Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|007240
Gene name
Locationscaffold_1:1723181..1724137
Strand+
Gene length (bp)956
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03330 DPBB_1 Lytic transglycolase 1.9E-07 163 256

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P86242|PAPI_STRMB Papain inhibitor OS=Streptomyces mobaraensis GN=pi PE=1 SV=2 162 265 8.0E-14
sp|D4B2H3|ALL7_ARTBC Allergen Asp f 7 homolog OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02701 PE=3 SV=1 162 265 1.0E-11
sp|O42799|ALL7_ASPFU Allergen Asp f 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_4G06670 PE=1 SV=2 163 264 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 1684.11 677.92 2690.31
Initials Initials knots 950.47 500.38 1400.56
Pileal_Stipeal_center Stage I stipe center 1639.16 748.62 2529.71
Pileal_Stipeal_shell Stage I stipe shell 1001.03 520.45 1481.62
DIF_stipe_center Stage II stipe center 1430.68 682.48 2178.88
DIF_stipe_shell Stage II stipe shell 2154.55 928.55 3380.56
DIF_stipe_skin Stage II stipe skin 2080.61 896.81 3264.42
DIF_cap_skin Stage II cap skin 1103.75 561.42 1646.07
DIF_cap_tissue Stage II cap tissue 999.79 520.91 1478.68
DIF_gill_tissue Stage II gill tissue 969.78 507.82 1431.75
YFB_stipe_center Young fruiting body stipe center 2861.04 1114.19 4607.88
YFB_stipe_shell Young fruiting body stipe shell 3488.51 1221.23 5755.78
YFB_stipe_skin Young fruiting body stipe skin 3548.49 1236.14 5860.83
YFB_cap_skin Young fruiting body cap skin 1526.59 731.35 2321.83
YFB_cap_tissue Young fruiting body cap tissue 1065.30 549.02 1581.58
YFB_gill_tissue Young fruiting body gill tissue 1437.68 685.26 2190.11
YFB_veil Young fruiting body veil 1370.83 675.73 2065.93

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.150706 no
Casing YFB_stipe_center 0.243628 no
Casing YFB_stipe_shell 0.085561 no
Casing YFB_stipe_skin 0.071413 no
Casing YFB_cap_skin 0.885120 no
Casing YFB_cap_tissue 0.258084 no
Casing YFB_gill_tissue 0.796217 no
Casing YFB_veil 0.706693 no
Casing Initials 0.131265 no
Casing Pileal_Stipeal_center 0.972240 no
Casing Pileal_Stipeal_shell 0.175019 no
Casing DIF_stipe_center 0.789183 no
Casing DIF_stipe_shell 0.657604 no
Casing DIF_stipe_skin 0.714470 no
Casing DIF_cap_skin 0.311274 no
Casing DIF_cap_tissue 0.173592 no
DIF_gill_tissue YFB_stipe_center 0.004548 yes
DIF_gill_tissue YFB_stipe_shell 0.001625 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.224926 no
DIF_gill_tissue YFB_cap_tissue 0.874234 no
DIF_gill_tissue YFB_gill_tissue 0.322344 no
DIF_gill_tissue YFB_veil 0.385534 no
YFB_stipe_center YFB_stipe_shell 0.774803 no
