Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|007140
Gene name
Locationscaffold_1:1706618..1707320
Strand+
Gene length (bp)702
Transcript length (bp)495
Coding sequence length (bp)495
Protein length (aa) 165

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01597 GCV_H Glycine cleavage H-protein 1.5E-39 40 159

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2RPV0|GCSH_RHORT Glycine cleavage system H protein OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gcvH PE=3 SV=1 41 159 1.0E-40
sp|Q9N121|GCSH_RABIT Glycine cleavage system H protein, mitochondrial OS=Oryctolagus cuniculus GN=GCSH PE=2 SV=1 19 162 3.0E-38
sp|Q91WK5|GCSH_MOUSE Glycine cleavage system H protein, mitochondrial OS=Mus musculus GN=Gcsh PE=1 SV=2 32 162 4.0E-38
sp|Q5I0P2|GCSH_RAT Glycine cleavage system H protein, mitochondrial OS=Rattus norvegicus GN=Gcsh PE=2 SV=1 32 162 4.0E-38
sp|P20821|GCSH_BOVIN Glycine cleavage system H protein, mitochondrial OS=Bos taurus GN=GCSH PE=1 SV=1 11 162 7.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2RPV0|GCSH_RHORT Glycine cleavage system H protein OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gcvH PE=3 SV=1 41 159 1.0E-40
sp|Q9N121|GCSH_RABIT Glycine cleavage system H protein, mitochondrial OS=Oryctolagus cuniculus GN=GCSH PE=2 SV=1 19 162 3.0E-38
sp|Q91WK5|GCSH_MOUSE Glycine cleavage system H protein, mitochondrial OS=Mus musculus GN=Gcsh PE=1 SV=2 32 162 4.0E-38
sp|Q5I0P2|GCSH_RAT Glycine cleavage system H protein, mitochondrial OS=Rattus norvegicus GN=Gcsh PE=2 SV=1 32 162 4.0E-38
sp|P20821|GCSH_BOVIN Glycine cleavage system H protein, mitochondrial OS=Bos taurus GN=GCSH PE=1 SV=1 11 162 7.0E-38
sp|P23434|GCSH_HUMAN Glycine cleavage system H protein, mitochondrial OS=Homo sapiens GN=GCSH PE=1 SV=2 19 162 3.0E-37
sp|Q9HDV9|GCSH_SCHPO Putative glycine cleavage system H protein, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcv3 PE=1 SV=1 4 164 4.0E-37
sp|Q2W9A4|GCSH_MAGSA Glycine cleavage system H protein OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=gcvH PE=3 SV=1 38 162 8.0E-37
sp|A5FUJ7|GCSH_ACICJ Glycine cleavage system H protein OS=Acidiphilium cryptum (strain JF-5) GN=gcvH PE=3 SV=1 40 158 2.0E-36
sp|B4RF17|GCSH_PHEZH Glycine cleavage system H protein OS=Phenylobacterium zucineum (strain HLK1) GN=gcvH PE=3 SV=1 40 161 4.0E-36
sp|B2IGK2|GCSH_BEII9 Glycine cleavage system H protein OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gcvH PE=3 SV=1 40 160 5.0E-36
sp|Q9WY55|GCSH_THEMA Glycine cleavage system H protein OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=gcvH PE=1 SV=1 39 157 3.0E-35
sp|Q1QWJ4|GCSH_CHRSD Glycine cleavage system H protein OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gcvH PE=3 SV=1 40 162 7.0E-35
sp|P46485|GCSH_FLATR Glycine cleavage system H protein, mitochondrial OS=Flaveria trinervia GN=GDCSH PE=2 SV=1 5 164 3.0E-34
sp|P11183|GCSH_CHICK Glycine cleavage system H protein, mitochondrial OS=Gallus gallus GN=GCSH PE=1 SV=2 32 162 4.0E-34
sp|C1F934|GCSH_ACIC5 Glycine cleavage system H protein OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=gcvH PE=3 SV=1 40 158 2.0E-33
sp|A9ACU4|GCSH_BURM1 Glycine cleavage system H protein OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=gcvH PE=3 SV=1 40 159 2.0E-33
sp|O82179|GCSH2_ARATH Glycine cleavage system H protein 2, mitochondrial OS=Arabidopsis thaliana GN=GDH2 PE=2 SV=1 18 163 3.0E-33
sp|A7HQX9|GCSH_PARL1 Glycine cleavage system H protein OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gcvH PE=3 SV=1 40 160 3.0E-33
sp|A1UTQ4|GCSH_BARBK Glycine cleavage system H protein OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=gcvH PE=3 SV=1 41 158 5.0E-33
sp|Q0VLA7|GCSH_ALCBS Glycine cleavage system H protein OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=gcvH PE=3 SV=1 40 160 8.0E-33
sp|P64212|GCSH_BRUSU Glycine cleavage system H protein OS=Brucella suis biovar 1 (strain 1330) GN=gcvH PE=3 SV=1 41 158 8.0E-33
sp|P64211|GCSH_BRUME Glycine cleavage system H protein OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gcvH PE=3 SV=1 41 158 8.0E-33
sp|Q2YKY0|GCSH_BRUA2 Glycine cleavage system H protein OS=Brucella abortus (strain 2308) GN=gcvH PE=3 SV=1 41 158 8.0E-33
sp|A7IHF1|GCSH_XANP2 Glycine cleavage system H protein OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gcvH PE=3 SV=1 36 159 1.0E-32
sp|A8LIH3|GCSH_DINSH Glycine cleavage system H protein OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=gcvH PE=3 SV=1 38 158 2.0E-32
sp|Q7MEH8|GCSH_VIBVY Glycine cleavage system H protein OS=Vibrio vulnificus (strain YJ016) GN=gcvH PE=3 SV=1 38 154 2.0E-32
sp|Q8D7G6|GCSH_VIBVU Glycine cleavage system H protein OS=Vibrio vulnificus (strain CMCP6) GN=gcvH PE=3 SV=1 38 154 2.0E-32
sp|A9IWV1|GCSH_BART1 Glycine cleavage system H protein OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gcvH PE=3 SV=1 41 158 2.0E-32
sp|A3C6G9|GCSH_ORYSJ Glycine cleavage system H protein, mitochondrial OS=Oryza sativa subsp. japonica GN=GDCSH PE=1 SV=1 40 154 2.0E-32
sp|A2Z9B8|GCSH_ORYSI Glycine cleavage system H protein, mitochondrial OS=Oryza sativa subsp. indica GN=GDCSH PE=2 SV=1 40 154 2.0E-32
sp|B8EPI0|GCSH_METSB Glycine cleavage system H protein OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gcvH PE=3 SV=1 40 158 4.0E-32
sp|Q8NXH7|GCSH_STAAW Glycine cleavage system H protein OS=Staphylococcus aureus (strain MW2) GN=gcvH PE=3 SV=1 40 158 4.0E-32
sp|Q6GB23|GCSH_STAAS Glycine cleavage system H protein OS=Staphylococcus aureus (strain MSSA476) GN=gcvH PE=3 SV=1 40 158 4.0E-32
sp|P16048|GCSH_PEA Glycine cleavage system H protein, mitochondrial OS=Pisum sativum GN=GDCSH PE=1 SV=1 40 164 4.0E-32
sp|P49359|GCSH_FLAPR Glycine cleavage system H protein, mitochondrial OS=Flaveria pringlei GN=GDCSH PE=2 SV=1 5 164 5.0E-32
sp|B1YQQ2|GCSH_BURA4 Glycine cleavage system H protein OS=Burkholderia ambifaria (strain MC40-6) GN=gcvH PE=3 SV=1 40 159 5.0E-32
sp|A7N5C3|GCSH_VIBCB Glycine cleavage system H protein OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gcvH PE=3 SV=1 38 158 5.0E-32
sp|Q4FMV2|GCSH_PELUB Glycine cleavage system H protein OS=Pelagibacter ubique (strain HTCC1062) GN=gcvH PE=3 SV=1 40 157 6.0E-32
sp|Q9A352|GCSH_CAUCR Glycine cleavage system H protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=gcvH PE=3 SV=1 40 159 6.0E-32
sp|B8H4V5|GCSH_CAUCN Glycine cleavage system H protein OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=gcvH PE=3 SV=1 40 159 6.0E-32
sp|Q6GII3|GCSH_STAAR Glycine cleavage system H protein OS=Staphylococcus aureus (strain MRSA252) GN=gcvH PE=3 SV=1 40 158 6.0E-32
sp|P64214|GCSH_STAAN Glycine cleavage system H protein OS=Staphylococcus aureus (strain N315) GN=gcvH PE=1 SV=1 40 158 6.0E-32
sp|P64213|GCSH_STAAM Glycine cleavage system H protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gcvH PE=3 SV=1 40 158 6.0E-32
sp|A5IR11|GCSH_STAA9 Glycine cleavage system H protein OS=Staphylococcus aureus (strain JH9) GN=gcvH PE=3 SV=1 40 158 6.0E-32
sp|A6TZT7|GCSH_STAA2 Glycine cleavage system H protein OS=Staphylococcus aureus (strain JH1) GN=gcvH PE=3 SV=1 40 158 6.0E-32
sp|A7X019|GCSH_STAA1 Glycine cleavage system H protein OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=gcvH PE=3 SV=1 40 158 6.0E-32
sp|A7GUH9|GCSH_BACCN Glycine cleavage system H protein OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=gcvH PE=3 SV=1 40 159 8.0E-32
sp|Q39732|GCSH_FLAAN Glycine cleavage system H protein, mitochondrial OS=Flaveria anomala GN=GDCSH PE=2 SV=1 5 164 1.0E-31
sp|Q87I04|GCSH_VIBPA Glycine cleavage system H protein OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gcvH PE=3 SV=1 38 158 1.0E-31
sp|A8Z1D8|GCSH_STAAT Glycine cleavage system H protein OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=gcvH PE=3 SV=1 40 158 1.0E-31
sp|A6QFB6|GCSH_STAAE Glycine cleavage system H protein OS=Staphylococcus aureus (strain Newman) GN=gcvH PE=3 SV=1 40 158 1.0E-31
sp|Q5HHK8|GCSH_STAAC Glycine cleavage system H protein OS=Staphylococcus aureus (strain COL) GN=gcvH PE=3 SV=1 40 158 1.0E-31
sp|Q2FZZ8|GCSH_STAA8 Glycine cleavage system H protein OS=Staphylococcus aureus (strain NCTC 8325) GN=gcvH PE=3 SV=1 40 158 1.0E-31
sp|Q2FII7|GCSH_STAA3 Glycine cleavage system H protein OS=Staphylococcus aureus (strain USA300) GN=gcvH PE=3 SV=1 40 158 1.0E-31
sp|Q21NX6|GCSH_SACD2 Glycine cleavage system H protein OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gcvH PE=3 SV=1 40 162 2.0E-31
sp|Q5KVJ7|GCSH_GEOKA Glycine cleavage system H protein OS=Geobacillus kaustophilus (strain HTA426) GN=gcvH PE=3 SV=1 40 159 2.0E-31
sp|Q1INT9|GCSH_KORVE Glycine cleavage system H protein OS=Koribacter versatilis (strain Ellin345) GN=gcvH PE=3 SV=1 40 157 3.0E-31
sp|Q2YWP4|GCSH_STAAB Glycine cleavage system H protein OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=gcvH PE=3 SV=1 40 158 3.0E-31
sp|Q9YDG2|GCSH_AERPE Probable glycine cleavage system H protein OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gcvH PE=3 SV=2 32 154 3.0E-31
sp|B5EUH0|GCSH_VIBFM Glycine cleavage system H protein OS=Vibrio fischeri (strain MJ11) GN=gcvH PE=3 SV=1 40 154 4.0E-31
sp|Q6G2F0|GCSH_BARHE Glycine cleavage system H protein OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gcvH PE=1 SV=1 41 158 7.0E-31
sp|Q67N37|GCSH_SYMTH Glycine cleavage system H protein OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=gcvH PE=3 SV=1 40 157 7.0E-31
sp|Q5HQR3|GCSH_STAEQ Glycine cleavage system H protein OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gcvH PE=3 SV=1 40 158 7.0E-31
sp|O67192|GCSH4_AQUAE Glycine cleavage system H protein 4 OS=Aquifex aeolicus (strain VF5) GN=gcvH4 PE=3 SV=1 39 157 8.0E-31
sp|Q5DZM4|GCSH_VIBF1 Glycine cleavage system H protein OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gcvH PE=3 SV=1 40 154 1.0E-30
sp|P93255|GCSH_MESCR Glycine cleavage system H protein, mitochondrial OS=Mesembryanthemum crystallinum GN=GDCSH PE=2 SV=1 40 158 1.0E-30
sp|Q9LQL0|GCSH3_ARATH Glycine cleavage system H protein 3, mitochondrial OS=Arabidopsis thaliana GN=GDH3 PE=1 SV=1 40 164 1.0E-30
sp|B9J3J0|GCSH_BACCQ Glycine cleavage system H protein OS=Bacillus cereus (strain Q1) GN=gcvH PE=3 SV=1 40 159 1.0E-30
sp|B7HUY1|GCSH_BACC7 Glycine cleavage system H protein OS=Bacillus cereus (strain AH187) GN=gcvH PE=3 SV=1 40 159 1.0E-30
sp|Q72Y91|GCSH_BACC1 Glycine cleavage system H protein OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=gcvH PE=3 SV=1 40 159 1.0E-30
sp|Q8CPW8|GCSH_STAES Glycine cleavage system H protein OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gcvH PE=3 SV=1 40 158 1.0E-30
sp|A4ISJ7|GCSH_GEOTN Glycine cleavage system H protein OS=Geobacillus thermodenitrificans (strain NG80-2) GN=gcvH PE=3 SV=1 40 159 1.0E-30
sp|A0K322|GCSH_BURCH Glycine cleavage system H protein OS=Burkholderia cenocepacia (strain HI2424) GN=gcvH PE=3 SV=1 40 159 1.0E-30
sp|B1JSZ3|GCSH_BURCC Glycine cleavage system H protein OS=Burkholderia cenocepacia (strain MC0-3) GN=gcvH PE=3 SV=1 40 159 1.0E-30
sp|Q1BRE9|GCSH_BURCA Glycine cleavage system H protein OS=Burkholderia cenocepacia (strain AU 1054) GN=gcvH PE=3 SV=1 40 159 1.0E-30
sp|Q3IFW0|GCSH_PSEHT Glycine cleavage system H protein OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gcvH PE=3 SV=1 40 159 1.0E-30
sp|P49360|GCSH_FLAPU Glycine cleavage system H protein, mitochondrial (Fragment) OS=Flaveria pubescens GN=GDCSH PE=2 SV=1 5 154 1.0E-30
sp|A1S966|GCSH_SHEAM Glycine cleavage system H protein OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gcvH PE=3 SV=1 40 159 2.0E-30
sp|Q89I87|GCSH_BRADU Glycine cleavage system H protein OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gcvH PE=3 SV=1 36 157 2.0E-30
sp|Q6FYZ6|GCSH_BARQU Glycine cleavage system H protein OS=Bartonella quintana (strain Toulouse) GN=gcvH PE=3 SV=1 41 158 2.0E-30
sp|B5Y8S2|GCSH_COPPD Glycine cleavage system H protein OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=gcvH PE=3 SV=1 33 158 2.0E-30
sp|Q5X0A5|GCSH_LEGPL Glycine cleavage system H protein OS=Legionella pneumophila (strain Lens) GN=gcvH PE=3 SV=1 40 158 2.0E-30
sp|Q5ZZ94|GCSH_LEGPH Glycine cleavage system H protein OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gcvH PE=3 SV=1 40 158 2.0E-30
sp|A5I9T6|GCSH_LEGPC Glycine cleavage system H protein OS=Legionella pneumophila (strain Corby) GN=gcvH PE=3 SV=1 40 158 2.0E-30
sp|Q5X8W2|GCSH_LEGPA Glycine cleavage system H protein OS=Legionella pneumophila (strain Paris) GN=gcvH PE=3 SV=1 40 158 2.0E-30
sp|B7NHW5|GCSH_ECO7I Glycine cleavage system H protein OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gcvH PE=3 SV=1 40 160 2.0E-30
sp|P25855|GCSH1_ARATH Glycine cleavage system H protein 1, mitochondrial OS=Arabidopsis thaliana GN=GDH1 PE=1 SV=1 40 164 3.0E-30
sp|B4EF27|GCSH_BURCJ Glycine cleavage system H protein OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=gcvH PE=3 SV=1 40 159 3.0E-30
sp|Q815Y3|GCSH_BACCR Glycine cleavage system H protein OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=gcvH PE=3 SV=1 40 159 3.0E-30
sp|B7HD14|GCSH_BACC4 Glycine cleavage system H protein OS=Bacillus cereus (strain B4264) GN=gcvH PE=3 SV=1 40 159 3.0E-30
sp|Q6HBR6|GCSH_BACHK Glycine cleavage system H protein OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=gcvH PE=3 SV=1 40 159 3.0E-30
sp|Q631X9|GCSH_BACCZ Glycine cleavage system H protein OS=Bacillus cereus (strain ZK / E33L) GN=gcvH PE=3 SV=1 40 159 3.0E-30
sp|C1EY77|GCSH_BACC3 Glycine cleavage system H protein OS=Bacillus cereus (strain 03BB102) GN=gcvH PE=3 SV=1 40 159 3.0E-30
sp|B7JEE3|GCSH_BACC0 Glycine cleavage system H protein OS=Bacillus cereus (strain AH820) GN=gcvH PE=3 SV=1 40 159 3.0E-30
sp|Q81XK8|GCSH_BACAN Glycine cleavage system H protein OS=Bacillus anthracis GN=gcvH PE=3 SV=1 40 159 3.0E-30
sp|C3LCC7|GCSH_BACAC Glycine cleavage system H protein OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=gcvH PE=3 SV=1 40 159 3.0E-30
sp|C3PDM2|GCSH_BACAA Glycine cleavage system H protein OS=Bacillus anthracis (strain A0248) GN=gcvH PE=3 SV=1 40 159 3.0E-30
sp|A9MRH1|GCSH_SALAR Glycine cleavage system H protein OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gcvH PE=3 SV=1 40 160 6.0E-30
sp|A4WE56|GCSH_ENT38 Glycine cleavage system H protein OS=Enterobacter sp. (strain 638) GN=gcvH PE=3 SV=1 40 160 6.0E-30
sp|B7INR1|GCSH_BACC2 Glycine cleavage system H protein OS=Bacillus cereus (strain G9842) GN=gcvH PE=3 SV=1 40 159 6.0E-30
sp|A6VXM7|GCSH_MARMS Glycine cleavage system H protein OS=Marinomonas sp. (strain MWYL1) GN=gcvH PE=3 SV=1 40 158 7.0E-30
sp|B4RSJ6|GCSH_ALTMD Glycine cleavage system H protein OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=gcvH PE=3 SV=1 40 159 1.0E-29
sp|C3LUU8|GCSH_VIBCM Glycine cleavage system H protein OS=Vibrio cholerae serotype O1 (strain M66-2) GN=gcvH PE=3 SV=1 38 154 1.0E-29
sp|Q9KMP5|GCSH_VIBCH Glycine cleavage system H protein OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gcvH PE=3 SV=1 38 154 1.0E-29
sp|A5EZ07|GCSH_VIBC3 Glycine cleavage system H protein OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gcvH PE=3 SV=1 38 154 1.0E-29
sp|A4JA70|GCSH_BURVG Glycine cleavage system H protein OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=gcvH PE=3 SV=1 40 159 1.0E-29
sp|Q0TDU8|GCSH_ECOL5 Glycine cleavage system H protein OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|Q8FE66|GCSH_ECOL6 Glycine cleavage system H protein OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gcvH PE=3 SV=3 40 160 2.0E-29
sp|A1AF93|GCSH_ECOK1 Glycine cleavage system H protein OS=Escherichia coli O1:K1 / APEC GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B7MZ56|GCSH_ECO81 Glycine cleavage system H protein OS=Escherichia coli O81 (strain ED1a) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B7MM90|GCSH_ECO45 Glycine cleavage system H protein OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B7UHV2|GCSH_ECO27 Glycine cleavage system H protein OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B7VSK2|GCSH_VIBTL Glycine cleavage system H protein OS=Vibrio tasmaniensis (strain LGP32) GN=gcvH PE=3 SV=1 38 154 2.0E-29
sp|A9VNZ4|GCSH_BACWK Glycine cleavage system H protein OS=Bacillus weihenstephanensis (strain KBAB4) GN=gcvH PE=3 SV=1 40 159 2.0E-29
sp|Q3YXW6|GCSH_SHISS Glycine cleavage system H protein OS=Shigella sonnei (strain Ss046) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|P0A6U2|GCSH_SHIFL Glycine cleavage system H protein OS=Shigella flexneri GN=gcvH PE=3 SV=2 40 160 2.0E-29
sp|Q0T0Z4|GCSH_SHIF8 Glycine cleavage system H protein OS=Shigella flexneri serotype 5b (strain 8401) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|Q31WG5|GCSH_SHIBS Glycine cleavage system H protein OS=Shigella boydii serotype 4 (strain Sb227) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B2U0S1|GCSH_SHIB3 Glycine cleavage system H protein OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|P0A6U1|GCSH_SALTI Glycine cleavage system H protein OS=Salmonella typhi GN=gcvH PE=3 SV=2 40 160 2.0E-29
sp|B4TV23|GCSH_SALSV Glycine cleavage system H protein OS=Salmonella schwarzengrund (strain CVM19633) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B5BFL9|GCSH_SALPK Glycine cleavage system H protein OS=Salmonella paratyphi A (strain AKU_12601) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|Q5PJG5|GCSH_SALPA Glycine cleavage system H protein OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B4T549|GCSH_SALNS Glycine cleavage system H protein OS=Salmonella newport (strain SL254) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B4TGX4|GCSH_SALHS Glycine cleavage system H protein OS=Salmonella heidelberg (strain SL476) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B5QXI1|GCSH_SALEP Glycine cleavage system H protein OS=Salmonella enteritidis PT4 (strain P125109) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B5FUG7|GCSH_SALDC Glycine cleavage system H protein OS=Salmonella dublin (strain CT_02021853) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B5F5H9|GCSH_SALA4 Glycine cleavage system H protein OS=Salmonella agona (strain SL483) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B7LPB8|GCSH_ESCF3 Glycine cleavage system H protein OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B1LDA4|GCSH_ECOSM Glycine cleavage system H protein OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B6I737|GCSH_ECOSE Glycine cleavage system H protein OS=Escherichia coli (strain SE11) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B7N7E7|GCSH_ECOLU Glycine cleavage system H protein OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|P0A6T9|GCSH_ECOLI Glycine cleavage system H protein OS=Escherichia coli (strain K12) GN=gcvH PE=1 SV=2 40 160 2.0E-29
sp|B1IT98|GCSH_ECOLC Glycine cleavage system H protein OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|A8A445|GCSH_ECOHS Glycine cleavage system H protein OS=Escherichia coli O9:H4 (strain HS) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B1XEJ1|GCSH_ECODH Glycine cleavage system H protein OS=Escherichia coli (strain K12 / DH10B) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|C5A0H6|GCSH_ECOBW Glycine cleavage system H protein OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B7LYG8|GCSH_ECO8A Glycine cleavage system H protein OS=Escherichia coli O8 (strain IAI1) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|B5YQ96|GCSH_ECO5E Glycine cleavage system H protein OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|P0A6U0|GCSH_ECO57 Glycine cleavage system H protein OS=Escherichia coli O157:H7 GN=gcvH PE=3 SV=2 40 160 2.0E-29
sp|B7LF90|GCSH_ECO55 Glycine cleavage system H protein OS=Escherichia coli (strain 55989 / EAEC) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|Q98LT7|GCSH_RHILO Glycine cleavage system H protein OS=Rhizobium loti (strain MAFF303099) GN=gcvH PE=3 SV=1 36 158 2.0E-29
sp|A7ZR13|GCSH_ECO24 Glycine cleavage system H protein OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|Q8ZM75|GCSH_SALTY Glycine cleavage system H protein OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gcvH PE=3 SV=3 40 160 2.0E-29
sp|C0PY27|GCSH_SALPC Glycine cleavage system H protein OS=Salmonella paratyphi C (strain RKS4594) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|Q57K61|GCSH_SALCH Glycine cleavage system H protein OS=Salmonella choleraesuis (strain SC-B67) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|A3D084|GCSH_SHEB5 Glycine cleavage system H protein OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gcvH PE=3 SV=1 40 159 2.0E-29
sp|B5RE15|GCSH_SALG2 Glycine cleavage system H protein OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gcvH PE=3 SV=1 40 160 2.0E-29
sp|A9L331|GCSH_SHEB9 Glycine cleavage system H protein OS=Shewanella baltica (strain OS195) GN=gcvH PE=3 SV=1 40 159 2.0E-29
sp|A6WSL2|GCSH_SHEB8 Glycine cleavage system H protein OS=Shewanella baltica (strain OS185) GN=gcvH PE=3 SV=1 40 159 2.0E-29
sp|B8EB46|GCSH_SHEB2 Glycine cleavage system H protein OS=Shewanella baltica (strain OS223) GN=gcvH PE=3 SV=1 40 159 2.0E-29
sp|Q49W45|GCSH_STAS1 Glycine cleavage system H protein OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=gcvH PE=3 SV=1 40 158 3.0E-29
sp|A9N3N2|GCSH_SALPB Glycine cleavage system H protein OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gcvH PE=3 SV=1 40 160 3.0E-29
sp|Q2JPE6|GCSH_SYNJB Glycine cleavage system H protein OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gcvH PE=3 SV=1 40 161 3.0E-29
sp|B8HU54|GCSH_CYAP4 Glycine cleavage system H protein OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=gcvH PE=3 SV=1 40 161 3.0E-29
sp|A8APB3|GCSH_CITK8 Glycine cleavage system H protein OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gcvH PE=3 SV=1 40 160 6.0E-29
sp|Q9U616|GCSH_DROME Glycine cleavage system H protein, mitochondrial OS=Drosophila melanogaster GN=ppl PE=2 SV=1 21 161 6.0E-29
sp|B2FR20|GCSH_STRMK Glycine cleavage system H protein OS=Stenotrophomonas maltophilia (strain K279a) GN=gcvH PE=3 SV=1 40 162 6.0E-29
sp|Q055P7|GCSH_LEPBL Glycine cleavage system H protein OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gcvH PE=3 SV=1 41 162 8.0E-29
sp|Q04PM8|GCSH_LEPBJ Glycine cleavage system H protein OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gcvH PE=3 SV=1 41 162 8.0E-29
sp|Q32BW6|GCSH_SHIDS Glycine cleavage system H protein OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gcvH PE=3 SV=1 40 160 9.0E-29
sp|A3QHI1|GCSH_SHELP Glycine cleavage system H protein OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gcvH PE=3 SV=1 40 159 9.0E-29
sp|Q83B07|GCSH_COXBU Glycine cleavage system H protein OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=gcvH PE=3 SV=1 41 158 1.0E-28
sp|A9NA78|GCSH_COXBR Glycine cleavage system H protein OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=gcvH PE=3 SV=1 41 158 1.0E-28
sp|A9KC18|GCSH_COXBN Glycine cleavage system H protein OS=Coxiella burnetii (strain Dugway 5J108-111) GN=gcvH PE=3 SV=1 41 158 1.0E-28
sp|B6J2H8|GCSH_COXB2 Glycine cleavage system H protein OS=Coxiella burnetii (strain CbuG_Q212) GN=gcvH PE=3 SV=1 41 158 1.0E-28
sp|B6J4T6|GCSH_COXB1 Glycine cleavage system H protein OS=Coxiella burnetii (strain CbuK_Q154) GN=gcvH PE=3 SV=1 41 158 1.0E-28
sp|Q9K786|GCSH_BACHD Glycine cleavage system H protein OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gcvH PE=3 SV=1 40 159 1.0E-28
sp|B5XUD4|GCSH_KLEP3 Glycine cleavage system H protein OS=Klebsiella pneumoniae (strain 342) GN=gcvH PE=3 SV=1 40 160 1.0E-28
sp|A6TDR6|GCSH_KLEP7 Glycine cleavage system H protein OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gcvH PE=3 SV=1 40 160 1.0E-28
sp|B8CK17|GCSH_SHEPW Glycine cleavage system H protein OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=gcvH PE=3 SV=1 40 160 1.0E-28
sp|B9DJH3|GCSH_STACT Glycine cleavage system H protein OS=Staphylococcus carnosus (strain TM300) GN=gcvH PE=3 SV=1 40 158 1.0E-28
sp|C5BM96|GCSH_TERTT Glycine cleavage system H protein OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=gcvH PE=3 SV=1 40 154 2.0E-28
sp|A7MR83|GCSH_CROS8 Glycine cleavage system H protein OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gcvH PE=3 SV=1 40 160 2.0E-28
sp|Q12R03|GCSH_SHEDO Glycine cleavage system H protein OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gcvH PE=3 SV=1 40 161 2.0E-28
sp|Q4L4R5|GCSH_STAHJ Glycine cleavage system H protein OS=Staphylococcus haemolyticus (strain JCSC1435) GN=gcvH PE=3 SV=1 40 158 2.0E-28
sp|C5D7J9|GCSH_GEOSW Glycine cleavage system H protein OS=Geobacillus sp. (strain WCH70) GN=gcvH PE=3 SV=1 40 158 2.0E-28
sp|Q6D975|GCSH_PECAS Glycine cleavage system H protein OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gcvH PE=3 SV=1 40 162 3.0E-28
sp|C5BAT1|GCSH_EDWI9 Glycine cleavage system H protein OS=Edwardsiella ictaluri (strain 93-146) GN=gcvH PE=3 SV=1 40 154 3.0E-28
sp|A8H7T0|GCSH_SHEPA Glycine cleavage system H protein OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gcvH PE=3 SV=1 40 160 3.0E-28
sp|Q0HEX1|GCSH_SHESM Glycine cleavage system H protein OS=Shewanella sp. (strain MR-4) GN=gcvH PE=3 SV=1 40 159 4.0E-28
sp|A0L104|GCSH_SHESA Glycine cleavage system H protein OS=Shewanella sp. (strain ANA-3) GN=gcvH PE=3 SV=1 40 159 4.0E-28
sp|Q8EIQ7|GCSH_SHEON Glycine cleavage system H protein OS=Shewanella oneidensis (strain MR-1) GN=gcvH PE=3 SV=1 40 159 4.0E-28
sp|B7GF88|GCSH_ANOFW Glycine cleavage system H protein OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=gcvH PE=3 SV=1 40 159 4.0E-28
sp|A1JPN4|GCSH_YERE8 Glycine cleavage system H protein OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gcvH PE=3 SV=1 40 154 4.0E-28
sp|B6ES34|GCSH_ALISL Glycine cleavage system H protein OS=Aliivibrio salmonicida (strain LFI1238) GN=gcvH PE=3 SV=1 40 154 4.0E-28
sp|Q8ENT9|GCSH_OCEIH Glycine cleavage system H protein OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=gcvH PE=3 SV=1 41 160 4.0E-28
sp|B8IU03|GCSH_METNO Glycine cleavage system H protein OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=gcvH PE=3 SV=1 40 157 5.0E-28
sp|Q9HTX6|GCSH2_PSEAE Glycine cleavage system H protein 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gcvH2 PE=3 SV=1 40 159 5.0E-28
sp|B4SSD9|GCSH_STRM5 Glycine cleavage system H protein OS=Stenotrophomonas maltophilia (strain R551-3) GN=gcvH PE=3 SV=1 40 154 5.0E-28
sp|B8D1D6|GCSH_HALOH Glycine cleavage system H protein OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=gcvH PE=3 SV=1 41 162 6.0E-28
sp|C5CAI7|GCSH_MICLC Glycine cleavage system H protein OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=gcvH PE=3 SV=1 40 157 6.0E-28
sp|Q92Q10|GCSH_RHIME Glycine cleavage system H protein OS=Rhizobium meliloti (strain 1021) GN=gcvH PE=3 SV=1 40 158 6.0E-28
sp|Q0HZ29|GCSH_SHESR Glycine cleavage system H protein OS=Shewanella sp. (strain MR-7) GN=gcvH PE=3 SV=1 40 159 6.0E-28
sp|A7Z8J3|GCSH_BACMF Glycine cleavage system H protein OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=gcvH PE=3 SV=1 40 155 7.0E-28
sp|B0TSG6|GCSH_SHEHH Glycine cleavage system H protein OS=Shewanella halifaxensis (strain HAW-EB4) GN=gcvH PE=3 SV=1 40 160 8.0E-28
sp|Q65F75|GCSH_BACLD Glycine cleavage system H protein OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=gcvH PE=3 SV=1 40 158 8.0E-28
sp|Q8F936|GCSH_LEPIN Glycine cleavage system H protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=gcvH PE=3 SV=1 41 162 9.0E-28
sp|Q72VI7|GCSH_LEPIC Glycine cleavage system H protein OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=gcvH PE=3 SV=1 41 162 9.0E-28
sp|A1RFY7|GCSH_SHESW Glycine cleavage system H protein OS=Shewanella sp. (strain W3-18-1) GN=gcvH PE=3 SV=1 40 159 9.0E-28
sp|A4YAD9|GCSH_SHEPC Glycine cleavage system H protein OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gcvH PE=3 SV=1 40 159 9.0E-28
sp|Q07YC8|GCSH_SHEFN Glycine cleavage system H protein OS=Shewanella frigidimarina (strain NCIMB 400) GN=gcvH PE=3 SV=1 40 159 1.0E-27
sp|C1D0F6|GCSH_DEIDV Glycine cleavage system H protein OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=gcvH PE=3 SV=1 33 156 1.0E-27
sp|B4UGZ2|GCSH_ANASK Glycine cleavage system H protein OS=Anaeromyxobacter sp. (strain K) GN=gcvH PE=3 SV=1 40 162 1.0E-27
sp|B8JDY7|GCSH_ANAD2 Glycine cleavage system H protein OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=gcvH PE=3 SV=1 40 162 1.0E-27
sp|B2VF34|GCSH_ERWT9 Glycine cleavage system H protein OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gcvH PE=3 SV=1 40 158 1.0E-27
sp|A0LXS6|GCSH_GRAFK Glycine cleavage system H protein OS=Gramella forsetii (strain KT0803) GN=gcvH PE=3 SV=1 40 154 1.0E-27
sp|Q5R191|GCSH_IDILO Glycine cleavage system H protein OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gcvH PE=3 SV=1 40 159 1.0E-27
sp|C3MCZ7|GCSH_RHISN Glycine cleavage system H protein OS=Rhizobium sp. (strain NGR234) GN=gcvH PE=3 SV=1 40 158 1.0E-27
sp|B1KG88|GCSH_SHEWM Glycine cleavage system H protein OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=gcvH PE=3 SV=1 40 159 2.0E-27
sp|O32174|GCSH_BACSU Glycine cleavage system H protein OS=Bacillus subtilis (strain 168) GN=gcvH PE=1 SV=1 40 155 2.0E-27
sp|B7L0K9|GCSH_METC4 Glycine cleavage system H protein OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=gcvH PE=3 SV=1 40 157 2.0E-27
sp|Q9RTF3|GCSH_DEIRA Glycine cleavage system H protein OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=gcvH PE=3 SV=1 39 159 3.0E-27
sp|Q7N198|GCSH_PHOLL Glycine cleavage system H protein OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gcvH PE=3 SV=1 40 162 3.0E-27
sp|A1WWA4|GCSH_HALHL Glycine cleavage system H protein OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gcvH PE=3 SV=1 40 158 3.0E-27
sp|C6D8X0|GCSH_PECCP Glycine cleavage system H protein OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gcvH PE=3 SV=1 40 162 3.0E-27
sp|B1ZU74|GCSH_OPITP Glycine cleavage system H protein OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=gcvH PE=3 SV=1 40 142 3.0E-27
sp|B0K241|GCSH_THEPX Glycine cleavage system H protein OS=Thermoanaerobacter sp. (strain X514) GN=gcvH PE=3 SV=1 41 159 4.0E-27
sp|B0KD96|GCSH_THEP3 Glycine cleavage system H protein OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=gcvH PE=3 SV=1 41 159 4.0E-27
sp|A8MEG5|GCSH_ALKOO Glycine cleavage system H protein OS=Alkaliphilus oremlandii (strain OhILAs) GN=gcvH PE=3 SV=1 33 157 4.0E-27
sp|B0U269|GCSH_XYLFM Glycine cleavage system H protein OS=Xylella fastidiosa (strain M12) GN=gcvH PE=3 SV=1 40 162 4.0E-27
sp|A6U8Q4|GCSH_SINMW Glycine cleavage system H protein OS=Sinorhizobium medicae (strain WSM419) GN=gcvH PE=3 SV=1 40 158 5.0E-27
sp|O86566|GCSH_STRCO Glycine cleavage system H protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=gcvH PE=3 SV=1 40 157 5.0E-27
sp|Q9PGW7|GCSH_XYLFA Glycine cleavage system H protein OS=Xylella fastidiosa (strain 9a5c) GN=gcvH PE=3 SV=2 40 162 5.0E-27
sp|A9W103|GCSH_METEP Glycine cleavage system H protein OS=Methylobacterium extorquens (strain PA1) GN=gcvH PE=3 SV=1 40 157 6.0E-27
sp|Q87EZ7|GCSH_XYLFT Glycine cleavage system H protein OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gcvH PE=3 SV=1 40 162 6.0E-27
sp|B2I6Q0|GCSH_XYLF2 Glycine cleavage system H protein OS=Xylella fastidiosa (strain M23) GN=gcvH PE=3 SV=1 40 162 6.0E-27
sp|A8FZK5|GCSH_SHESH Glycine cleavage system H protein OS=Shewanella sediminis (strain HAW-EB3) GN=gcvH PE=3 SV=1 40 159 6.0E-27
sp|Q15PU5|GCSH_PSEA6 Glycine cleavage system H protein OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gcvH PE=3 SV=1 40 158 7.0E-27
sp|Q5V231|GCSH_HALMA Probable glycine cleavage system H protein OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=gcvH PE=3 SV=1 40 154 7.0E-27
sp|B1JNS7|GCSH_YERPY Glycine cleavage system H protein OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gcvH PE=3 SV=1 40 154 7.0E-27
sp|Q666R6|GCSH_YERPS Glycine cleavage system H protein OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gcvH PE=3 SV=1 40 154 7.0E-27
sp|A4TIA6|GCSH_YERPP Glycine cleavage system H protein OS=Yersinia pestis (strain Pestoides F) GN=gcvH PE=3 SV=1 40 154 7.0E-27
sp|Q1CEZ8|GCSH_YERPN Glycine cleavage system H protein OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gcvH PE=3 SV=1 40 154 7.0E-27
sp|A9R4K7|GCSH_YERPG Glycine cleavage system H protein OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gcvH PE=3 SV=1 40 154 7.0E-27
sp|Q8ZHI7|GCSH_YERPE Glycine cleavage system H protein OS=Yersinia pestis GN=gcvH PE=3 SV=1 40 154 7.0E-27
sp|B2K0Q4|GCSH_YERPB Glycine cleavage system H protein OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gcvH PE=3 SV=1 40 154 7.0E-27
sp|Q1CB43|GCSH_YERPA Glycine cleavage system H protein OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gcvH PE=3 SV=1 40 154 7.0E-27
sp|A7FF20|GCSH_YERP3 Glycine cleavage system H protein OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gcvH PE=3 SV=1 40 154 7.0E-27
sp|B0C921|GCSH_ACAM1 Glycine cleavage system H protein OS=Acaryochloris marina (strain MBIC 11017) GN=gcvH PE=3 SV=1 40 158 8.0E-27
sp|A9KQK0|GCSH_CLOPH Glycine cleavage system H protein OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=gcvH PE=3 SV=1 33 158 8.0E-27
sp|A5N934|GCSH_CLOK5 Glycine cleavage system H protein OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=gcvH PE=3 SV=1 41 160 9.0E-27
sp|B9E2H2|GCSH_CLOK1 Glycine cleavage system H protein OS=Clostridium kluyveri (strain NBRC 12016) GN=gcvH PE=3 SV=1 41 160 9.0E-27
sp|Q0A5H0|GCSH_ALKEH Glycine cleavage system H protein OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gcvH PE=3 SV=1 40 162 1.0E-26
sp|A6LGR3|GCSH_PARD8 Glycine cleavage system H protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=gcvH PE=3 SV=1 40 158 1.0E-26
sp|B3DZN7|GCSH_METI4 Glycine cleavage system H protein OS=Methylacidiphilum infernorum (isolate V4) GN=gcvH PE=3 SV=1 39 162 1.0E-26
sp|Q1AR90|GCSH_RUBXD Glycine cleavage system H protein OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=gcvH PE=3 SV=1 41 162 1.0E-26
sp|Q5H1X2|GCSH_XANOR Glycine cleavage system H protein OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=gcvH PE=3 SV=1 40 162 1.0E-26
sp|B2SSQ0|GCSH_XANOP Glycine cleavage system H protein OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=gcvH PE=3 SV=1 40 162 1.0E-26
sp|Q2P4S4|GCSH_XANOM Glycine cleavage system H protein OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gcvH PE=3 SV=1 40 162 1.0E-26
sp|A9B2Q6|GCSH_HERA2 Glycine cleavage system H protein OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=gcvH PE=3 SV=1 41 160 1.0E-26
sp|A6L091|GCSH_BACV8 Glycine cleavage system H protein OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=gcvH PE=3 SV=1 40 159 2.0E-26
sp|Q2YCK0|GCSH_NITMU Glycine cleavage system H protein OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gcvH PE=3 SV=1 40 162 2.0E-26
sp|B0VCZ2|GCSH_ACIBY Glycine cleavage system H protein OS=Acinetobacter baumannii (strain AYE) GN=gcvH PE=3 SV=1 40 156 2.0E-26
sp|A3M4W5|GCSH_ACIBT Glycine cleavage system H protein OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=gcvH PE=3 SV=2 40 156 2.0E-26
sp|B2HZ03|GCSH_ACIBC Glycine cleavage system H protein OS=Acinetobacter baumannii (strain ACICU) GN=gcvH PE=3 SV=1 40 156 2.0E-26
sp|B7I4Z0|GCSH_ACIB5 Glycine cleavage system H protein OS=Acinetobacter baumannii (strain AB0057) GN=gcvH PE=3 SV=1 40 156 2.0E-26
sp|B7H3Q0|GCSH_ACIB3 Glycine cleavage system H protein OS=Acinetobacter baumannii (strain AB307-0294) GN=gcvH PE=3 SV=1 40 156 2.0E-26
sp|B4F0N8|GCSH_PROMH Glycine cleavage system H protein OS=Proteus mirabilis (strain HI4320) GN=gcvH PE=3 SV=1 40 162 2.0E-26
sp|Q31EI1|GCSH_THICR Glycine cleavage system H protein OS=Thiomicrospira crunogena (strain XCL-2) GN=gcvH PE=3 SV=1 40 161 2.0E-26
sp|Q54JV8|GCSH1_DICDI Probable glycine cleavage system H protein 1, mitochondrial OS=Dictyostelium discoideum GN=gcvH1 PE=3 SV=1 25 158 2.0E-26
sp|C1DD72|GCSH_LARHH Glycine cleavage system H protein OS=Laribacter hongkongensis (strain HLHK9) GN=gcvH PE=3 SV=1 40 155 2.0E-26
sp|Q8A4S8|GCSH_BACTN Glycine cleavage system H protein OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gcvH PE=3 SV=1 40 159 2.0E-26
sp|Q972C3|GCSH1_SULTO Probable glycine cleavage system H protein 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gcvH1 PE=3 SV=2 34 162 3.0E-26
sp|Q4J912|GCSH1_SULAC Probable glycine cleavage system H protein 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gcvH1 PE=3 SV=1 56 162 3.0E-26
sp|Q3B2G2|GCSH_CHLL7 Glycine cleavage system H protein OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gcvH PE=3 SV=1 40 158 3.0E-26
sp|Q88CI8|GCSH2_PSEPK Glycine cleavage system H protein 2 OS=Pseudomonas putida (strain KT2440) GN=gcvH2 PE=3 SV=1 40 158 3.0E-26
sp|Q2NRE9|GCSH_SODGM Glycine cleavage system H protein OS=Sodalis glossinidius (strain morsitans) GN=gcvH PE=3 SV=1 40 159 3.0E-26
sp|Q8PI38|GCSH_XANAC Glycine cleavage system H protein OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gcvH PE=3 SV=1 40 154 3.0E-26
sp|Q3AET6|GCSH_CARHZ Glycine cleavage system H protein OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=gcvH PE=3 SV=1 40 158 4.0E-26
sp|Q8P6T9|GCSH_XANCP Glycine cleavage system H protein OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gcvH PE=3 SV=1 40 154 5.0E-26
sp|B0RQ92|GCSH_XANCB Glycine cleavage system H protein OS=Xanthomonas campestris pv. campestris (strain B100) GN=gcvH PE=3 SV=1 40 154 5.0E-26
sp|Q4UXC1|GCSH_XANC8 Glycine cleavage system H protein OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gcvH PE=3 SV=1 40 154 5.0E-26
sp|B2JJ72|GCSH_BURP8 Glycine cleavage system H protein OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=gcvH PE=3 SV=1 40 154 5.0E-26
sp|C0ZL15|GCSH_BREBN Glycine cleavage system H protein OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=gcvH PE=3 SV=1 40 158 6.0E-26
sp|Q3BQN7|GCSH_XANC5 Glycine cleavage system H protein OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gcvH PE=3 SV=1 40 154 6.0E-26
sp|Q82JI1|GCSH_STRAW Glycine cleavage system H protein OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=gcvH PE=3 SV=1 40 157 7.0E-26
sp|Q5L7W4|GCSH_BACFN Glycine cleavage system H protein OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gcvH PE=3 SV=1 40 159 7.0E-26
sp|B9LPA9|GCSH_HALLT Probable glycine cleavage system H protein OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=gcvH PE=3 SV=1 39 158 7.0E-26
sp|Q88AR9|GCSH2_PSESM Glycine cleavage system H protein 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gcvH2 PE=3 SV=1 40 159 8.0E-26
sp|A4SP34|GCSH_AERS4 Glycine cleavage system H protein OS=Aeromonas salmonicida (strain A449) GN=gcvH PE=3 SV=1 40 159 8.0E-26
sp|A5HZP0|GCSH_CLOBH Glycine cleavage system H protein OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=gcvH PE=3 SV=1 33 155 9.0E-26
sp|A7FRV4|GCSH_CLOB1 Glycine cleavage system H protein OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=gcvH PE=3 SV=1 33 155 9.0E-26
sp|A0LDQ0|GCSH_MAGMM Glycine cleavage system H protein OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=gcvH PE=3 SV=1 41 163 1.0E-25
sp|B1KWD6|GCSH_CLOBM Glycine cleavage system H protein OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=gcvH PE=3 SV=1 33 155 1.0E-25
sp|C1FTW4|GCSH_CLOBJ Glycine cleavage system H protein OS=Clostridium botulinum (strain Kyoto / Type A2) GN=gcvH PE=3 SV=1 33 155 1.0E-25
sp|Q3JCM7|GCSH_NITOC Glycine cleavage system H protein OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gcvH PE=3 SV=1 40 158 1.0E-25
sp|Q72LB0|GCSH_THET2 Glycine cleavage system H protein OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=gcvH PE=3 SV=1 39 154 1.0E-25
sp|A8GIS0|GCSH_SERP5 Glycine cleavage system H protein OS=Serratia proteamaculans (strain 568) GN=gcvH PE=3 SV=1 40 159 1.0E-25
sp|Q13SR7|GCSH_BURXL Glycine cleavage system H protein OS=Burkholderia xenovorans (strain LB400) GN=gcvH PE=3 SV=1 40 158 1.0E-25
sp|A0KJ04|GCSH_AERHH Glycine cleavage system H protein OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=gcvH PE=3 SV=1 40 159 1.0E-25
sp|P73560|GCSH_SYNY3 Glycine cleavage system H protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gcvH PE=3 SV=1 41 141 1.0E-25
sp|B4SE01|GCSH_PELPB Glycine cleavage system H protein OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=gcvH PE=3 SV=1 40 154 2.0E-25
sp|Q1QCL5|GCSH_PSYCK Glycine cleavage system H protein OS=Psychrobacter cryohalolentis (strain K5) GN=gcvH PE=3 SV=1 40 156 2.0E-25
sp|Q4FTK7|GCSH_PSYA2 Glycine cleavage system H protein OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=gcvH PE=3 SV=1 40 156 2.0E-25
sp|Q8UFD5|GCSH_AGRFC Glycine cleavage system H protein OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gcvH PE=3 SV=1 40 158 2.0E-25
sp|Q8XU99|GCSH_RALSO Glycine cleavage system H protein OS=Ralstonia solanacearum (strain GMI1000) GN=gcvH PE=3 SV=1 34 154 2.0E-25
sp|Q1D7X3|GCSH_MYXXD Glycine cleavage system H protein OS=Myxococcus xanthus (strain DK 1622) GN=gcvH PE=3 SV=1 40 161 2.0E-25
sp|B0UAJ5|GCSH_METS4 Glycine cleavage system H protein OS=Methylobacterium sp. (strain 4-46) GN=gcvH PE=3 SV=1 40 154 2.0E-25
sp|Q1IX33|GCSH_DEIGD Glycine cleavage system H protein OS=Deinococcus geothermalis (strain DSM 11300) GN=gcvH PE=3 SV=1 40 154 2.0E-25
sp|Q5NZ92|GCSH_AROAE Glycine cleavage system H protein OS=Aromatoleum aromaticum (strain EbN1) GN=gcvH PE=3 SV=1 40 161 2.0E-25
sp|Q2JX00|GCSH_SYNJA Glycine cleavage system H protein OS=Synechococcus sp. (strain JA-3-3Ab) GN=gcvH PE=3 SV=1 40 161 2.0E-25
sp|A7GB84|GCSH_CLOBL Glycine cleavage system H protein OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=gcvH PE=3 SV=1 33 155 2.0E-25
sp|B1IEV4|GCSH_CLOBK Glycine cleavage system H protein OS=Clostridium botulinum (strain Okra / Type B1) GN=gcvH PE=3 SV=1 33 155 2.0E-25
sp|A1TYT9|GCSH_MARHV Glycine cleavage system H protein OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gcvH PE=3 SV=1 40 149 3.0E-25
sp|B3PI81|GCSH_CELJU Glycine cleavage system H protein OS=Cellvibrio japonicus (strain Ueda107) GN=gcvH PE=3 SV=1 40 162 3.0E-25
sp|Q8Y4L2|GCSH_LISMO Glycine cleavage system H protein OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=gcvH PE=3 SV=1 41 159 3.0E-25
sp|B8DDD3|GCSH_LISMH Glycine cleavage system H protein OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=gcvH PE=3 SV=1 41 159 3.0E-25
sp|Q97ZI6|GCSH1_SULSO Probable glycine cleavage system H protein 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gcvH1 PE=3 SV=1 56 154 3.0E-25
sp|A8FH75|GCSH_BACP2 Glycine cleavage system H protein OS=Bacillus pumilus (strain SAFR-032) GN=gcvH PE=3 SV=1 40 155 3.0E-25
sp|B0VR13|GCSH_ACIBS Glycine cleavage system H protein OS=Acinetobacter baumannii (strain SDF) GN=gcvH PE=3 SV=1 40 156 3.0E-25
sp|B2T7I7|GCSH_BURPP Glycine cleavage system H protein OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=gcvH PE=3 SV=1 40 154 3.0E-25
sp|B1Z7Y5|GCSH_METPB Glycine cleavage system H protein OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=gcvH PE=3 SV=1 40 157 4.0E-25
sp|A5GWN5|GCSH_SYNR3 Glycine cleavage system H protein OS=Synechococcus sp. (strain RCC307) GN=gcvH PE=3 SV=1 40 160 5.0E-25
sp|B9JWI3|GCSH_AGRVS Glycine cleavage system H protein OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gcvH PE=3 SV=1 40 158 5.0E-25
sp|Q8RDF0|GCSH1_CALS4 Glycine cleavage system H protein 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gcvH1 PE=3 SV=1 33 158 5.0E-25
sp|B2GK12|GCSH_KOCRD Glycine cleavage system H protein OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=gcvH PE=3 SV=1 41 159 6.0E-25
sp|C3L1M6|GCSH_CLOB6 Glycine cleavage system H protein OS=Clostridium botulinum (strain 657 / Type Ba4) GN=gcvH PE=3 SV=1 33 155 7.0E-25
sp|B4S5J3|GCSH_PROA2 Glycine cleavage system H protein OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=gcvH PE=3 SV=1 41 158 7.0E-25
sp|A0ALA8|GCSH_LISW6 Glycine cleavage system H protein OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=gcvH PE=3 SV=1 41 155 1.0E-24
sp|Q311A6|GCSH_DESAG Glycine cleavage system H protein OS=Desulfovibrio alaskensis (strain G20) GN=gcvH PE=3 SV=1 40 160 1.0E-24
sp|C5A593|GCSH_THEGJ Probable glycine cleavage system H protein OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=gcvH PE=3 SV=1 41 158 1.0E-24
sp|Q64N36|GCSH_BACFR Glycine cleavage system H protein OS=Bacteroides fragilis (strain YCH46) GN=gcvH PE=3 SV=1 40 159 1.0E-24
sp|Q5SKW9|GCSH_THET8 Glycine cleavage system H protein OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=gcvH PE=1 SV=1 39 154 1.0E-24
sp|Q71X03|GCSH_LISMF Glycine cleavage system H protein OS=Listeria monocytogenes serotype 4b (strain F2365) GN=gcvH PE=3 SV=1 41 159 2.0E-24
sp|C1KY63|GCSH_LISMC Glycine cleavage system H protein OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=gcvH PE=3 SV=1 41 159 2.0E-24
sp|P39726|GCSH_YEAST Glycine cleavage system H protein, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCV3 PE=1 SV=3 40 155 2.0E-24
sp|A4SG07|GCSH_CHLPM Glycine cleavage system H protein OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=gcvH PE=3 SV=1 40 160 2.0E-24
sp|B3EH27|GCSH_CHLL2 Glycine cleavage system H protein OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=gcvH PE=3 SV=1 40 159 2.0E-24
sp|Q60CU8|GCSH_METCA Glycine cleavage system H protein OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gcvH PE=3 SV=1 40 154 3.0E-24
sp|B2J428|GCSH_NOSP7 Glycine cleavage system H protein OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gcvH PE=3 SV=1 40 154 3.0E-24
sp|A9M2B7|GCSH_NEIM0 Glycine cleavage system H protein OS=Neisseria meningitidis serogroup C (strain 053442) GN=gcvH PE=3 SV=1 40 154 4.0E-24
sp|Q3IN29|GCSH_NATPD Probable glycine cleavage system H protein OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=gcvH PE=3 SV=1 39 158 4.0E-24
sp|Q9I136|GCSH1_PSEAE Glycine cleavage system H protein 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gcvH1 PE=3 SV=1 40 164 4.0E-24
sp|A1K4Z8|GCSH_AZOSB Glycine cleavage system H protein OS=Azoarcus sp. (strain BH72) GN=gcvH PE=3 SV=1 40 160 4.0E-24
sp|Q928L3|GCSH_LISIN Glycine cleavage system H protein OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=gcvH PE=3 SV=1 41 155 6.0E-24
sp|A1BE02|GCSH_CHLPD Glycine cleavage system H protein OS=Chlorobium phaeobacteroides (strain DSM 266) GN=gcvH PE=3 SV=1 40 158 7.0E-24
sp|Q8U0U0|GCSH_PYRFU Probable glycine cleavage system H protein OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gcvH PE=3 SV=1 41 159 7.0E-24
sp|Q2S0U9|GCSH_SALRD Glycine cleavage system H protein OS=Salinibacter ruber (strain DSM 13855 / M31) GN=gcvH PE=3 SV=1 41 154 8.0E-24
sp|Q5F6Y8|GCSH_NEIG1 Glycine cleavage system H protein OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gcvH PE=3 SV=1 40 154 1.0E-23
sp|B3QM31|GCSH_CHLP8 Glycine cleavage system H protein OS=Chlorobaculum parvum (strain NCIB 8327) GN=gcvH PE=3 SV=1 40 158 1.0E-23
sp|Q8RCW0|GCSH2_CALS4 Glycine cleavage system H protein 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=gcvH2 PE=3 SV=1 41 158 1.0E-23
sp|Q8KC04|GCSH_CHLTE Glycine cleavage system H protein OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=gcvH PE=3 SV=1 40 158 2.0E-23
sp|B1VZY6|GCSH_STRGG Glycine cleavage system H protein OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=gcvH PE=3 SV=1 40 160 2.0E-23
sp|Q0AEP8|GCSH_NITEC Glycine cleavage system H protein OS=Nitrosomonas eutropha (strain C91) GN=gcvH PE=3 SV=1 40 160 2.0E-23
sp|A1SY73|GCSH_PSYIN Glycine cleavage system H protein OS=Psychromonas ingrahamii (strain 37) GN=gcvH PE=3 SV=1 41 154 2.0E-23
sp|Q5JFJ9|GCSH_THEKO Probable glycine cleavage system H protein OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gcvH PE=3 SV=1 41 158 2.0E-23
sp|Q6FB57|GCSH_ACIAD Glycine cleavage system H protein OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=gcvH PE=3 SV=1 61 156 3.0E-23
sp|Q3APU2|GCSH_CHLCH Glycine cleavage system H protein OS=Chlorobium chlorochromatii (strain CaD3) GN=gcvH PE=3 SV=1 40 158 3.0E-23
sp|Q9V0G1|GCSH_PYRAB Probable glycine cleavage system H protein OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gcvH PE=3 SV=3 41 160 4.0E-23
sp|A1KSI4|GCSH_NEIMF Glycine cleavage system H protein OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gcvH PE=3 SV=1 40 154 4.0E-23
sp|Q9JVP1|GCSH_NEIMA Glycine cleavage system H protein OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gcvH PE=3 SV=1 40 154 4.0E-23
sp|Q3SMB7|GCSH_THIDA Glycine cleavage system H protein OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gcvH PE=3 SV=1 40 160 4.0E-23
sp|B0SQA2|GCSH_LEPBP Glycine cleavage system H protein OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=gcvH PE=3 SV=1 41 159 4.0E-23
sp|B0SGN9|GCSH_LEPBA Glycine cleavage system H protein OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=gcvH PE=3 SV=1 41 159 4.0E-23
sp|B7K739|GCSH_CYAP7 Glycine cleavage system H protein OS=Cyanothece sp. (strain PCC 7424) GN=gcvH PE=3 SV=1 40 158 5.0E-23
sp|O59049|GCSH_PYRHO Probable glycine cleavage system H protein OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gcvH PE=3 SV=2 41 159 6.0E-23
sp|Q4JXU4|GCSH_CORJK Glycine cleavage system H protein OS=Corynebacterium jeikeium (strain K411) GN=gcvH PE=3 SV=1 41 156 7.0E-23
sp|Q3AGL5|GCSH_SYNSC Glycine cleavage system H protein OS=Synechococcus sp. (strain CC9605) GN=gcvH PE=3 SV=1 40 159 8.0E-23
sp|B1WT69|GCSH_CYAA5 Glycine cleavage system H protein OS=Cyanothece sp. (strain ATCC 51142) GN=gcvH PE=3 SV=1 40 162 9.0E-23
sp|Q73ZR2|GCSH_MYCPA Glycine cleavage system H protein OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=gcvH PE=3 SV=1 40 154 1.0E-22
sp|A0QGN7|GCSH_MYCA1 Glycine cleavage system H protein OS=Mycobacterium avium (strain 104) GN=gcvH PE=3 SV=1 40 154 1.0E-22
sp|Q88P64|GCSH1_PSEPK Glycine cleavage system H protein 1 OS=Pseudomonas putida (strain KT2440) GN=gcvH1 PE=3 SV=1 40 164 1.0E-22
sp|Q9K0L7|GCSH_NEIMB Glycine cleavage system H protein OS=Neisseria meningitidis serogroup B (strain MC58) GN=gcvH PE=3 SV=1 40 154 1.0E-22
sp|Q3M9G2|GCSH_ANAVT Glycine cleavage system H protein OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gcvH PE=3 SV=1 40 154 1.0E-22
sp|A5CVS6|GCSH_VESOH Glycine cleavage system H protein OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=gcvH PE=3 SV=1 39 159 2.0E-22
sp|A1AXH9|GCSH_RUTMC Glycine cleavage system H protein OS=Ruthia magnifica subsp. Calyptogena magnifica GN=gcvH PE=3 SV=1 39 138 2.0E-22
sp|B1XNI3|GCSH_SYNP2 Glycine cleavage system H protein OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gcvH PE=3 SV=1 40 154 3.0E-22
sp|Q47D82|GCSH_DECAR Glycine cleavage system H protein OS=Dechloromonas aromatica (strain RCB) GN=gcvH PE=3 SV=1 40 149 3.0E-22
sp|Q7NSJ4|GCSH_CHRVO Glycine cleavage system H protein OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=gcvH PE=3 SV=1 40 154 3.0E-22
sp|Q46IC0|GCSH_PROMT Glycine cleavage system H protein OS=Prochlorococcus marinus (strain NATL2A) GN=gcvH PE=3 SV=1 40 159 4.0E-22
sp|B5ZQP7|GCSH_RHILW Glycine cleavage system H protein OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=gcvH PE=3 SV=1 40 154 4.0E-22
sp|P9WN55|GCSH_MYCTU Glycine cleavage system H protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gcvH PE=1 SV=1 40 154 5.0E-22
sp|P9WN54|GCSH_MYCTO Glycine cleavage system H protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gcvH PE=3 SV=1 40 154 5.0E-22
sp|A5U3J3|GCSH_MYCTA Glycine cleavage system H protein OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=gcvH PE=3 SV=1 40 154 5.0E-22
sp|Q8YNF8|GCSH_NOSS1 Glycine cleavage system H protein OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gcvH PE=3 SV=1 40 154 5.0E-22
sp|A5WG72|GCSH_PSYWF Glycine cleavage system H protein OS=Psychrobacter sp. (strain PRwf-1) GN=gcvH PE=3 SV=1 40 154 5.0E-22
sp|B1GYV6|GCSH_UNCTG Glycine cleavage system H protein OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=gcvH PE=3 SV=1 40 158 5.0E-22
sp|Q2K814|GCSH_RHIEC Glycine cleavage system H protein OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gcvH PE=3 SV=1 40 154 6.0E-22
sp|A2C5D5|GCSH_PROM1 Glycine cleavage system H protein OS=Prochlorococcus marinus (strain NATL1A) GN=gcvH PE=3 SV=1 40 159 7.0E-22
sp|B8DP97|GCSH_DESVM Glycine cleavage system H protein OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=gcvH PE=3 SV=1 41 158 7.0E-22
sp|Q9HPJ8|GCSH_HALSA Probable glycine cleavage system H protein OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gcvH PE=3 SV=1 40 158 7.0E-22
sp|B0R5Y7|GCSH_HALS3 Probable glycine cleavage system H protein OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=gcvH PE=3 SV=1 40 158 7.0E-22
sp|Q189S4|GCSH_PEPD6 Glycine cleavage system H protein OS=Peptoclostridium difficile (strain 630) GN=gcvH PE=3 SV=1 33 156 9.0E-22
sp|Q6L1E3|GCSH_PICTO Probable glycine cleavage system H protein OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=gcvH PE=3 SV=1 41 158 9.0E-22
sp|A1VE01|GCSH_DESVV Glycine cleavage system H protein OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=gcvH PE=3 SV=1 40 154 1.0E-21
sp|Q72C58|GCSH_DESVH Glycine cleavage system H protein OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=gcvH PE=3 SV=1 40 154 1.0E-21
sp|Q7TTS3|GCSH_SYNPX Glycine cleavage system H protein OS=Synechococcus sp. (strain WH8102) GN=gcvH PE=3 SV=1 40 159 1.0E-21
sp|Q0AVH7|GCSH_SYNWW Glycine cleavage system H protein OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=gcvH PE=3 SV=1 41 155 2.0E-21
sp|C1APA3|GCSH_MYCBT Glycine cleavage system H protein OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=gcvH PE=3 SV=1 40 154 3.0E-21
sp|A1KJN8|GCSH_MYCBP Glycine cleavage system H protein OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=gcvH PE=3 SV=1 40 154 3.0E-21
sp|Q7TZG8|GCSH_MYCBO Glycine cleavage system H protein OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=gcvH PE=3 SV=1 40 154 3.0E-21
sp|O32920|GCSH_MYCLE Glycine cleavage system H protein OS=Mycobacterium leprae (strain TN) GN=gcvH PE=3 SV=1 40 154 4.0E-21
sp|B8ZSP0|GCSH_MYCLB Glycine cleavage system H protein OS=Mycobacterium leprae (strain Br4923) GN=gcvH PE=3 SV=1 40 154 4.0E-21
sp|Q7NFJ4|GCSH_GLOVI Glycine cleavage system H protein OS=Gloeobacter violaceus (strain PCC 7421) GN=gcvH PE=3 SV=1 40 154 4.0E-21
sp|Q3AUL9|GCSH_SYNS9 Glycine cleavage system H protein OS=Synechococcus sp. (strain CC9902) GN=gcvH PE=3 SV=1 40 159 5.0E-21
sp|B7K3J2|GCSH_CYAP8 Glycine cleavage system H protein OS=Cyanothece sp. (strain PCC 8801) GN=gcvH PE=3 SV=1 40 154 5.0E-21
sp|Q10UY0|GCSH_TRIEI Glycine cleavage system H protein OS=Trichodesmium erythraeum (strain IMS101) GN=gcvH PE=3 SV=1 40 145 5.0E-21
sp|Q82WQ5|GCSH_NITEU Glycine cleavage system H protein OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gcvH PE=3 SV=1 40 160 8.0E-21
sp|C3PHK4|GCSH_CORA7 Glycine cleavage system H protein OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=gcvH PE=3 SV=1 41 156 8.0E-21
sp|A5GPH4|GCSH_SYNPW Glycine cleavage system H protein OS=Synechococcus sp. (strain WH7803) GN=gcvH PE=3 SV=1 38 149 1.0E-20
sp|Q2KYL9|GCSH_BORA1 Glycine cleavage system H protein OS=Bordetella avium (strain 197N) GN=gcvH PE=3 SV=1 39 159 1.0E-20
sp|B9JFK6|GCSH_AGRRK Glycine cleavage system H protein OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=gcvH PE=3 SV=1 40 158 1.0E-20
sp|Q47MD7|GCSH_THEFY Glycine cleavage system H protein OS=Thermobifida fusca (strain YX) GN=gcvH PE=3 SV=1 41 154 2.0E-20
sp|Q7MVT9|GCSH_PORGI Glycine cleavage system H protein OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=gcvH PE=3 SV=1 33 158 2.0E-20
sp|B2RJH4|GCSH_PORG3 Glycine cleavage system H protein OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=gcvH PE=3 SV=1 33 158 2.0E-20
sp|Q8DIB2|GCSH_THEEB Glycine cleavage system H protein OS=Thermosynechococcus elongatus (strain BP-1) GN=gcvH PE=3 SV=2 40 140 2.0E-20
sp|Q5YWV9|GCSH_NOCFA Glycine cleavage system H protein OS=Nocardia farcinica (strain IFM 10152) GN=gcvH PE=3 SV=1 40 160 2.0E-20
sp|B0JLR5|GCSH_MICAN Glycine cleavage system H protein OS=Microcystis aeruginosa (strain NIES-843) GN=gcvH PE=3 SV=1 40 142 3.0E-20
sp|B3PP19|GCSH_RHIE6 Glycine cleavage system H protein OS=Rhizobium etli (strain CIAT 652) GN=gcvH PE=3 SV=1 40 158 3.0E-20
sp|Q97C14|GCSH_THEVO Probable glycine cleavage system H protein OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=gcvH PE=3 SV=1 40 158 4.0E-20
sp|A3PFF7|GCSH_PROM0 Glycine cleavage system H protein OS=Prochlorococcus marinus (strain MIT 9301) GN=gcvH PE=3 SV=1 40 158 8.0E-20
sp|Q7W0E4|GCSH_BORPE Glycine cleavage system H protein OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=gcvH PE=3 SV=1 39 154 8.0E-20
sp|Q7TUJ2|GCSH_PROMM Glycine cleavage system H protein OS=Prochlorococcus marinus (strain MIT 9313) GN=gcvH PE=3 SV=1 40 154 8.0E-20
sp|A1T9T8|GCSH_MYCVP Glycine cleavage system H protein OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=gcvH PE=3 SV=1 41 160 1.0E-19
sp|Q7TU20|GCSH_PROMP Glycine cleavage system H protein OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=gcvH PE=3 SV=1 40 156 1.0E-19
sp|Q7V9K3|GCSH_PROMA Glycine cleavage system H protein OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gcvH PE=3 SV=1 40 154 1.0E-19
sp|B3EMS2|GCSH_CHLPB Glycine cleavage system H protein OS=Chlorobium phaeobacteroides (strain BS1) GN=gcvH PE=3 SV=1 40 154 1.0E-19
sp|A2CDR1|GCSH_PROM3 Glycine cleavage system H protein OS=Prochlorococcus marinus (strain MIT 9303) GN=gcvH PE=3 SV=1 40 154 2.0E-19
sp|A5CT42|GCSH_CLAM3 Glycine cleavage system H protein OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=gcvH PE=3 SV=1 40 158 2.0E-19
sp|Q887L4|GCSH1_PSESM Glycine cleavage system H protein 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gcvH1 PE=3 SV=1 40 164 2.0E-19
sp|A2BTQ0|GCSH_PROMS Glycine cleavage system H protein OS=Prochlorococcus marinus (strain AS9601) GN=gcvH PE=3 SV=1 40 158 3.0E-19
sp|Q54FI0|GCSH2_DICDI Glycine cleavage system H-like protein gcvH2 OS=Dictyostelium discoideum GN=gcvH2 PE=3 SV=1 20 158 3.0E-19
sp|Q73M83|GCSH_TREDE Glycine cleavage system H protein OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gcvH PE=3 SV=1 40 143 3.0E-19
sp|Q1B832|GCSH_MYCSS Glycine cleavage system H protein OS=Mycobacterium sp. (strain MCS) GN=gcvH PE=3 SV=1 41 149 6.0E-19
sp|A1UGX5|GCSH_MYCSK Glycine cleavage system H protein OS=Mycobacterium sp. (strain KMS) GN=gcvH PE=3 SV=1 41 149 6.0E-19
sp|A3Q0H8|GCSH_MYCSJ Glycine cleavage system H protein OS=Mycobacterium sp. (strain JLS) GN=gcvH PE=3 SV=1 41 149 6.0E-19
sp|Q317X3|GCSH_PROM9 Glycine cleavage system H protein OS=Prochlorococcus marinus (strain MIT 9312) GN=gcvH PE=3 SV=1 40 156 6.0E-19
sp|C5C5I0|GCSH_BEUC1 Glycine cleavage system H protein OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=gcvH PE=3 SV=1 39 144 7.0E-19
sp|A8G7H4|GCSH_PROM2 Glycine cleavage system H protein OS=Prochlorococcus marinus (strain MIT 9215) GN=gcvH PE=3 SV=1 40 158 8.0E-19
sp|B0RG24|GCSH_CLAMS Glycine cleavage system H protein OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=gcvH PE=3 SV=1 40 158 1.0E-18
sp|P64215|GCSH_TROWT Glycine cleavage system H protein OS=Tropheryma whipplei (strain Twist) GN=gcvH PE=3 SV=1 41 136 2.0E-18
sp|P64216|GCSH_TROW8 Glycine cleavage system H protein OS=Tropheryma whipplei (strain TW08/27) GN=gcvH PE=3 SV=1 41 136 2.0E-18
sp|Q5N0D3|GCSH_SYNP6 Glycine cleavage system H protein OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gcvH PE=3 SV=1 40 140 3.0E-18
sp|Q31LJ3|GCSH_SYNE7 Glycine cleavage system H protein OS=Synechococcus elongatus (strain PCC 7942) GN=gcvH PE=3 SV=1 40 140 3.0E-18
sp|A0QYG3|GCSH_MYCS2 Glycine cleavage system H protein OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=gcvH PE=1 SV=1 41 139 4.0E-18
sp|Q11Z42|GCSH_CYTH3 Glycine cleavage system H protein OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gcvH PE=3 SV=1 40 143 6.0E-18
sp|A2BZ55|GCSH_PROM5 Glycine cleavage system H protein OS=Prochlorococcus marinus (strain MIT 9515) GN=gcvH PE=3 SV=1 40 158 9.0E-18
sp|Q0I6E5|GCSH_SYNS3 Glycine cleavage system H protein OS=Synechococcus sp. (strain CC9311) GN=gcvH PE=3 SV=1 40 158 4.0E-17
sp|Q9HIH3|GCSH_THEAC Probable glycine cleavage system H protein OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=gcvH PE=3 SV=1 41 144 6.0E-17
sp|A4TA86|GCSH_MYCGI Glycine cleavage system H protein OS=Mycobacterium gilvum (strain PYR-GCK) GN=gcvH PE=3 SV=1 41 160 1.0E-16
sp|B1MB62|GCSH_MYCA9 Glycine cleavage system H protein OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=gcvH PE=3 SV=1 40 138 1.0E-16
sp|B1XSD8|GCSH_POLNS Glycine cleavage system H protein OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=gcvH PE=3 SV=1 38 137 3.0E-16
sp|Q9PKB2|GCSH_CHLMU Glycine cleavage system H protein OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gcvH PE=3 SV=1 39 148 3.0E-16
sp|Q8G4Z7|GCSH_BIFLO Glycine cleavage system H protein OS=Bifidobacterium longum (strain NCC 2705) GN=gcvH PE=3 SV=1 40 154 6.0E-16
sp|Q54JU3|GCSH3_DICDI Putative glycine cleavage system H protein 3 OS=Dictyostelium discoideum GN=gcvH3 PE=3 SV=1 15 158 6.0E-16
sp|Q1H4U1|GCSH_METFK Glycine cleavage system H protein OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gcvH PE=3 SV=1 40 138 5.0E-15
sp|Q9Z8B0|GCSH_CHLPN Glycine cleavage system H protein OS=Chlamydia pneumoniae GN=gcvH PE=3 SV=1 59 143 2.0E-14
sp|Q7UNG9|GCSH_RHOBA Glycine cleavage system H protein OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=gcvH PE=3 SV=1 38 140 1.0E-13
sp|O84284|GCSH_CHLTR Glycine cleavage system H protein OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gcvH PE=3 SV=1 39 141 2.0E-13
sp|Q3KM80|GCSH_CHLTA Glycine cleavage system H protein OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gcvH PE=3 SV=1 39 141 2.0E-13
sp|B1L6U5|GCSH_KORCO Probable glycine cleavage system H protein OS=Korarchaeum cryptofilum (strain OPF8) GN=gcvH PE=3 SV=1 39 160 6.0E-13
sp|B0BBR3|GCSH_CHLTB Glycine cleavage system H protein OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gcvH PE=3 SV=1 39 141 7.0E-13
sp|B0B7J8|GCSH_CHLT2 Glycine cleavage system H protein OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gcvH PE=3 SV=1 39 141 7.0E-13
sp|Q97Z69|GCSH2_SULSO Probable glycine cleavage system H protein 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gcvH2 PE=3 SV=1 61 153 2.0E-11
sp|Q54JU0|GCSH5_DICDI Glycine cleavage system H-like protein gcvH5, mitochondrial OS=Dictyostelium discoideum GN=gcvH5 PE=3 SV=1 57 160 3.0E-10
sp|Q96ZD6|GCSH2_SULTO Probable glycine cleavage system H protein 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gcvH2 PE=3 SV=1 61 153 4.0E-10
sp|O67573|GCSH2_AQUAE Glycine cleavage system H protein 2 OS=Aquifex aeolicus (strain VF5) GN=gcvH2 PE=3 SV=1 52 149 3.0E-09
sp|O66720|GCSH5_AQUAE Glycine cleavage system H protein 5 OS=Aquifex aeolicus (strain VF5) GN=gcvH5 PE=3 SV=1 52 150 4.0E-09
sp|Q4JBR3|GCSH2_SULAC Probable glycine cleavage system H protein 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gcvH2 PE=3 SV=1 56 150 1.0E-08
sp|O67080|GCSH3_AQUAE Glycine cleavage system H protein 3 OS=Aquifex aeolicus (strain VF5) GN=gcvH3 PE=3 SV=1 52 154 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|007140
MQSLLRTATRSRPALSGLWRTNLGRATYPNLGIRTLITKRYSKDHETISYDDQTGIGTLTITDHAQSTLGDVVFV
ELPAEGKEVEQGETVGAVESVKAASDIYSPVSGVVVEVNRALADQPGKLNKSAEQDGWLCKIKLSDPSEVEKLLT
KEAYDSYINNSESA*
Coding >AgabiH97|007140
ATGCAATCCCTCTTGCGAACTGCTACTCGTTCTAGGCCTGCCTTGTCGGGCCTTTGGAGGACAAACCTTGGTCGC
GCGACCTACCCGAATCTCGGAATACGCACTTTAATAACGAAACGCTATTCAAAGGATCATGAAACAATATCGTAC
GACGATCAGACAGGAATTGGTACTCTCACTATTACCGACCATGCCCAGTCCACACTTGGGGATGTTGTCTTCGTC
GAACTTCCAGCTGAGGGTAAGGAAGTCGAACAAGGAGAGACGGTTGGTGCCGTAGAGAGTGTCAAAGCTGCATCG
GATATTTACTCGCCCGTTTCTGGAGTTGTTGTCGAAGTGAACCGCGCCCTTGCAGACCAGCCAGGAAAGCTTAAC
AAGTCTGCGGAACAGGATGGATGGCTCTGCAAGATCAAACTGTCGGATCCTTCGGAAGTAGAGAAATTGCTCACG
AAGGAAGCTTATGACTCCTATATTAATAACAGTGAGAGCGCGTAA
Transcript >AgabiH97|007140
ATGCAATCCCTCTTGCGAACTGCTACTCGTTCTAGGCCTGCCTTGTCGGGCCTTTGGAGGACAAACCTTGGTCGC
GCGACCTACCCGAATCTCGGAATACGCACTTTAATAACGAAACGCTATTCAAAGGATCATGAAACAATATCGTAC
GACGATCAGACAGGAATTGGTACTCTCACTATTACCGACCATGCCCAGTCCACACTTGGGGATGTTGTCTTCGTC
GAACTTCCAGCTGAGGGTAAGGAAGTCGAACAAGGAGAGACGGTTGGTGCCGTAGAGAGTGTCAAAGCTGCATCG
GATATTTACTCGCCCGTTTCTGGAGTTGTTGTCGAAGTGAACCGCGCCCTTGCAGACCAGCCAGGAAAGCTTAAC
AAGTCTGCGGAACAGGATGGATGGCTCTGCAAGATCAAACTGTCGGATCCTTCGGAAGTAGAGAAATTGCTCACG
AAGGAAGCTTATGACTCCTATATTAATAACAGTGAGAGCGCGTAA
Gene >AgabiH97|007140
ATGCAATCCCTCTTGCGAACTGCTACTCGTTCTAGGCCTGCCTTGTCGGGCCTTTGGAGGACAAACCTTGGTCGC
GCGACCTACCCGAATCTCGGAATACGCACTTTAATAAGTGAGTAATCTACCCGCTACTCCGCGAAGGACCCAGAC
TAAGAAATGACCAGCGAAACGCTATTCAAAGGATCATGAAACAATATCGTACGACGATCAGACAGGAATTGGTAC
TCTCACTATTACCGACCATGCCCAGTCCACACTTGGGGATGTTGTCTTCGTCGAACTTCCAGCTGAGGGTAAGGA
AGTCGAACAAGGAGGTATGTTACTTTGAAAGAGTAAAAGTTGTTCTGCGCCTAAATGTTCGACAGAGACGGTTGG
TGCCGTAGAGAGTGTCAAAGCTGCATCGGATATTGTGAGTCGCGTCCTGATCCGACGACCTTTTTCTAGCTGACG
GAGTATACTCAGTACTCGCCCGTTTCTGGAGTTGTTGTCGAAGTGAACCGCGCCCTTGCAGACCAGCCAGGAAAG
CTTAACAAGTCTGCGGAACAGGATGGTAACATTGTCCTACTATTCGGTTGAAGAGAAACCTAATGTTCAATTCTA
GGATGGCTCTGCAAGATCAAACTGTCGGATCCTTCGGAAGTAGAGAAATTGCTCACGAAGGAAGCTTATGACTCC
TATATTAATAACAGTGAGAGCGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail