Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|007220
Gene name
Locationscaffold_1:1719408..1721185
Strand-
Gene length (bp)1777
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 1.5E-52 11 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 1 417 2.0E-99
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 3 412 3.0E-96
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 4 413 8.0E-89
sp|Q3UVU3|ZNT10_MOUSE Zinc transporter 10 OS=Mus musculus GN=Slc30a10 PE=1 SV=1 4 450 4.0E-70
sp|Q60738|ZNT1_MOUSE Zinc transporter 1 OS=Mus musculus GN=Slc30a1 PE=1 SV=1 8 440 1.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 1 417 2.0E-99
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 3 412 3.0E-96
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 4 413 8.0E-89
sp|Q3UVU3|ZNT10_MOUSE Zinc transporter 10 OS=Mus musculus GN=Slc30a10 PE=1 SV=1 4 450 4.0E-70
sp|Q60738|ZNT1_MOUSE Zinc transporter 1 OS=Mus musculus GN=Slc30a1 PE=1 SV=1 8 440 1.0E-66
sp|Q6XR72|ZNT10_HUMAN Zinc transporter 10 OS=Homo sapiens GN=SLC30A10 PE=1 SV=2 4 450 7.0E-65
sp|Q62720|ZNT1_RAT Zinc transporter 1 OS=Rattus norvegicus GN=Slc30a1 PE=2 SV=1 8 440 3.0E-64
sp|Q9Y6M5|ZNT1_HUMAN Zinc transporter 1 OS=Homo sapiens GN=SLC30A1 PE=1 SV=3 8 440 1.0E-63
sp|Q4R6K2|ZNT1_MACFA Zinc transporter 1 OS=Macaca fascicularis GN=SLC30A1 PE=2 SV=1 8 440 7.0E-63
sp|Q95QW4|CDF1_CAEEL Cation diffusion facilitator family protein 1 OS=Caenorhabditis elegans GN=cdf-1 PE=1 SV=1 2 415 1.0E-42
sp|Q54T06|Y8206_DICDI Probable zinc transporter protein DDB_G0282067 OS=Dictyostelium discoideum GN=DDB_G0282067 PE=2 SV=1 270 449 2.0E-32
sp|Q54T06|Y8206_DICDI Probable zinc transporter protein DDB_G0282067 OS=Dictyostelium discoideum GN=DDB_G0282067 PE=2 SV=1 3 132 7.0E-20
sp|Q9HGQ3|CIS4_SCHPO Probable zinc transporter cis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cis4 PE=1 SV=1 5 379 5.0E-19
sp|Q8H329|MTP8_ORYSJ Metal tolerance protein 8 OS=Oryza sativa subsp. japonica GN=MTP8 PE=2 SV=2 253 414 8.0E-19
sp|Q54F34|Y1141_DICDI Probable zinc transporter protein DDB_G0291141 OS=Dictyostelium discoideum GN=DDB_G0291141 PE=3 SV=1 6 132 3.0E-18
sp|Q8BGG0|ZNT8_MOUSE Zinc transporter 8 OS=Mus musculus GN=Slc30a8 PE=2 SV=1 268 430 4.0E-18