YFB_stipe_center YFB_stipe_skin 0.745462 no
YFB_stipe_center YFB_cap_skin 0.121416 no
YFB_stipe_center YFB_cap_tissue 0.009773 yes
YFB_stipe_center YFB_gill_tissue 0.083501 no
YFB_stipe_center YFB_veil 0.059712 no
YFB_stipe_shell YFB_stipe_skin 0.984696 no
YFB_stipe_shell YFB_cap_skin 0.036911 yes
YFB_stipe_shell YFB_cap_tissue 0.001140 yes
YFB_stipe_shell YFB_gill_tissue 0.021846 yes
YFB_stipe_shell YFB_veil 0.015529 yes
YFB_stipe_skin YFB_cap_skin 0.031323 yes
YFB_stipe_skin YFB_cap_tissue 0.003765 yes
YFB_stipe_skin YFB_gill_tissue 0.020260 yes
YFB_stipe_skin YFB_veil 0.013186 yes
YFB_cap_skin YFB_cap_tissue 0.379038 no
YFB_cap_skin YFB_gill_tissue 0.928861 no
YFB_cap_skin YFB_veil 0.860670 no
YFB_cap_tissue YFB_gill_tissue 0.500419 no
YFB_cap_tissue YFB_veil 0.578337 no
YFB_gill_tissue YFB_veil 0.945407 no
Initials DIF_gill_tissue 0.975745 no
Initials YFB_stipe_center 0.003765 yes
Initials YFB_stipe_shell 0.001625 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.192781 no
Initials YFB_cap_tissue 0.841568 no
Initials YFB_gill_tissue 0.283853 no
Initials YFB_veil 0.344316 no
Initials Pileal_Stipeal_center 0.131406 no
Initials Pileal_Stipeal_shell 0.934618 no
Initials DIF_stipe_center 0.289094 no
Initials DIF_stipe_shell 0.015242 yes
Initials DIF_stipe_skin 0.023415 yes
Initials DIF_cap_skin 0.774463 no
Initials DIF_cap_tissue 0.937059 no
Pileal_Stipeal_center DIF_gill_tissue 0.156383 no
Pileal_Stipeal_center YFB_stipe_center 0.196285 no
Pileal_Stipeal_center YFB_stipe_shell 0.062995 no
Pileal_Stipeal_center YFB_stipe_skin 0.050499 no
Pileal_Stipeal_center YFB_cap_skin 0.917851 no
Pileal_Stipeal_center YFB_cap_tissue 0.273347 no
Pileal_Stipeal_center YFB_gill_tissue 0.835415 no
Pileal_Stipeal_center YFB_veil 0.747093 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.179455 no
Pileal_Stipeal_center DIF_stipe_center 0.829051 no
Pileal_Stipeal_center DIF_stipe_shell 0.598075 no
Pileal_Stipeal_center DIF_stipe_skin 0.655527 no
Pileal_Stipeal_center DIF_cap_skin 0.329316 no
Pileal_Stipeal_center DIF_cap_tissue 0.179084 no
Pileal_Stipeal_shell DIF_gill_tissue 0.962446 no
Pileal_Stipeal_shell YFB_stipe_center 0.004928 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.002084 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.268064 no
Pileal_Stipeal_shell YFB_cap_tissue 0.924498 no
Pileal_Stipeal_shell YFB_gill_tissue 0.374960 no
Pileal_Stipeal_shell YFB_veil 0.444068 no
Pileal_Stipeal_shell DIF_stipe_center 0.382526 no
Pileal_Stipeal_shell DIF_stipe_shell 0.023933 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.036683 yes
Pileal_Stipeal_shell DIF_cap_skin 0.867377 no
Pileal_Stipeal_shell DIF_cap_tissue 0.998336 no
DIF_stipe_center DIF_gill_tissue 0.328018 no
DIF_stipe_center YFB_stipe_center 0.086750 no
DIF_stipe_center YFB_stipe_shell 0.024187 yes
DIF_stipe_center YFB_stipe_skin 0.016669 yes
DIF_stipe_center YFB_cap_skin 0.924741 no
DIF_stipe_center YFB_cap_tissue 0.506395 no
DIF_stipe_center YFB_gill_tissue 0.994571 no
DIF_stipe_center YFB_veil 0.951206 no
DIF_stipe_center DIF_stipe_shell 0.344582 no
DIF_stipe_center DIF_stipe_skin 0.392429 no
DIF_stipe_center DIF_cap_skin 0.578559 no
DIF_stipe_center DIF_cap_tissue 0.369114 no
DIF_stipe_shell DIF_gill_tissue 0.021846 yes
DIF_stipe_shell YFB_stipe_center 0.610306 no
DIF_stipe_shell YFB_stipe_shell 0.305693 no
DIF_stipe_shell YFB_stipe_skin 0.278179 no
DIF_stipe_shell YFB_cap_skin 0.455042 no
DIF_stipe_shell YFB_cap_tissue 0.045911 yes
DIF_stipe_shell YFB_gill_tissue 0.352768 no
DIF_stipe_shell YFB_veil 0.258723 no
DIF_stipe_shell DIF_stipe_skin 0.964160 no
DIF_stipe_shell DIF_cap_skin 0.061277 no
DIF_stipe_shell DIF_cap_tissue 0.028437 yes
DIF_stipe_skin DIF_gill_tissue 0.031323 yes
DIF_stipe_skin YFB_stipe_center 0.551954 no
DIF_stipe_skin YFB_stipe_shell 0.263990 no
DIF_stipe_skin YFB_stipe_skin 0.238213 no
DIF_stipe_skin YFB_cap_skin 0.517551 no
DIF_stipe_skin YFB_cap_tissue 0.063760 no
DIF_stipe_skin YFB_gill_tissue 0.412372 no
DIF_stipe_skin YFB_veil 0.312589 no
DIF_stipe_skin DIF_cap_skin 0.085045 no
DIF_stipe_skin DIF_cap_tissue 0.037364 yes
DIF_cap_skin DIF_gill_tissue 0.814159 no
DIF_cap_skin YFB_stipe_center 0.010412 yes
DIF_cap_skin YFB_stipe_shell 0.003765 yes
DIF_cap_skin YFB_stipe_skin 0.001140 yes
DIF_cap_skin YFB_cap_skin 0.458171 no
DIF_cap_skin YFB_cap_tissue 0.957909 no
DIF_cap_skin YFB_gill_tissue 0.574021 no
DIF_cap_skin YFB_veil 0.654205 no
DIF_cap_skin DIF_cap_tissue 0.862800 no
DIF_cap_tissue DIF_gill_tissue 0.963745 no
DIF_cap_tissue YFB_stipe_center 0.005302 yes
DIF_cap_tissue YFB_stipe_shell 0.002084 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.265944 no
DIF_cap_tissue YFB_cap_tissue 0.921788 no
DIF_cap_tissue YFB_gill_tissue 0.371980 no
DIF_cap_tissue YFB_veil 0.441147 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|007240
MSFSKLVLLFVAFVASAGALSSPHPRGIHHRALAGRITVPESPVSPPLPVRRRQNSKRCKSRPSSAALIVSTKDA
EATHTREATHTKEATPTKEVVPTKEAPTTKETEAPKPTTHETTHKASPTPKPAPPPTTKEEAPAPTKKPPPPPPT
SNLPSFLTGLNTGDATFYATGLGACGIVNKDTDFIAAASKDLFDAFPGYNGANPNKNPMCNRRVSATYEGTTIEV
VLTDRCEGCALTALDFSPAAFNKLADPGKGRLHGMTWKFI*
Coding >AgabiH97|007240
ATGTCCTTCTCAAAGCTCGTCCTTCTTTTTGTCGCTTTCGTCGCCTCTGCCGGCGCTCTCTCCAGCCCTCATCCT
CGCGGCATCCATCACCGCGCCCTCGCCGGCCGCATTACGGTTCCTGAGTCTCCAGTCTCCCCCCCTCTTCCCGTT
CGCAGGCGCCAGAACAGCAAGCGCTGCAAGTCTCGCCCTTCCTCTGCTGCCCTCATTGTAAGCACGAAGGACGCC
GAGGCTACTCACACAAGAGAGGCCACCCACACCAAAGAGGCTACCCCAACGAAAGAGGTCGTCCCCACGAAAGAG
GCTCCTACCACAAAAGAAACCGAGGCTCCTAAACCTACTACTCACGAAACGACTCACAAGGCCTCTCCTACCCCC
AAGCCGGCCCCACCACCAACGACCAAAGAAGAAGCTCCTGCCCCAACCAAGAAACCGCCTCCTCCTCCTCCCACC
TCGAACCTTCCAAGCTTCCTGACTGGTCTTAACACTGGCGATGCAACGTTTTACGCAACTGGTCTTGGTGCTTGT
GGCATCGTAAATAAAGACACTGATTTCATTGCTGCCGCCTCTAAGGACTTGTTCGATGCTTTCCCTGGCTACAAC
GGAGCCAACCCCAACAAGAACCCTATGTGTAATCGCAGGGTATCTGCGACCTATGAAGGTACCACTATCGAGGTT
GTGCTTACCGACCGGTGTGAGGGATGCGCCCTAACTGCCTTGGATTTCTCTCCGGCTGCTTTCAATAAACTTGCC
GACCCAGGTAAGGGGCGTCTGCATGGCATGACTTGGAAATTCATCTAG
Transcript >AgabiH97|007240
ATGTCCTTCTCAAAGCTCGTCCTTCTTTTTGTCGCTTTCGTCGCCTCTGCCGGCGCTCTCTCCAGCCCTCATCCT
CGCGGCATCCATCACCGCGCCCTCGCCGGCCGCATTACGGTTCCTGAGTCTCCAGTCTCCCCCCCTCTTCCCGTT
CGCAGGCGCCAGAACAGCAAGCGCTGCAAGTCTCGCCCTTCCTCTGCTGCCCTCATTGTAAGCACGAAGGACGCC
GAGGCTACTCACACAAGAGAGGCCACCCACACCAAAGAGGCTACCCCAACGAAAGAGGTCGTCCCCACGAAAGAG
GCTCCTACCACAAAAGAAACCGAGGCTCCTAAACCTACTACTCACGAAACGACTCACAAGGCCTCTCCTACCCCC
AAGCCGGCCCCACCACCAACGACCAAAGAAGAAGCTCCTGCCCCAACCAAGAAACCGCCTCCTCCTCCTCCCACC
TCGAACCTTCCAAGCTTCCTGACTGGTCTTAACACTGGCGATGCAACGTTTTACGCAACTGGTCTTGGTGCTTGT
GGCATCGTAAATAAAGACACTGATTTCATTGCTGCCGCCTCTAAGGACTTGTTCGATGCTTTCCCTGGCTACAAC
GGAGCCAACCCCAACAAGAACCCTATGTGTAATCGCAGGGTATCTGCGACCTATGAAGGTACCACTATCGAGGTT
GTGCTTACCGACCGGTGTGAGGGATGCGCCCTAACTGCCTTGGATTTCTCTCCGGCTGCTTTCAATAAACTTGCC
GACCCAGGTAAGGGGCGTCTGCATGGCATGACTTGGAAATTCATCTAG
Gene >AgabiH97|007240
ATGTCCTTCTCAAAGCTCGTCCTTCTTTTTGTCGCTTTCGTCGCCTCTGCCGGCGCTCTCTCCAGCCCTCATCCT
CGCGGCATCCATCACCGCGCCCTCGCCGGCCGCATTACGGTTCCTGAGTCTCCAGTCTCCCCCCCTCTTCCCGTT
CGCAGGCGCCAGAACAGCAAGCGCTGCAAGTCTCGCCCTTCCTCTGCTGCCCTCATTGTAAGCACGAAGGACGCC
GAGGCTACTCACACAAGAGAGGCCACCCACACCAAAGAGGCTACCCCAACGAAAGAGGTCGTCCCCACGAAAGAG
GCTCCTACCACAAAAGAAACCGAGGCTCCTAAACCTACTACTCACGAAACGACTCACAAGGCCTCTCCTACCCCC
AAGCCGGCCCCACCACCAACGACCAAAGAAGAAGCTCCTGCCCCAACCAAGAAACCGCCTCCTCCTCCTCCCACC
TCGAACCTTCCAAGCTTCCTGACTGGTCTTAACACTGGCGATGCAACGTTTTACGCAAGTAGGTTTTCATATCCG
CTTCATTTTAATCCGATTTACCTATTGTAACCTAGCTGGTCTTGGTGCTTGTGGCATCGTAAATAAAGACACTGA
TTTCATTGCTGCCGCCTCTAAGGACTTGTTCGATGCTTTCCCGTGCGTTTCCTTCTACCCTTTCTTGATTCCCCT
CATTCATTCCATGATCTGTAGTGGCTACAACGGAGCCAACCCCAACAAGAACCCTATGTGTAATCGCAGGGTATC
TGCGACCTGTGAGTATATTTTTTTGATAAGCAATATTATAGACTGCTTACGGTTCATCAGATGAAGGTACCACTA
TCGAGGTTGTGCTTACCGACCGGTGTGAGGGATGCGCCCTAACTGCCTTGGATTTCTCTCCGGCTGCTTTCAATA
AACTTGCCGACCCAGGTAAGGGGCGTCTGCATGGCATGACTTGGAAATTCATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail