF_cap_tissue | Stage II cap tissue | 999.79 | 520.91 | 1478.68 |
| DIF_gill_tissue | Stage II gill tissue | 969.78 | 507.82 | 1431.75 |
| YFB_stipe_center | Young fruiting body stipe center | 2861.04 | 1114.19 | 4607.88 |
| YFB_stipe_shell | Young fruiting body stipe shell | 3488.51 | 1221.23 | 5755.78 |
| YFB_stipe_skin | Young fruiting body stipe skin | 3548.49 | 1236.14 | 5860.83 |
| YFB_cap_skin | Young fruiting body cap skin | 1526.59 | 731.35 | 2321.83 |
| YFB_cap_tissue | Young fruiting body cap tissue | 1065.30 | 549.02 | 1581.58 |
| YFB_gill_tissue | Young fruiting body gill tissue | 1437.68 | 685.26 | 2190.11 |
| YFB_veil | Young fruiting body veil | 1370.83 | 675.73 | 2065.93 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.150706 | no |
| Casing | YFB_stipe_center | 0.243628 | no |
| Casing | YFB_stipe_shell | 0.085561 | no |
| Casing | YFB_stipe_skin | 0.071413 | no |
| Casing | YFB_cap_skin | 0.885120 | no |
| Casing | YFB_cap_tissue | 0.258084 | no |
| Casing | YFB_gill_tissue | 0.796217 | no |
| Casing | YFB_veil | 0.706693 | no |
| Casing | Initials | 0.131265 | no |
| Casing | Pileal_Stipeal_center | 0.972240 | no |
| Casing | Pileal_Stipeal_shell | 0.175019 | no |
| Casing | DIF_stipe_center | 0.789183 | no |
| Casing | DIF_stipe_shell | 0.657604 | no |
| Casing | DIF_stipe_skin | 0.714470 | no |
| Casing | DIF_cap_skin | 0.311274 | no |
| Casing | DIF_cap_tissue | 0.173592 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.004548 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.001625 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.224926 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.874234 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.322344 | no |
| DIF_gill_tissue | YFB_veil | 0.385534 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.774803 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.745462 | no |
| YFB_stipe_center | YFB_cap_skin | 0.121416 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.009773 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.083501 | no |
| YFB_stipe_center | YFB_veil | 0.059712 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.984696 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.036911 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.001140 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.021846 | yes |
| YFB_stipe_shell | YFB_veil | 0.015529 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.031323 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.003765 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.020260 | yes |
| YFB_stipe_skin | YFB_veil | 0.013186 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.379038 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.928861 | no |
| YFB_cap_skin | YFB_veil | 0.860670 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.500419 | no |
| YFB_cap_tissue | YFB_veil | 0.578337 | no |
| YFB_gill_tissue | YFB_veil | 0.945407 | no |
| Initials | DIF_gill_tissue | 0.975745 | no |
| Initials | YFB_stipe_center | 0.003765 | yes |
| Initials | YFB_stipe_shell | 0.001625 | yes |
| Initials | YFB_stipe_skin | 0.000613 | yes |
| Initials | YFB_cap_skin | 0.192781 | no |
| Initials | YFB_cap_tissue | 0.841568 | no |
| Initials | YFB_gill_tissue | 0.283853 | no |
| Initials | YFB_veil | 0.344316 | no |
| Initials | Pileal_Stipeal_center | 0.131406 | no |
| Initials | Pileal_Stipeal_shell | 0.934618 | no |
| Initials | DIF_stipe_center | 0.289094 | no |
| Initials | DIF_stipe_shell | 0.015242 | yes |
| Initials | DIF_stipe_skin | 0.023415 | yes |
| Initials | DIF_cap_skin | 0.774463 | no |
| Initials | DIF_cap_tissue | 0.937059 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.156383 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.196285 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.062995 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.050499 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.917851 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.273347 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.835415 | no |
| Pileal_Stipeal_center | YFB_veil | 0.747093 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.179455 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.829051 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.598075 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.655527 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.329316 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.179084 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.962446 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.004928 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.002084 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.268064 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.924498 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.374960 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.444068 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.382526 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.023933 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.036683 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.867377 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.998336 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.328018 | no |
| DIF_stipe_center | YFB_stipe_center | 0.086750 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.024187 | yes |
| DIF_stipe_center | YFB_stipe_skin | 0.016669 | yes |
| DIF_stipe_center | YFB_cap_skin | 0.924741 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.506395 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.994571 | no |
| DIF_stipe_center | YFB_veil | 0.951206 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.344582 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.392429 | no |
| DIF_stipe_center | DIF_cap_skin | 0.578559 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.369114 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.021846 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.610306 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.305693 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.278179 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.455042 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.045911 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.352768 | no |
| DIF_stipe_shell | YFB_veil | 0.258723 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.964160 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.061277 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.028437 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.031323 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.551954 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.263990 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.238213 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.517551 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.063760 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.412372 | no |
| DIF_stipe_skin | YFB_veil | 0.312589 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.085045 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.037364 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.814159 | no |
| DIF_cap_skin | YFB_stipe_center | 0.010412 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.003765 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.001140 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.458171 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.957909 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.574021 | no |
| DIF_cap_skin | YFB_veil | 0.654205 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.862800 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.963745 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.005302 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.002084 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.265944 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.921788 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.371980 | no |
| DIF_cap_tissue | YFB_veil | 0.441147 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|007240 MSFSKLVLLFVAFVASAGALSSPHPRGIHHRALAGRITVPESPVSPPLPVRRRQNSKRCKSRPSSAALIVSTKDA EATHTREATHTKEATPTKEVVPTKEAPTTKETEAPKPTTHETTHKASPTPKPAPPPTTKEEAPAPTKKPPPPPPT SNLPSFLTGLNTGDATFYATGLGACGIVNKDTDFIAAASKDLFDAFPGYNGANPNKNPMCNRRVSATYEGTTIEV VLTDRCEGCALTALDFSPAAFNKLADPGKGRLHGMTWKFI* |
| Coding | >AgabiH97|007240 ATGTCCTTCTCAAAGCTCGTCCTTCTTTTTGTCGCTTTCGTCGCCTCTGCCGGCGCTCTCTCCAGCCCTCATCCT CGCGGCATCCATCACCGCGCCCTCGCCGGCCGCATTACGGTTCCTGAGTCTCCAGTCTCCCCCCCTCTTCCCGTT CGCAGGCGCCAGAACAGCAAGCGCTGCAAGTCTCGCCCTTCCTCTGCTGCCCTCATTGTAAGCACGAAGGACGCC GAGGCTACTCACACAAGAGAGGCCACCCACACCAAAGAGGCTACCCCAACGAAAGAGGTCGTCCCCACGAAAGAG GCTCCTACCACAAAAGAAACCGAGGCTCCTAAACCTACTACTCACGAAACGACTCACAAGGCCTCTCCTACCCCC AAGCCGGCCCCACCACCAACGACCAAAGAAGAAGCTCCTGCCCCAACCAAGAAACCGCCTCCTCCTCCTCCCACC TCGAACCTTCCAAGCTTCCTGACTGGTCTTAACACTGGCGATGCAACGTTTTACGCAACTGGTCTTGGTGCTTGT GGCATCGTAAATAAAGACACTGATTTCATTGCTGCCGCCTCTAAGGACTTGTTCGATGCTTTCCCTGGCTACAAC GGAGCCAACCCCAACAAGAACCCTATGTGTAATCGCAGGGTATCTGCGACCTATGAAGGTACCACTATCGAGGTT GTGCTTACCGACCGGTGTGAGGGATGCGCCCTAACTGCCTTGGATTTCTCTCCGGCTGCTTTCAATAAACTTGCC GACCCAGGTAAGGGGCGTCTGCATGGCATGACTTGGAAATTCATCTAG |
| Transcript | >AgabiH97|007240 ATGTCCTTCTCAAAGCTCGTCCTTCTTTTTGTCGCTTTCGTCGCCTCTGCCGGCGCTCTCTCCAGCCCTCATCCT CGCGGCATCCATCACCGCGCCCTCGCCGGCCGCATTACGGTTCCTGAGTCTCCAGTCTCCCCCCCTCTTCCCGTT CGCAGGCGCCAGAACAGCAAGCGCTGCAAGTCTCGCCCTTCCTCTGCTGCCCTCATTGTAAGCACGAAGGACGCC GAGGCTACTCACACAAGAGAGGCCACCCACACCAAAGAGGCTACCCCAACGAAAGAGGTCGTCCCCACGAAAGAG GCTCCTACCACAAAAGAAACCGAGGCTCCTAAACCTACTACTCACGAAACGACTCACAAGGCCTCTCCTACCCCC AAGCCGGCCCCACCACCAACGACCAAAGAAGAAGCTCCTGCCCCAACCAAGAAACCGCCTCCTCCTCCTCCCACC TCGAACCTTCCAAGCTTCCTGACTGGTCTTAACACTGGCGATGCAACGTTTTACGCAACTGGTCTTGGTGCTTGT GGCATCGTAAATAAAGACACTGATTTCATTGCTGCCGCCTCTAAGGACTTGTTCGATGCTTTCCCTGGCTACAAC GGAGCCAACCCCAACAAGAACCCTATGTGTAATCGCAGGGTATCTGCGACCTATGAAGGTACCACTATCGAGGTT GTGCTTACCGACCGGTGTGAGGGATGCGCCCTAACTGCCTTGGATTTCTCTCCGGCTGCTTTCAATAAACTTGCC GACCCAGGTAAGGGGCGTCTGCATGGCATGACTTGGAAATTCATCTAG |
| Gene | >AgabiH97|007240 ATGTCCTTCTCAAAGCTCGTCCTTCTTTTTGTCGCTTTCGTCGCCTCTGCCGGCGCTCTCTCCAGCCCTCATCCT CGCGGCATCCATCACCGCGCCCTCGCCGGCCGCATTACGGTTCCTGAGTCTCCAGTCTCCCCCCCTCTTCCCGTT CGCAGGCGCCAGAACAGCAAGCGCTGCAAGTCTCGCCCTTCCTCTGCTGCCCTCATTGTAAGCACGAAGGACGCC GAGGCTACTCACACAAGAGAGGCCACCCACACCAAAGAGGCTACCCCAACGAAAGAGGTCGTCCCCACGAAAGAG GCTCCTACCACAAAAGAAACCGAGGCTCCTAAACCTACTACTCACGAAACGACTCACAAGGCCTCTCCTACCCCC AAGCCGGCCCCACCACCAACGACCAAAGAAGAAGCTCCTGCCCCAACCAAGAAACCGCCTCCTCCTCCTCCCACC TCGAACCTTCCAAGCTTCCTGACTGGTCTTAACACTGGCGATGCAACGTTTTACGCAAGTAGGTTTTCATATCCG CTTCATTTTAATCCGATTTACCTATTGTAACCTAGCTGGTCTTGGTGCTTGTGGCATCGTAAATAAAGACACTGA TTTCATTGCTGCCGCCTCTAAGGACTTGTTCGATGCTTTCCCGTGCGTTTCCTTCTACCCTTTCTTGATTCCCCT CATTCATTCCATGATCTGTAGTGGCTACAACGGAGCCAACCCCAACAAGAACCCTATGTGTAATCGCAGGGTATC TGCGACCTGTGAGTATATTTTTTTGATAAGCAATATTATAGACTGCTTACGGTTCATCAGATGAAGGTACCACTA TCGAGGTTGTGCTTACCGACCGGTGTGAGGGATGCGCCCTAACTGCCTTGGATTTCTCTCCGGCTGCTTTCAATA AACTTGCCGACCCAGGTAAGGGGCGTCTGCATGGCATGACTTGGAAATTCATCTAG |