sp|Q52KD7|ZNT7A_XENLA Zinc transporter 7-A OS=Xenopus laevis GN=slc30a7-a PE=2 SV=1 4 133 4.0E-18
sp|Q8ZGY6|ZITB_YERPE Zinc transporter ZitB OS=Yersinia pestis GN=zitB PE=3 SV=1 4 140 5.0E-18
sp|Q66D85|ZITB_YERPS Zinc transporter ZitB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=zitB PE=3 SV=1 4 140 5.0E-18
sp|Q08E25|ZNT3_BOVIN Zinc transporter 3 OS=Bos taurus GN=SLC30A3 PE=2 SV=1 268 428 1.0E-17
sp|Q6NRI1|ZNT7B_XENLA Zinc transporter 7-B OS=Xenopus laevis GN=slc30a7-b PE=2 SV=1 4 133 2.0E-17
sp|Q66D85|ZITB_YERPS Zinc transporter ZitB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=zitB PE=3 SV=1 269 419 3.0E-17
sp|Q6P3N9|ZNT7_XENTR Zinc transporter 7 OS=Xenopus tropicalis GN=slc30a7 PE=2 SV=1 4 133 3.0E-17
sp|Q6QIX3|ZNT3_RAT Zinc transporter 3 OS=Rattus norvegicus GN=Slc30a3 PE=1 SV=1 240 432 8.0E-17
sp|P13512|CZCD_CUPMC Metal cation efflux system protein CzcD OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=czcD PE=1 SV=2 263 411 9.0E-17
sp|P94178|CZCD_ALCSC Cation efflux system protein CzcD OS=Alcaligenes sp. (strain CT14) GN=czcD PE=3 SV=1 263 411 1.0E-16
sp|Q5R617|ZNT3_PONAB Zinc transporter 3 OS=Pongo abelii GN=SLC30A3 PE=2 SV=1 268 428 1.0E-16
sp|Q99726|ZNT3_HUMAN Zinc transporter 3 OS=Homo sapiens GN=SLC30A3 PE=1 SV=2 268 428 1.0E-16
sp|Q8R4H9|ZNT5_MOUSE Zinc transporter 5 OS=Mus musculus GN=Slc30a5 PE=1 SV=1 4 135 1.0E-16
sp|Q8ZGY6|ZITB_YERPE Zinc transporter ZitB OS=Yersinia pestis GN=zitB PE=3 SV=1 269 419 2.0E-16
sp|Q8TAD4|ZNT5_HUMAN Zinc transporter 5 OS=Homo sapiens GN=SLC30A5 PE=1 SV=1 4 135 2.0E-16
sp|Q8IWU4|ZNT8_HUMAN Zinc transporter 8 OS=Homo sapiens GN=SLC30A8 PE=1 SV=2 268 419 3.0E-16
sp|Q9SI03|MTP12_ARATH Metal tolerance protein 12 OS=Arabidopsis thaliana GN=MTP12 PE=3 SV=1 5 129 4.0E-16
sp|Q5MNV6|ZNT7_CHICK Zinc transporter 7 OS=Gallus gallus GN=SLC30A7 PE=2 SV=1 6 133 4.0E-16
sp|P97441|ZNT3_MOUSE Zinc transporter 3 OS=Mus musculus GN=Slc30a3 PE=1 SV=1 268 428 5.0E-16
sp|A4IFD7|ZNT7_BOVIN Zinc transporter 7 OS=Bos taurus GN=SLC30A7 PE=2 SV=1 6 132 7.0E-16
sp|O55174|ZNT4_RAT Zinc transporter 4 OS=Rattus norvegicus GN=Slc30a4 PE=2 SV=1 7 134 9.0E-16
sp|A5PMX1|ZNT7_DANRE Zinc transporter 7 OS=Danio rerio GN=slc30a7 PE=2 SV=1 6 133 9.0E-16
sp|Q9JKN1|ZNT7_MOUSE Zinc transporter 7 OS=Mus musculus GN=Slc30a7 PE=1 SV=1 6 133 1.0E-15
sp|Q8NEW0|ZNT7_HUMAN Zinc transporter 7 OS=Homo sapiens GN=SLC30A7 PE=2 SV=1 6 132 1.0E-15
sp|Q5BJM8|ZNT7_RAT Zinc transporter 7 OS=Rattus norvegicus GN=Slc30a7 PE=2 SV=2 6 133 1.0E-15
sp|Q6DG36|ZNT5_DANRE Zinc transporter 5 OS=Danio rerio GN=slc30a5 PE=2 SV=1 6 141 2.0E-15
sp|Q5ZLF4|ZNT5_CHICK Zinc transporter 5 OS=Gallus gallus GN=SLC30A5 PE=2 SV=1 6 135 2.0E-15
sp|O35149|ZNT4_MOUSE Zinc transporter 4 OS=Mus musculus GN=Slc30a4 PE=1 SV=2 7 134 2.0E-15
sp|A7Z1S6|CZCD_BACMF Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcD PE=3 SV=1 19 127 2.0E-15
sp|Q62941|ZNT2_RAT Zinc transporter 2 OS=Rattus norvegicus GN=Slc30a2 PE=2 SV=1 263 425 2.0E-15
sp|Q5XHB4|ZNT8_XENTR Zinc transporter 8 OS=Xenopus tropicalis GN=slc30a8 PE=2 SV=1 271 419 4.0E-15
sp|Q8H329|MTP8_ORYSJ Metal tolerance protein 8 OS=Oryza sativa subsp. japonica GN=MTP8 PE=2 SV=2 5 132 8.0E-15
sp|Q2HJ10|ZNT2_MOUSE Zinc transporter 2 OS=Mus musculus GN=Slc30a2 PE=2 SV=1 264 411 8.0E-15
sp|O14863|ZNT4_HUMAN Zinc transporter 4 OS=Homo sapiens GN=SLC30A4 PE=2 SV=2 8 134 9.0E-15
sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN=slc30a5 PE=2 SV=1 6 135 1.0E-14
sp|Q5I020|ZNT8_XENLA Zinc transporter 8 OS=Xenopus laevis GN=slc30a8 PE=2 SV=1 271 419 1.0E-14
sp|P0CE46|ZNT8_RAT Zinc transporter 8 OS=Rattus norvegicus GN=Slc30a8 PE=1 SV=1 271 430 2.0E-14
sp|Q9BRI3|ZNT2_HUMAN Zinc transporter 2 OS=Homo sapiens GN=SLC30A2 PE=1 SV=1 259 411 4.0E-14
sp|O07084|CZCD_BACSU Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus subtilis (strain 168) GN=czcD PE=1 SV=1 19 127 6.0E-14
sp|Q6D7E5|ZITB_PECAS Zinc transporter ZitB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=zitB PE=3 SV=1 264 417 8.0E-14
sp|Q688R1|MTP1_ORYSJ Metal tolerance protein 1 OS=Oryza sativa subsp. japonica GN=MTP1 PE=2 SV=1 247 379 1.0E-13
sp|Q8Z8B6|ZITB_SALTI Zinc transporter ZitB OS=Salmonella typhi GN=zitB PE=3 SV=1 264 419 2.0E-13
sp|Q54QU8|Y3629_DICDI Probable zinc transporter protein DDB_G0283629 OS=Dictyostelium discoideum GN=DDB_G0283629 PE=3 SV=1 9 133 2.0E-13
sp|O07084|CZCD_BACSU Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus subtilis (strain 168) GN=czcD PE=1 SV=1 269 411 3.0E-13
sp|Q8Z8B6|ZITB_SALTI Zinc transporter ZitB OS=Salmonella typhi GN=zitB PE=3 SV=1 4 134 3.0E-13
sp|Q8X400|ZITB_ECO57 Zinc transporter ZitB OS=Escherichia coli O157:H7 GN=zitB PE=3 SV=1 19 140 3.0E-13
sp|Q8ZQT3|ZITB_SALTY Zinc transporter ZitB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zitB PE=3 SV=1 264 419 3.0E-13
sp|Q6ICY4|MTPC2_ARATH Metal tolerance protein C2 OS=Arabidopsis thaliana GN=MTPC2 PE=2 SV=1 2 135 4.0E-13
sp|Q83SA2|ZITB_SHIFL Zinc transporter ZitB OS=Shigella flexneri GN=zitB PE=3 SV=1 19 140 4.0E-13
sp|P75757|ZITB_ECOLI Zinc transporter ZitB OS=Escherichia coli (strain K12) GN=zitB PE=1 SV=1 19 140 4.0E-13
sp|Q54QU8|Y3629_DICDI Probable zinc transporter protein DDB_G0283629 OS=Dictyostelium discoideum GN=DDB_G0283629 PE=3 SV=1 262 411 5.0E-13
sp|A7Z1S6|CZCD_BACMF Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcD PE=3 SV=1 269 411 6.0E-13
sp|Q8R4H9|ZNT5_MOUSE Zinc transporter 5 OS=Mus musculus GN=Slc30a5 PE=1 SV=1 267 411 1.0E-12
sp|Q6DBM8|MTPB_ARATH Metal tolerance protein B OS=Arabidopsis thaliana GN=MTPB PE=2 SV=1 263 411 1.0E-12
sp|Q5XHB4|ZNT8_XENTR Zinc transporter 8 OS=Xenopus tropicalis GN=slc30a8 PE=2 SV=1 17 147 2.0E-12
sp|Q9ZT63|MTP1_ARATH Metal tolerance protein 1 OS=Arabidopsis thaliana GN=MTP1 PE=1 SV=2 246 379 2.0E-12
sp|Q6DG36|ZNT5_DANRE Zinc transporter 5 OS=Danio rerio GN=slc30a5 PE=2 SV=1 271 411 3.0E-12
sp|Q8TAD4|ZNT5_HUMAN Zinc transporter 5 OS=Homo sapiens GN=SLC30A5 PE=1 SV=1 271 411 5.0E-12
sp|Q9SI03|MTP12_ARATH Metal tolerance protein 12 OS=Arabidopsis thaliana GN=MTP12 PE=3 SV=1 274 415 1.0E-11
sp|Q5I020|ZNT8_XENLA Zinc transporter 8 OS=Xenopus laevis GN=slc30a8 PE=2 SV=1 4 147 1.0E-11
sp|Q8ZQT3|ZITB_SALTY Zinc transporter ZitB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zitB PE=3 SV=1 4 134 2.0E-11
sp|O55174|ZNT4_RAT Zinc transporter 4 OS=Rattus norvegicus GN=Slc30a4 PE=2 SV=1 258 423 3.0E-11
sp|Q5ZLF4|ZNT5_CHICK Zinc transporter 5 OS=Gallus gallus GN=SLC30A5 PE=2 SV=1 271 411 4.0E-11
sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN=slc30a5 PE=2 SV=1 263 411 4.0E-11
sp|Q55E98|Y9332_DICDI Probable zinc transporter protein DDB_G0269332 OS=Dictyostelium discoideum GN=DDB_G0269332 PE=3 SV=1 4 134 6.0E-11
sp|Q9LXS1|MTPA2_ARATH Metal tolerance protein A2 OS=Arabidopsis thaliana GN=MTPA2 PE=2 SV=2 264 379 6.0E-11
sp|O35149|ZNT4_MOUSE Zinc transporter 4 OS=Mus musculus GN=Slc30a4 PE=1 SV=2 258 411 1.0E-10
sp|Q03455|MSC2_YEAST Probable zinc transporter MSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC2 PE=1 SV=2 1 139 1.0E-10
sp|O14863|ZNT4_HUMAN Zinc transporter 4 OS=Homo sapiens GN=SLC30A4 PE=2 SV=2 256 417 2.0E-10
sp|Q6D7E5|ZITB_PECAS Zinc transporter ZitB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=zitB PE=3 SV=1 4 140 2.0E-10
sp|Q54F34|Y1141_DICDI Probable zinc transporter protein DDB_G0291141 OS=Dictyostelium discoideum GN=DDB_G0291141 PE=3 SV=1 266 379 6.0E-10
sp|Q8IWU4|ZNT8_HUMAN Zinc transporter 8 OS=Homo sapiens GN=SLC30A8 PE=1 SV=2 15 154 9.0E-10
sp|A5PMX1|ZNT7_DANRE Zinc transporter 7 OS=Danio rerio GN=slc30a7 PE=2 SV=1 259 411 1.0E-09
sp|Q2HJ10|ZNT2_MOUSE Zinc transporter 2 OS=Mus musculus GN=Slc30a2 PE=2 SV=1 15 155 1.0E-09
sp|Q9M271|MTPA1_ARATH Metal tolerance protein A1 OS=Arabidopsis thaliana GN=MTPA1 PE=2 SV=1 263 379 1.0E-09
sp|Q99726|ZNT3_HUMAN Zinc transporter 3 OS=Homo sapiens GN=SLC30A3 PE=1 SV=2 8 149 2.0E-09
sp|Q8NEW0|ZNT7_HUMAN Zinc transporter 7 OS=Homo sapiens GN=SLC30A7 PE=2 SV=1 256 412 2.0E-09
sp|P0CE46|ZNT8_RAT Zinc transporter 8 OS=Rattus norvegicus GN=Slc30a8 PE=1 SV=1 17 154 3.0E-09
sp|Q9ZT63|MTP1_ARATH Metal tolerance protein 1 OS=Arabidopsis thaliana GN=MTP1 PE=1 SV=2 8 127 3.0E-09
sp|Q08E25|ZNT3_BOVIN Zinc transporter 3 OS=Bos taurus GN=SLC30A3 PE=2 SV=1 15 158 4.0E-09
sp|Q5R617|ZNT3_PONAB Zinc transporter 3 OS=Pongo abelii GN=SLC30A3 PE=2 SV=1 8 149 4.0E-09
sp|Q6NRI1|ZNT7B_XENLA Zinc transporter 7-B OS=Xenopus laevis GN=slc30a7-b PE=2 SV=1 255 409 5.0E-09
sp|Q6P3N9|ZNT7_XENTR Zinc transporter 7 OS=Xenopus tropicalis GN=slc30a7 PE=2 SV=1 255 409 5.0E-09
sp|A4IFD7|ZNT7_BOVIN Zinc transporter 7 OS=Bos taurus GN=SLC30A7 PE=2 SV=1 256 412 6.0E-09
sp|Q6DBM8|MTPB_ARATH Metal tolerance protein B OS=Arabidopsis thaliana GN=MTPB PE=2 SV=1 6 127 6.0E-09
sp|Q9M271|MTPA1_ARATH Metal tolerance protein A1 OS=Arabidopsis thaliana GN=MTPA1 PE=2 SV=1 8 127 7.0E-09
sp|Q8BGG0|ZNT8_MOUSE Zinc transporter 8 OS=Mus musculus GN=Slc30a8 PE=2 SV=1 15 154 8.0E-09
sp|Q52KD7|ZNT7A_XENLA Zinc transporter 7-A OS=Xenopus laevis GN=slc30a7-a PE=2 SV=1 255 412 1.0E-08
sp|Q9JKN1|ZNT7_MOUSE Zinc transporter 7 OS=Mus musculus GN=Slc30a7 PE=1 SV=1 272 412 1.0E-08
sp|Q83SA2|ZITB_SHIFL Zinc transporter ZitB OS=Shigella flexneri GN=zitB PE=3 SV=1 264 419 2.0E-08
sp|P75757|ZITB_ECOLI Zinc transporter ZitB OS=Escherichia coli (strain K12) GN=zitB PE=1 SV=1 264 419 2.0E-08
sp|Q5BJM8|ZNT7_RAT Zinc transporter 7 OS=Rattus norvegicus GN=Slc30a7 PE=2 SV=2 272 412 3.0E-08
sp|Q8X400|ZITB_ECO57 Zinc transporter ZitB OS=Escherichia coli O157:H7 GN=zitB PE=3 SV=1 264 419 3.0E-08
sp|Q5MNV6|ZNT7_CHICK Zinc transporter 7 OS=Gallus gallus GN=SLC30A7 PE=2 SV=1 262 409 4.0E-08
sp|Q688R1|MTP1_ORYSJ Metal tolerance protein 1 OS=Oryza sativa subsp. japonica GN=MTP1 PE=2 SV=1 8 127 8.0E-08
sp|Q6QIX3|ZNT3_RAT Zinc transporter 3 OS=Rattus norvegicus GN=Slc30a3 PE=1 SV=1 14 149 3.0E-07
sp|Q62941|ZNT2_RAT Zinc transporter 2 OS=Rattus norvegicus GN=Slc30a2 PE=2 SV=1 15 134 5.0E-07
sp|P97441|ZNT3_MOUSE Zinc transporter 3 OS=Mus musculus GN=Slc30a3 PE=1 SV=1 8 87 6.0E-07
sp|Q9LXS1|MTPA2_ARATH Metal tolerance protein A2 OS=Arabidopsis thaliana GN=MTPA2 PE=2 SV=2 5 126 9.0E-07
sp|Q6P0D1|ZNT6_DANRE Zinc transporter 6 OS=Danio rerio GN=slc30a6 PE=2 SV=1 5 136 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0006811 ion transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 39 56 17
3 77 99 22
4 114 133 19
5 275 297 22
6 307 326 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|007220
MGLSRSTRITLLLVIDVLFFFIELIVGYAVGSLALVADSFHMLNDVLSLIVALYAIKLSASNKPNSRYTYGWHRA
EILAALVNGVFLLALCFSIFMEALERFFKTTEISSPRLVVIVGSFGLASNIVGLFLFHEHPEHEDKPKTHSSRSP
LVAASPTPGTARDIRDTSTSPTPSIEADYSYTPFIGHPAATRASMVRTAENMARPRSVSPESRRRDRRDSYPHHR
PTRSRSRSMADPVTHEVLPSADEEAPLLETTKDSPSTSSSKAGSMNMRALVLHVVGDALGNIGVIATGLVIWKTS
WSFKFYFDPIISLVITVIIFWNALPLVRSTSFILLQGVPSTVSIDEVRSSILAVPGVLSLHELHVWQLSESKLIA
SVHVLAESQFDFMHVASDIRTVLHHLGIHSSTIQPEYIQTGDPDPKRTNELSCLIRCPLDESCDSEDTCCPPPSI
EV*
Coding >AgabiH97|007220
ATGGGGCTCTCCCGCTCAACCAGAATCACCCTTCTCCTCGTCATCGACGTTCTTTTCTTCTTTATCGAACTCATC
GTCGGATATGCCGTGGGGTCTCTCGCCCTCGTCGCTGACAGTTTCCATATGCTCAACGATGTATTGAGTCTTATC
GTGGCCCTCTACGCTATCAAACTTTCCGCCTCCAACAAGCCCAATTCTCGCTACACCTATGGCTGGCATCGGGCC
GAAATCTTGGCTGCCCTCGTCAACGGCGTCTTCCTCTTGGCTCTGTGCTTCTCGATCTTTATGGAAGCGTTGGAA
CGCTTTTTTAAGACTACAGAAATCTCCAGTCCACGCCTTGTTGTTATCGTTGGCTCGTTTGGCTTAGCCTCTAAT
ATTGTTGGGCTCTTCCTCTTCCATGAGCACCCTGAGCATGAAGACAAGCCTAAAACACATTCCTCACGGTCGCCT
CTCGTCGCTGCATCCCCGACGCCGGGTACTGCTAGGGATATCCGTGACACCTCGACATCTCCTACTCCCTCAATC
GAAGCAGATTACTCGTATACGCCTTTTATTGGACACCCTGCTGCCACCCGTGCTTCTATGGTTAGAACGGCCGAA
AACATGGCTCGACCACGCTCTGTTTCGCCAGAGTCCCGCCGCCGTGATCGACGTGATTCATATCCCCATCACCGT
CCGACCCGCTCACGTTCTCGCTCCATGGCAGACCCCGTCACTCATGAAGTACTTCCCTCCGCCGATGAGGAAGCA
CCTTTACTTGAAACTACGAAAGATTCGCCTTCAACATCATCCTCCAAAGCTGGTTCCATGAATATGCGTGCTCTG
GTTCTTCATGTAGTCGGAGATGCTCTCGGTAACATTGGTGTCATAGCCACTGGACTTGTTATTTGGAAGACTTCA
TGGAGCTTCAAGTTTTATTTCGATCCTATCATCAGTCTAGTCATTACTGTGATAATTTTCTGGAACGCACTCCCG
CTCGTGCGGAGCACATCTTTCATTCTTCTACAGGGTGTCCCGTCAACAGTCTCTATTGACGAAGTGAGATCATCT
ATTCTGGCGGTCCCCGGCGTTTTATCACTACACGAGCTGCACGTCTGGCAATTATCAGAAAGCAAACTCATTGCT
TCTGTCCACGTTTTGGCTGAAAGCCAGTTTGACTTTATGCATGTAGCCTCTGACATTCGTACAGTTTTGCATCAT
CTCGGAATACATTCTTCTACGATACAACCGGAGTATATACAGACTGGCGATCCTGATCCGAAGCGTACCAATGAA
CTATCTTGCCTAATCCGATGCCCTTTGGATGAATCGTGCGACTCGGAAGACACTTGCTGCCCCCCGCCCTCTATC
GAGGTGTAA
Transcript >AgabiH97|007220
ATGGGGCTCTCCCGCTCAACCAGAATCACCCTTCTCCTCGTCATCGACGTTCTTTTCTTCTTTATCGAACTCATC
GTCGGATATGCCGTGGGGTCTCTCGCCCTCGTCGCTGACAGTTTCCATATGCTCAACGATGTATTGAGTCTTATC
GTGGCCCTCTACGCTATCAAACTTTCCGCCTCCAACAAGCCCAATTCTCGCTACACCTATGGCTGGCATCGGGCC
GAAATCTTGGCTGCCCTCGTCAACGGCGTCTTCCTCTTGGCTCTGTGCTTCTCGATCTTTATGGAAGCGTTGGAA
CGCTTTTTTAAGACTACAGAAATCTCCAGTCCACGCCTTGTTGTTATCGTTGGCTCGTTTGGCTTAGCCTCTAAT
ATTGTTGGGCTCTTCCTCTTCCATGAGCACCCTGAGCATGAAGACAAGCCTAAAACACATTCCTCACGGTCGCCT
CTCGTCGCTGCATCCCCGACGCCGGGTACTGCTAGGGATATCCGTGACACCTCGACATCTCCTACTCCCTCAATC
GAAGCAGATTACTCGTATACGCCTTTTATTGGACACCCTGCTGCCACCCGTGCTTCTATGGTTAGAACGGCCGAA
AACATGGCTCGACCACGCTCTGTTTCGCCAGAGTCCCGCCGCCGTGATCGACGTGATTCATATCCCCATCACCGT
CCGACCCGCTCACGTTCTCGCTCCATGGCAGACCCCGTCACTCATGAAGTACTTCCCTCCGCCGATGAGGAAGCA
CCTTTACTTGAAACTACGAAAGATTCGCCTTCAACATCATCCTCCAAAGCTGGTTCCATGAATATGCGTGCTCTG
GTTCTTCATGTAGTCGGAGATGCTCTCGGTAACATTGGTGTCATAGCCACTGGACTTGTTATTTGGAAGACTTCA
TGGAGCTTCAAGTTTTATTTCGATCCTATCATCAGTCTAGTCATTACTGTGATAATTTTCTGGAACGCACTCCCG
CTCGTGCGGAGCACATCTTTCATTCTTCTACAGGGTGTCCCGTCAACAGTCTCTATTGACGAAGTGAGATCATCT
ATTCTGGCGGTCCCCGGCGTTTTATCACTACACGAGCTGCACGTCTGGCAATTATCAGAAAGCAAACTCATTGCT
TCTGTCCACGTTTTGGCTGAAAGCCAGTTTGACTTTATGCATGTAGCCTCTGACATTCGTACAGTTTTGCATCAT
CTCGGAATACATTCTTCTACGATACAACCGGAGTATATACAGACTGGCGATCCTGATCCGAAGCGTACCAATGAA
CTATCTTGCCTAATCCGATGCCCTTTGGATGAATCGTGCGACTCGGAAGACACTTGCTGCCCCCCGCCCTCTATC
GAGGTGTAA
Gene >AgabiH97|007220
ATGGGGCTCTCCCGCTCAACCAGAATCACCCTTCTCCTCGTCATCGACGTTCTTTTCTTCTTTATCGAACTCATC
GTCGGTCCGTTCTTCCTTCTGACCTCTCCTCTCTGTCATCTTAACTGTGCACAGGATATGCCGTGGGGTCTCTCG
CCCTCGTCGCTGACAGTTTCCATATGCTCAAGTACGACGCTATTTTTCTGTGCAACATCATTCACTGATGTCTCC
GTAGCGATGTATTGAGTCTTATCGTGGCCCTCTACGCTATCAAAGTCACTGCATTTCCTTTCTTTTGTCAGCCCG
TCCTTTCTAACTCGCCTTATTAGCTTTCCGCCTCCAACAAGCCCAATTCTCGCTACACCTATGGCTGGCATCGGG
CCGAAATCTTGGCTGCCCTCGTCAACGGCGTCTTCCTCTTGGCTCTGTGCTTCTCGATCTTTATGGAAGCGTTGG
AACGCTTTTTTAAGACTACAGGTACTCTTCGGACGTCATGTCATGCTCACCCTTTTATTCACCTCACCATTAGAA
ATCTCCAGTCCACGCCTTGTTGTTATCGTTGGCTCGTTTGGCTTAGCCTCTAATATTGTTGGGCTCTTCCTCTTC
CATGGTACGAGTCCTTCTACCTCTTTCATATCTGTTACTCACTGGGTCATGCTCGATAGAGCACCCTGAGCATGA
AGACAAGCCTAAAACACATTCCTCACGGTCGCCTCTCGTCGCTGCATCCCCGACGCCGGGTACTGCTAGGGATAT
CCGTGACACCTCGACATCTCCTACTCCCTCAATCGAAGCAGATTACTCGTATACGCCTTTTATTGGACACCCTGC
TGCCACCCGTGCTTCTATGGTTAGAACGGCCGAAAACATGGCTCGACCACGCTCTGTTTCGCCAGAGTCCCGCCG
CCGTGATCGACGTGATTCATATCCCCATCACCGTCCGACCCGCTCACGTTCTCGCTCCATGGCAGACCCCGTCAC
TCATGAAGTACTTCCCTCCGCCGATGAGGAAGCACCTTTACTTGAAACTACGAAAGATTCGCCTTCAACATCATC
CTCCAAAGCTGGTTCCATGAATATGCGTGCTCTGGTTCTTCATGTAGTCGGAGATGCTCTCGGTAACATTGGTGT
CATAGCCACTGGACTTGTTATTTGGAAGACTTCATGGAGCTTCAAGTTTTATTTCGATCCTATCATCAGTCTAGT
CATTACTGTGATAATTTTCTGGAACGCACTCCCGCTCGGTCAGTCTGCCTCAAAGAACACTTAACCTTGCTGCTT
ACCAAATTACAGTGCGGAGCACATCTTTCATTCTTCTACAGGGTGTCCCGTCAACAGTCTCTATTGACGAAGTGA
GATCATCTATTCTGGCGGTCCCCGGCGTTTTATCACTACACGAGCTGCACGTCTGGCAATTATCAGAAAGCAAAC
TCATTGCTTCTGTCCACGTTTTGGCTGAAAGCCAGTTTGACTTTATGCATGTAGCCTCTGACATTCGTACAGTTT
TGCATCATCTCGGAATACATTCTTCTACGATACAACCGGAGTATATACAGACTGGCGATCCTGATCCGAAGGTGG
GCAGCTTTGTCCTTTTTCTTATATGTATCCTGGATTAACTCGAATCACCAGCGTACCAATGAACTATCTTGCCTA
ATCCGATGCCCTTTGGATGAATCGTGCGACTCGGAAGACACTTGCTGCCGTCAGTTCCAAATTGCTATTCATTTT
GCAAGTTTATATTAATTGTTGTTTTACAGCCCCGCCCTCTATCGAGGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail