Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|007060
Gene name
Locationscaffold_1:1693408..1694464
Strand+
Gene length (bp)1056
Transcript length (bp)903
Coding sequence length (bp)903
Protein length (aa) 301

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 2.2E-08 67 209
PF13649 Methyltransf_25 Methyltransferase domain 5.3E-07 86 201
PF08242 Methyltransf_12 Methyltransferase domain 7.0E-07 87 203
PF08241 Methyltransf_11 Methyltransferase domain 1.8E-06 87 205
PF13847 Methyltransf_31 Methyltransferase domain 1.9E-06 83 217

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|A4F7P5|ERYG_SACEN Erythromycin 3''-O-methyltransferase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=eryG PE=1 SV=1 42 258 1.0E-16
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 50 210 2.0E-06

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 35.68 19.34 52.03
Initials Initials knots 33.09 17.88 48.30
Pileal_Stipeal_center Stage I stipe center 40.99 22.72 59.27
Pileal_Stipeal_shell Stage I stipe shell 25.41 13.03 37.78
DIF_stipe_center Stage II stipe center 36.54 20.02 53.07
DIF_stipe_shell Stage II stipe shell 40.07 22.18 57.96
DIF_stipe_skin Stage II stipe skin 41.36 22.98 59.74
DIF_cap_skin Stage II cap skin 19.52 9.76 29.27
DIF_cap_tissue Stage II cap tissue 23.93 12.35 35.50
DIF_gill_tissue Stage II gill tissue 26.86 14.13 39.60
YFB_stipe_center Young fruiting body stipe center 43.77 24.48 63.06
YFB_stipe_shell Young fruiting body stipe shell 39.21 21.67 56.76
YFB_stipe_skin Young fruiting body stipe skin 48.83 27.50 70.16
YFB_cap_skin Young fruiting body cap skin 23.45 12.12 34.78
YFB_cap_tissue Young fruiting body cap tissue 25.52 13.33 37.70
YFB_gill_tissue Young fruiting body gill tissue 32.46 17.49 47.43
YFB_veil Young fruiting body veil 27.28 14.29 40.26

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.479522 no
Casing YFB_stipe_center 0.629667 no
Casing YFB_stipe_shell 0.865876 no
Casing YFB_stipe_skin 0.390414 no
Casing YFB_cap_skin 0.244478 no
Casing YFB_cap_tissue 0.369030 no
Casing YFB_gill_tissue 0.865376 no
Casing YFB_veil 0.510357 no
Casing Initials 0.896523 no
Casing Pileal_Stipeal_center 0.781518 no
Casing Pileal_Stipeal_shell 0.378072 no
Casing DIF_stipe_center 0.970487 no
Casing DIF_stipe_shell 0.826576 no
Casing DIF_stipe_skin 0.763076 no
Casing DIF_cap_skin 0.067706 no
Casing DIF_cap_tissue 0.271456 no
DIF_gill_tissue YFB_stipe_center 0.127636 no
DIF_gill_tissue YFB_stipe_shell 0.281350 no
DIF_gill_tissue YFB_stipe_skin 0.049674 yes
DIF_gill_tissue YFB_cap_skin 0.798669 no
DIF_gill_tissue YFB_cap_tissue 0.932959 no
DIF_gill_tissue YFB_gill_tissue 0.685112 no
DIF_gill_tissue YFB_veil 0.980431 no
YFB_stipe_center YFB_stipe_shell 0.829235 no
YFB_stipe_center YFB_stipe_skin 0.828279 no
YFB_stipe_center YFB_cap_skin 0.042909 yes
YFB_stipe_center YFB_cap_tissue 0.080353 no
YFB_stipe_center YFB_gill_tissue 0.420996 no
YFB_stipe_center YFB_veil 0.141946 no
YFB_stipe_shell YFB_stipe_skin 0.593498 no
YFB_stipe_shell YFB_cap_skin 0.121568 no
YFB_stipe_shell YFB_cap_tissue 0.205535 no
YFB_stipe_shell YFB_gill_tissue 0.678467 no
YFB_stipe_shell YFB_veil 0.314964 no
YFB_stipe_skin YFB_cap_skin 0.016949 yes
YFB_stipe_skin YFB_cap_tissue 0.032504 yes
YFB_stipe_skin YFB_gill_tissue 0.224247 no
YFB_stipe_skin YFB_veil 0.059513 no
YFB_cap_skin YFB_cap_tissue 0.887415 no
YFB_cap_skin YFB_gill_tissue 0.409695 no
YFB_cap_skin YFB_veil 0.768731 no
YFB_cap_tissue YFB_gill_tissue 0.577094 no
YFB_cap_tissue YFB_veil 0.913141 no
YFB_gill_tissue YFB_veil 0.713641 no
Initials DIF_gill_tissue 0.643971 no
Initials YFB_stipe_center 0.457545 no
Initials YFB_stipe_shell 0.718608 no
Initials YFB_stipe_skin 0.249089 no
Initials YFB_cap_skin 0.373006 no
Initials YFB_cap_tissue 0.528044 no
Initials YFB_gill_tissue 0.976291 no
Initials YFB_veil 0.675621 no
Initials Pileal_Stipeal_center 0.619650 no
Initials Pileal_Stipeal_shell 0.530481 no
Initials DIF_stipe_center 0.855184 no
Initials DIF_stipe_shell 0.668161 no
Initials DIF_stipe_skin 0.598920 no
Initials DIF_cap_skin 0.118854 no
Initials DIF_cap_tissue 0.408273 no
Pileal_Stipeal_center DIF_gill_tissue 0.213061 no
Pileal_Stipeal_center YFB_stipe_center 0.907673 no
Pileal_Stipeal_center YFB_stipe_shell 0.943185 no
Pileal_Stipeal_center YFB_stipe_skin 0.697022 no
Pileal_Stipeal_center YFB_cap_skin 0.085045 no
Pileal_Stipeal_center YFB_cap_tissue 0.147674 no
Pileal_Stipeal_center YFB_gill_tissue 0.574299 no
Pileal_Stipeal_center YFB_veil 0.237553 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.156514 no
Pileal_Stipeal_center DIF_stipe_center 0.823610 no
Pileal_Stipeal_center DIF_stipe_shell 0.970651 no
Pileal_Stipeal_center DIF_stipe_skin 0.988239 no
Pileal_Stipeal_center DIF_cap_skin 0.018344 yes
Pileal_Stipeal_center DIF_cap_tissue 0.097447 no
Pileal_Stipeal_shell DIF_gill_tissue 0.931256 no
Pileal_Stipeal_shell YFB_stipe_center 0.092165 no
Pileal_Stipeal_shell YFB_stipe_shell 0.218427 no
Pileal_Stipeal_shell YFB_stipe_skin 0.037140 yes
Pileal_Stipeal_shell YFB_cap_skin 0.898901 no
Pileal_Stipeal_shell YFB_cap_tissue 0.994090 no
Pileal_Stipeal_shell YFB_gill_tissue 0.579377 no
Pileal_Stipeal_shell YFB_veil 0.909071 no
Pileal_Stipeal_shell DIF_stipe_center 0.328264 no
Pileal_Stipeal_shell DIF_stipe_shell 0.194366 no
Pileal_Stipeal_shell DIF_stipe_skin 0.152734 no
Pileal_Stipeal_shell DIF_cap_skin 0.564856 no
Pileal_Stipeal_shell DIF_cap_tissue 0.925627 no
DIF_stipe_center DIF_gill_tissue 0.417847 no
DIF_stipe_center YFB_stipe_center 0.677559 no
DIF_stipe_center YFB_stipe_shell 0.903255 no
DIF_stipe_center YFB_stipe_skin 0.435715 no
DIF_stipe_center YFB_cap_skin 0.203400 no
DIF_stipe_center YFB_cap_tissue 0.316139 no
DIF_stipe_center YFB_gill_tissue 0.819731 no
DIF_stipe_center YFB_veil 0.454137 no
DIF_stipe_center DIF_stipe_shell 0.864441 no
DIF_stipe_center DIF_stipe_skin 0.805046 no
DIF_stipe_center DIF_cap_skin 0.051723 no
DIF_stipe_center DIF_cap_tissue 0.226043 no
DIF_stipe_shell DIF_gill_tissue 0.246599 no
DIF_stipe_shell YFB_stipe_center 0.868868 no
DIF_stipe_shell YFB_stipe_shell 0.972276 no
DIF_stipe_shell YFB_stipe_skin 0.644700 no
DIF_stipe_shell YFB_cap_skin 0.098609 no
DIF_stipe_shell YFB_cap_tissue 0.172566 no
DIF_stipe_shell YFB_gill_tissue 0.631610 no
DIF_stipe_shell YFB_veil 0.274857 no
DIF_stipe_shell DIF_stipe_skin 0.958124 no
DIF_stipe_shell DIF_cap_skin 0.021846 yes
DIF_stipe_shell DIF_cap_tissue 0.114735 no
DIF_stipe_skin DIF_gill_tissue 0.199497 no
DIF_stipe_skin YFB_stipe_center 0.921606 no
DIF_stipe_skin YFB_stipe_shell 0.929822 no
DIF_stipe_skin YFB_stipe_skin 0.716053 no
DIF_stipe_skin YFB_cap_skin 0.078590 no
DIF_stipe_skin YFB_cap_tissue 0.135891 no
DIF_stipe_skin YFB_gill_tissue 0.558105 no
DIF_stipe_skin YFB_veil 0.223034 no
DIF_stipe_skin DIF_cap_skin 0.015529 yes
DIF_stipe_skin DIF_cap_tissue 0.089805 no
DIF_cap_skin DIF_gill_tissue 0.434116 no
DIF_cap_skin YFB_stipe_center 0.011968 yes
DIF_cap_skin YFB_stipe_shell 0.028437 yes
DIF_cap_skin YFB_stipe_skin 0.001625 yes
DIF_cap_skin YFB_cap_skin 0.720375 no
DIF_cap_skin YFB_cap_tissue 0.539308 no
DIF_cap_skin YFB_gill_tissue 0.147141 no
DIF_cap_skin YFB_veil 0.406444 no
DIF_cap_skin DIF_cap_tissue 0.680223 no
DIF_cap_tissue DIF_gill_tissue 0.838975 no
DIF_cap_tissue YFB_stipe_center 0.051520 no
DIF_cap_tissue YFB_stipe_shell 0.135891 no
DIF_cap_tissue YFB_stipe_skin 0.017507 yes
DIF_cap_tissue YFB_cap_skin 0.975812 no
DIF_cap_tissue YFB_cap_tissue 0.916818 no
DIF_cap_tissue YFB_gill_tissue 0.450517 no
DIF_cap_tissue YFB_veil 0.810925 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|007060
MFDTLSLFLFLSITLCSLFFLRSSVGVPYGLYHLTLNKELGDSDSSPKTEWMNQGYWKATTSFPEACRALALKLL
KAAKYKVGDSVLDVGHGTGESLIMFLTDRDIPRPSKLVGITNAPSQYQRSKERVSRVRSSNDEAAKVSVDLYCGD
AICRDTAPPTHPLHVQNTARFDVVFALDCAYHFATRKEFLAQAYQKLAPGGRIVLGDICFAKEFPSRVIAFIATK
IMPKENIVSPQEYIQLLEKLGYTEVELEDITSDSFVGLCKFLSTRGALWYIYSCFLSWFQDAGGARFVVVTARKP
*
Coding >AgabiH97|007060
ATGTTTGATACTCTCAGTCTTTTCCTCTTCCTTTCCATTACTCTCTGTTCCCTCTTCTTCCTTCGTTCTTCAGTG
GGAGTTCCATATGGATTATATCATTTGACCTTGAACAAGGAGCTAGGAGACTCAGACTCTTCGCCAAAGACAGAA
TGGATGAACCAGGGTTATTGGAAGGCGACAACGTCATTTCCGGAGGCTTGTCGCGCTCTTGCCCTCAAGCTCTTG
AAGGCTGCAAAATACAAAGTGGGAGACAGTGTTCTTGATGTTGGACATGGCACCGGGGAGTCTCTTATCATGTTC
CTGACGGACCGTGACATTCCTCGTCCTTCCAAGCTGGTCGGTATCACGAATGCTCCTTCCCAATACCAACGTTCA
AAAGAACGTGTATCTCGTGTTCGTTCTTCCAACGACGAAGCAGCCAAGGTTTCAGTTGATTTGTACTGCGGTGAT
GCCATTTGTCGCGACACTGCCCCACCGACACACCCTCTCCACGTTCAGAACACAGCAAGATTCGACGTTGTCTTT
GCTTTGGATTGTGCTTACCATTTTGCCACACGTAAAGAATTCCTGGCTCAAGCGTATCAAAAATTAGCGCCAGGA
GGTCGAATAGTCCTCGGGGACATTTGCTTCGCAAAGGAGTTCCCATCTAGGGTCATAGCTTTCATTGCCACTAAA
ATCATGCCAAAGGAAAACATAGTTTCCCCGCAGGAGTATATCCAACTTTTGGAAAAGCTTGGATATACGGAGGTT
GAGTTGGAAGATATTACTTCTGATTCGTTCGTCGGTCTCTGCAAGTTTTTGTCTACTCGGGGGGCACTGTGGTAC
ATCTATTCGTGTTTTCTGAGTTGGTTTCAGGATGCTGGTGGAGCACGTTTCGTTGTTGTCACCGCACGAAAGCCA
TGA
Transcript >AgabiH97|007060
ATGTTTGATACTCTCAGTCTTTTCCTCTTCCTTTCCATTACTCTCTGTTCCCTCTTCTTCCTTCGTTCTTCAGTG
GGAGTTCCATATGGATTATATCATTTGACCTTGAACAAGGAGCTAGGAGACTCAGACTCTTCGCCAAAGACAGAA
TGGATGAACCAGGGTTATTGGAAGGCGACAACGTCATTTCCGGAGGCTTGTCGCGCTCTTGCCCTCAAGCTCTTG
AAGGCTGCAAAATACAAAGTGGGAGACAGTGTTCTTGATGTTGGACATGGCACCGGGGAGTCTCTTATCATGTTC
CTGACGGACCGTGACATTCCTCGTCCTTCCAAGCTGGTCGGTATCACGAATGCTCCTTCCCAATACCAACGTTCA
AAAGAACGTGTATCTCGTGTTCGTTCTTCCAACGACGAAGCAGCCAAGGTTTCAGTTGATTTGTACTGCGGTGAT
GCCATTTGTCGCGACACTGCCCCACCGACACACCCTCTCCACGTTCAGAACACAGCAAGATTCGACGTTGTCTTT
GCTTTGGATTGTGCTTACCATTTTGCCACACGTAAAGAATTCCTGGCTCAAGCGTATCAAAAATTAGCGCCAGGA
GGTCGAATAGTCCTCGGGGACATTTGCTTCGCAAAGGAGTTCCCATCTAGGGTCATAGCTTTCATTGCCACTAAA
ATCATGCCAAAGGAAAACATAGTTTCCCCGCAGGAGTATATCCAACTTTTGGAAAAGCTTGGATATACGGAGGTT
GAGTTGGAAGATATTACTTCTGATTCGTTCGTCGGTCTCTGCAAGTTTTTGTCTACTCGGGGGGCACTGTGGTAC
ATCTATTCGTGTTTTCTGAGTTGGTTTCAGGATGCTGGTGGAGCACGTTTCGTTGTTGTCACCGCACGAAAGCCA
TGA
Gene >AgabiH97|007060
ATGTTTGATACTCTCAGTCTTTTCCTCTTCCTTTCCATTACTCTCTGTTCCCTCTTCTTCCTTCGTTCTTCAGTG
GGAGTTCCATATGGATTATATCATTTGACCTTGAACAAGGAGCTAGGAGACTCAGACTCTTCGCCAAAGACAGAA
TGGATGAACCAGGGTTATTGGAAGGTCCGATTCATTCTAGTCGACAACTTCACATATGATTCTGAAAGTTCTTAG
GCGACAACGTCATTTCCGGAGGCTTGTCGCGGTATTGGACCTTCCGCCGGATCATATTCTCGTTAATGATACTCC
GCTATAGCTCTTGCCCTCAAGCTCTTGAAGGCTGCAAAATACAAAGTGGGAGACAGTGTTCTTGGTATGTGTTTC
TCTTCCTACCGATGAAGCACCATCATCGATCGTTACTTAGATGTTGGACATGGCACCGGGGAGTCTCTTATCATG
TTCCTGACGGACCGTGACATTCCTCGTCCTTCCAAGCTGGTCGGTATCACGAATGCTCCTTCCCAATACCAACGT
TCAAAAGAACGTGTATCTCGTGTTCGTTCTTCCAACGACGAAGCAGCCAAGGTTTCAGTTGATTTGTACTGCGGT
GATGCCATTTGTCGCGACACTGCCCCACCGACACACCCTCTCCACGTTCAGAACACAGCAAGATTCGACGTTGTC
TTTGCTTTGGATTGTGCTTACCATTTTGCCACACGTAAAGAATTCCTGGCTCAAGCGTATCAAAAATTAGCGCCA
GGAGGTCGAATAGTCCTCGGGGACATTTGCTTCGCAAAGGAGTTCCCATCTAGGGTCATAGCTTTCATTGCCACT
AAAATCATGCCAAAGGAAAACATAGTTTCCCCGCAGGAGTATATCCAACTTTTGGAAAAGCTTGGATATACGGAG
GTTGAGTTGGAAGATATTACTTCTGATTCGTTCGTCGGTCTCTGCAAGTTTTTGTCTACTCGGGGGGCACTGTGG
TACATCTATTCGTGTTTTCTGAGTTGGTTTCAGGATGCTGGTGGAGCACGTTTCGTTGTTGTCACCGCACGAAAG
CCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail