Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006950
Gene name
Locationscaffold_1:1675503..1677722
Strand+
Gene length (bp)2219
Transcript length (bp)1416
Coding sequence length (bp)1416
Protein length (aa) 472

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 2.6E-37 67 243
PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain 9.7E-34 342 450
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 4.7E-14 269 334

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42820|EF1A_SCHCO Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1 56 471 0.0E+00
sp|Q9HDF6|EF1A_PIRIN Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1 56 461 0.0E+00
sp|P28295|EF1A_ABSGL Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1 56 470 0.0E+00
sp|Q01765|EF1A_PODCU Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 56 471 0.0E+00
sp|Q01520|EF1A_PODAS Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 56 470 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42820|EF1A_SCHCO Elongation factor 1-alpha OS=Schizophyllum commune GN=TEF1 PE=3 SV=1 56 471 0.0E+00
sp|Q9HDF6|EF1A_PIRIN Elongation factor 1-alpha OS=Piriformospora indica GN=TEF1 PE=2 SV=1 56 461 0.0E+00
sp|P28295|EF1A_ABSGL Elongation factor 1-alpha OS=Absidia glauca GN=TEF-1 PE=3 SV=1 56 470 0.0E+00
sp|Q01765|EF1A_PODCU Elongation factor 1-alpha OS=Podospora curvicolla GN=TEF PE=3 SV=1 56 471 0.0E+00
sp|Q01520|EF1A_PODAS Elongation factor 1-alpha OS=Podospora anserina GN=TEF PE=3 SV=1 56 470 0.0E+00
sp|P32186|EF1A_PUCGR Elongation factor 1-alpha OS=Puccinia graminis GN=TEF PE=3 SV=2 56 466 0.0E+00
sp|P0CN30|EF1A_CRYNJ Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEF1 PE=3 SV=1 56 461 0.0E+00
sp|P0CN31|EF1A_CRYNB Elongation factor 1-alpha OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEF1 PE=2 SV=1 56 461 0.0E+00
sp|P40911|EF1A_AJECG Elongation factor 1-alpha OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=TEF PE=2 SV=1 56 470 0.0E+00
sp|Q9Y713|EF1A_ASPOR Elongation factor 1-alpha OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tef1 PE=3 SV=1 56 470 0.0E+00
sp|P06805|EF1A1_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-1 PE=3 SV=1 56 454 0.0E+00
sp|P14864|EF1A2_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-2 PE=3 SV=1 56 454 0.0E+00
sp|O59949|EF1A_YARLI Elongation factor 1-alpha OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEF PE=2 SV=2 56 461 0.0E+00
sp|Q09069|EF1A_SORMA Elongation factor 1-alpha OS=Sordaria macrospora GN=TEF PE=3 SV=1 56 461 0.0E+00
sp|P41752|EF1A_ASHGO Elongation factor 1-alpha OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEF PE=3 SV=1 56 470 0.0E+00
sp|P14865|EF1A3_MUCCL Elongation factor 1-alpha OS=Mucor circinelloides f. lusitanicus GN=TEF-3 PE=3 SV=1 56 454 0.0E+00
sp|Q01372|EF1A_NEUCR Elongation factor 1-alpha OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tef-1 PE=3 SV=2 56 461 0.0E+00
sp|Q00251|EF1A_AURPU Elongation factor 1-alpha OS=Aureobasidium pullulans GN=TEF1 PE=3 SV=1 56 470 0.0E+00
sp|Q96WZ1|EF1A_COCIM Elongation factor 1-alpha OS=Coccidioides immitis (strain RS) GN=TEF PE=2 SV=2 56 461 0.0E+00
sp|A5DPE3|EF1A_PICGU Elongation factor 1-alpha OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TEF1 PE=3 SV=2 56 461 0.0E+00
sp|Q59QD6|EF1A2_CANAL Elongation factor 1-alpha 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF2 PE=3 SV=1 56 461 0.0E+00
sp|P0CY35|EF1A1_CANAL Elongation factor 1-alpha 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEF1 PE=3 SV=1 56 461 0.0E+00
sp|P02994|EF1A_YEAST Elongation factor 1-alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEF1 PE=1 SV=1 56 454 0.0E+00
sp|P41745|EF1A_BLAAD Elongation factor 1-alpha OS=Blastobotrys adeninivorans GN=TEF PE=3 SV=1 56 461 0.0E+00
sp|Q92005|EF1A_DANRE Elongation factor 1-alpha OS=Danio rerio GN=eef1a PE=2 SV=1 56 471 0.0E+00
sp|P34825|EF1A_HYPJE Elongation factor 1-alpha OS=Hypocrea jecorina GN=tef1 PE=3 SV=1 56 453 0.0E+00
sp|P0CT55|EF1A3_SCHPO Elongation factor 1-alpha-B/C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef103 PE=1 SV=1 56 461 0.0E+00
sp|P0CT54|EF1A2_SCHPO Elongation factor 1-alpha-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef102 PE=1 SV=1 56 461 0.0E+00
sp|P0CT53|EF1A1_SCHPO Elongation factor 1-alpha-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tef101 PE=1 SV=1 56 461 0.0E+00
sp|P13549|EF1A0_XENLA Elongation factor 1-alpha, somatic form OS=Xenopus laevis GN=eef1as PE=2 SV=1 56 471 0.0E+00
sp|P62630|EF1A1_RAT Elongation factor 1-alpha 1 OS=Rattus norvegicus GN=Eef1a1 PE=2 SV=1 56 471 0.0E+00
sp|P10126|EF1A1_MOUSE Elongation factor 1-alpha 1 OS=Mus musculus GN=Eef1a1 PE=1 SV=3 56 471 0.0E+00
sp|P62629|EF1A1_CRIGR Elongation factor 1-alpha 1 OS=Cricetulus griseus GN=EEF1A1 PE=2 SV=1 56 471 0.0E+00
sp|P68105|EF1A1_RABIT Elongation factor 1-alpha 1 OS=Oryctolagus cuniculus GN=EEF1A1 PE=1 SV=1 56 471 0.0E+00
sp|Q5R4R8|EF1A1_PONAB Elongation factor 1-alpha 1 OS=Pongo abelii GN=EEF1A1 PE=2 SV=2 56 471 0.0E+00
sp|Q5R1X2|EF1A1_PANTR Elongation factor 1-alpha 1 OS=Pan troglodytes GN=EEF1A1 PE=2 SV=1 56 471 0.0E+00
sp|P68104|EF1A1_HUMAN Elongation factor 1-alpha 1 OS=Homo sapiens GN=EEF1A1 PE=1 SV=1 56 471 0.0E+00
sp|Q66RN5|EF1A1_FELCA Elongation factor 1-alpha 1 OS=Felis catus GN=EEF1A1 PE=2 SV=1 56 471 0.0E+00
sp|P68103|EF1A1_BOVIN Elongation factor 1-alpha 1 OS=Bos taurus GN=EEF1A1 PE=1 SV=1 56 471 0.0E+00
sp|Q90835|EF1A_CHICK Elongation factor 1-alpha 1 OS=Gallus gallus GN=EEF1A PE=2 SV=1 56 471 0.0E+00
sp|P17507|EF1A2_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis GN=eef1ao PE=1 SV=1 56 470 0.0E+00
sp|A2Q0Z0|EF1A1_HORSE Elongation factor 1-alpha 1 OS=Equus caballus GN=EEF1A1 PE=2 SV=1 56 471 0.0E+00
sp|P17508|EF1A3_XENLA Elongation factor 1-alpha, oocyte form OS=Xenopus laevis PE=1 SV=2 56 470 0.0E+00
sp|Q5VTE0|EF1A3_HUMAN Putative elongation factor 1-alpha-like 3 OS=Homo sapiens GN=EEF1A1P5 PE=5 SV=1 56 471 0.0E+00
sp|Q71V39|EF1A2_RABIT Elongation factor 1-alpha 2 OS=Oryctolagus cuniculus GN=EEF1A2 PE=1 SV=1 56 469 0.0E+00
sp|Q05639|EF1A2_HUMAN Elongation factor 1-alpha 2 OS=Homo sapiens GN=EEF1A2 PE=1 SV=1 56 469 0.0E+00
sp|Q32PH8|EF1A2_BOVIN Elongation factor 1-alpha 2 OS=Bos taurus GN=EEF1A2 PE=2 SV=1 56 469 0.0E+00
sp|P62632|EF1A2_RAT Elongation factor 1-alpha 2 OS=Rattus norvegicus GN=Eef1a2 PE=1 SV=1 56 469 0.0E+00
sp|P62631|EF1A2_MOUSE Elongation factor 1-alpha 2 OS=Mus musculus GN=Eef1a2 PE=1 SV=1 56 469 0.0E+00
sp|Q2HJN8|EF1A2_OSCTI Elongation factor 1-alpha 2 OS=Oscheius tipulae GN=eft-2 PE=3 SV=1 56 466 0.0E+00
sp|P53013|EF1A_CAEEL Elongation factor 1-alpha OS=Caenorhabditis elegans GN=eft-3 PE=3 SV=1 56 471 0.0E+00
sp|Q2HJN4|EF1A1_OSCTI Elongation factor 1-alpha 1 OS=Oscheius tipulae GN=eft-1 PE=3 SV=1 56 466 0.0E+00
sp|Q2HJN9|EF1A4_OSCTI Elongation factor 1-alpha 4 OS=Oscheius tipulae GN=eft-4 PE=3 SV=1 56 466 0.0E+00
sp|P08736|EF1A1_DROME Elongation factor 1-alpha 1 OS=Drosophila melanogaster GN=Ef1alpha48D PE=1 SV=2 56 471 0.0E+00
sp|Q2HJN6|EF1A3_OSCTI Elongation factor 1-alpha 3 OS=Oscheius tipulae GN=eft-3 PE=3 SV=1 56 466 0.0E+00
sp|P29520|EF1A_BOMMO Elongation factor 1-alpha OS=Bombyx mori PE=2 SV=1 56 471 0.0E+00
sp|P27592|EF1A_ONCVO Elongation factor 1-alpha OS=Onchocerca volvulus PE=2 SV=1 56 468 0.0E+00
sp|P02993|EF1A_ARTSA Elongation factor 1-alpha OS=Artemia salina PE=1 SV=2 56 461 0.0E+00
sp|Q9YIC0|EF1A_ORYLA Elongation factor 1-alpha OS=Oryzias latipes GN=eef1a PE=2 SV=1 56 457 0.0E+00
sp|P51554|EF1A_HYDVU Elongation factor 1-alpha OS=Hydra vulgaris PE=2 SV=1 56 468 0.0E+00
sp|P05303|EF1A2_DROME Elongation factor 1-alpha 2 OS=Drosophila melanogaster GN=Ef1alpha100E PE=2 SV=2 56 461 0.0E+00
sp|P86939|EF1A2_TRYB2 Elongation factor 1-alpha 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=Tb10.70.5670 PE=1 SV=1 56 470 0.0E+00
sp|P86934|EF1A1_TRYB2 Elongation factor 1-alpha 1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=TEF1 PE=1 SV=1 56 470 0.0E+00
sp|P86933|EF1A_TRYBB Elongation factor 1-alpha OS=Trypanosoma brucei brucei GN=TEF1 PE=2 SV=1 56 470 0.0E+00
sp|P19039|EF1A_APIME Elongation factor 1-alpha OS=Apis mellifera PE=3 SV=1 56 461 0.0E+00
sp|Q26487|EF1A_SPOFR Elongation factor 1-alpha (Fragment) OS=Spodoptera frugiperda PE=1 SV=1 56 436 0.0E+00
sp|P27634|EF1A_RHYAM Elongation factor 1-alpha (Fragment) OS=Rhynchosciara americana PE=2 SV=1 63 471 0.0E+00
sp|P84316|EF1A_HELZE Elongation factor 1-alpha (Fragment) OS=Helicoverpa zea PE=3 SV=1 56 436 0.0E+00
sp|P84315|EF1A_HELVI Elongation factor 1-alpha (Fragment) OS=Heliothis virescens PE=3 SV=1 56 436 0.0E+00
sp|P84318|EF1A_HELGL Elongation factor 1-alpha (Fragment) OS=Helicoverpa gelotopoeon PE=3 SV=1 56 436 0.0E+00
sp|P84320|EF1A_HELDI Elongation factor 1-alpha (Fragment) OS=Heliocheilus discalis PE=3 SV=1 56 436 0.0E+00
sp|P84317|EF1A_HELAM Elongation factor 1-alpha (Fragment) OS=Helicoverpa armigera PE=3 SV=1 56 436 0.0E+00
sp|P84319|EF1A_HELAL Elongation factor 1-alpha (Fragment) OS=Heliocheilus albipunctella PE=3 SV=1 56 436 0.0E+00
sp|P84322|EF1A_ANIIF Elongation factor 1-alpha (Fragment) OS=Anicla infecta PE=3 SV=1 56 436 0.0E+00
sp|P84321|EF1A_ADIBE Elongation factor 1-alpha (Fragment) OS=Adisura bella PE=3 SV=1 56 436 0.0E+00
sp|P25698|EF1A_SOYBN Elongation factor 1-alpha OS=Glycine max GN=TEFS1 PE=3 SV=2 56 466 0.0E+00
sp|P34823|EF1A2_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=2 SV=1 56 466 0.0E+00
sp|P17786|EF1A_SOLLC Elongation factor 1-alpha OS=Solanum lycopersicum PE=2 SV=1 56 469 0.0E+00
sp|O49169|EF1A_MANES Elongation factor 1-alpha OS=Manihot esculenta GN=EF1 PE=3 SV=1 56 470 0.0E+00
sp|Q8GTY0|EF1A4_ARATH Elongation factor 1-alpha 4 OS=Arabidopsis thaliana GN=A4 PE=1 SV=2 56 470 0.0E+00
sp|Q0WL56|EF1A3_ARATH Elongation factor 1-alpha 3 OS=Arabidopsis thaliana GN=A3 PE=1 SV=2 56 470 0.0E+00
sp|Q8W4H7|EF1A2_ARATH Elongation factor 1-alpha 2 OS=Arabidopsis thaliana GN=A2 PE=1 SV=2 56 470 0.0E+00
sp|P0DH99|EF1A1_ARATH Elongation factor 1-alpha 1 OS=Arabidopsis thaliana GN=A1 PE=1 SV=1 56 470 0.0E+00
sp|P43643|EF1A_TOBAC Elongation factor 1-alpha OS=Nicotiana tabacum PE=2 SV=1 56 466 0.0E+00
sp|Q03033|EF1A_WHEAT Elongation factor 1-alpha OS=Triticum aestivum GN=TEF1 PE=2 SV=1 56 466 0.0E+00
sp|P25166|EF1A_STYLE Elongation factor 1-alpha OS=Stylonychia lemnae GN=EFAA PE=3 SV=1 56 466 0.0E+00
sp|Q40034|EF1A2_HORVU Elongation factor 1-alpha OS=Hordeum vulgare GN=BLT63 PE=1 SV=1 56 466 0.0E+00
sp|O64937|EF1A_ORYSJ Elongation factor 1-alpha OS=Oryza sativa subsp. japonica GN=REFA1 PE=2 SV=2 56 457 0.0E+00
sp|Q41803|EF1A_MAIZE Elongation factor 1-alpha OS=Zea mays GN=EF1A PE=3 SV=1 56 457 0.0E+00
sp|P34824|EF1A1_HORVU Elongation factor 1-alpha OS=Hordeum vulgare PE=1 SV=1 56 466 0.0E+00
sp|Q04634|EF1A_TETPY Elongation factor 1-alpha OS=Tetrahymena pyriformis PE=2 SV=1 56 455 0.0E+00
sp|P14963|EF1A_EUGGR Elongation factor 1-alpha OS=Euglena gracilis GN=TEF PE=2 SV=1 56 466 0.0E+00
sp|O24534|EF1A_VICFA Elongation factor 1-alpha OS=Vicia faba PE=2 SV=1 56 457 0.0E+00
sp|P29521|EF1A1_DAUCA Elongation factor 1-alpha OS=Daucus carota PE=1 SV=1 56 457 0.0E+00
sp|P0CT32|EF1A2_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a2 PE=1 SV=1 56 471 0.0E+00
sp|P0CT31|EF1A1_DICDI Elongation factor 1-alpha OS=Dictyostelium discoideum GN=eef1a1 PE=1 SV=1 56 471 0.0E+00
sp|Q8LPC4|EF1A_PYRYE Elongation factor 1-alpha OS=Pyropia yezoensis PE=2 SV=1 56 466 0.0E+00
sp|P50256|EF1AC_PORPU Elongation factor 1-alpha C OS=Porphyra purpurea GN=TEF-C PE=2 SV=1 56 466 0.0E+00
sp|Q41011|EF1A_PEA Elongation factor 1-alpha OS=Pisum sativum PE=2 SV=1 56 457 0.0E+00
sp|P17506|EF1A1_XENLA Elongation factor 1-alpha OS=Xenopus laevis PE=1 SV=2 57 466 0.0E+00
sp|P31018|EF1A_ENTHI Elongation factor 1-alpha OS=Entamoeba histolytica PE=2 SV=1 56 450 0.0E+00
sp|P90519|EF1A_CRYPV Elongation factor 1-alpha OS=Cryptosporidium parvum PE=2 SV=1 56 459 0.0E+00
sp|Q27139|EF1A1_EUPCR Elongation factor 1-alpha 1 OS=Euplotes crassus GN=EFA1 PE=3 SV=1 56 459 0.0E+00
sp|Q00080|EF1A_PLAFK Elongation factor 1-alpha OS=Plasmodium falciparum (isolate K1 / Thailand) GN=MEF-1 PE=3 SV=1 56 464 0.0E+00
sp|P54959|EF1A_BLAHO Elongation factor 1-alpha OS=Blastocystis hominis PE=2 SV=1 60 449 0.0E+00
sp|Q07051|EF1A_EIMBO Elongation factor 1-alpha (Fragment) OS=Eimeria bovis PE=2 SV=1 116 471 0.0E+00
sp|Q27140|EF1A2_EUPCR Elongation factor 1-alpha 2 OS=Euplotes crassus GN=EFA2 PE=3 SV=1 56 450 9.0E-169
sp|Q08046|EF1A_GIAIN Elongation factor 1-alpha (Fragment) OS=Giardia intestinalis GN=TEF1 PE=2 SV=1 57 436 7.0E-167
sp|A8ABM5|EF1A_IGNH4 Elongation factor 1-alpha OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=tuf PE=3 SV=1 56 450 3.0E-157
sp|A3DMQ1|EF1A_STAMF Elongation factor 1-alpha OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=tuf PE=3 SV=1 56 450 4.0E-157
sp|P50257|EF1AS_PORPU Elongation factor 1-alpha S OS=Porphyra purpurea GN=TEF-S PE=2 SV=1 56 458 9.0E-155
sp|A2BN41|EF1A_HYPBU Elongation factor 1-alpha OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=tuf PE=3 SV=1 64 450 2.0E-154
sp|P41203|EF1A_DESMO Elongation factor 1-alpha OS=Desulfurococcus mobilis GN=tuf PE=3 SV=1 56 445 3.0E-152
sp|Q9YAV0|EF1A_AERPE Elongation factor 1-alpha OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=tuf PE=1 SV=1 56 450 3.0E-151
sp|Q2FRI3|EF1A_METHJ Elongation factor 1-alpha OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=tuf PE=3 SV=1 56 452 3.0E-151
sp|A2STF0|EF1A_METLZ Elongation factor 1-alpha OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=tuf PE=3 SV=1 56 450 4.0E-151
sp|A7I656|EF1A_METB6 Elongation factor 1-alpha OS=Methanoregula boonei (strain 6A8) GN=tuf PE=3 SV=1 56 450 8.0E-151
sp|B8GIQ3|EF1A_METPE Elongation factor 1-alpha OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=tuf PE=3 SV=1 56 450 1.0E-148
sp|P35021|EF1A_SULSO Elongation factor 1-alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=tuf PE=1 SV=3 57 450 2.0E-148
sp|Q57770|EF1A_METJA Elongation factor 1-alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=tuf PE=3 SV=1 56 455 8.0E-148
sp|A6UQ14|EF1A_METVS Elongation factor 1-alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=tuf PE=3 SV=1 56 455 5.0E-147
sp|A0RUM4|EF1A_CENSY Elongation factor 1-alpha OS=Cenarchaeum symbiosum (strain A) GN=tuf PE=3 SV=1 56 455 2.0E-146
sp|P07810|EF1A_METVA Elongation factor 1-alpha OS=Methanococcus vannielii GN=tuf PE=3 SV=1 56 455 3.0E-146
sp|A9A9U3|EF1A_METM6 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=tuf PE=3 SV=1 56 455 3.0E-145
sp|A4FWE9|EF1A_METM5 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=tuf PE=3 SV=1 56 455 4.0E-145
sp|A6VGV6|EF1A_METM7 Elongation factor 1-alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=tuf PE=3 SV=1 56 455 4.0E-145
sp|A3CTG3|EF1A_METMJ Elongation factor 1-alpha OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=tuf PE=3 SV=1 56 450 6.0E-145
sp|C6A4R7|EF1A_THESM Elongation factor 1-alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=tuf PE=3 SV=1 56 452 3.0E-144
sp|Q8TYP6|EF1A_METKA Elongation factor 1-alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=tuf PE=3 SV=1 54 454 6.0E-144
sp|P17196|EF1A_SULAC Elongation factor 1-alpha OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=tuf PE=3 SV=1 57 450 2.0E-143
sp|A4YCR6|EF1A_METS5 Elongation factor 1-alpha OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=tuf PE=3 SV=1 57 450 2.0E-143
sp|Q6LXI1|EF1A_METMP Elongation factor 1-alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=tuf PE=3 SV=1 56 455 3.0E-143
sp|A1RXW9|EF1A_THEPD Elongation factor 1-alpha OS=Thermofilum pendens (strain Hrk 5) GN=tuf PE=3 SV=1 56 454 3.0E-143
sp|Q979T1|EF1A_THEVO Elongation factor 1-alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=tuf PE=3 SV=2 56 452 4.0E-143
sp|O29325|EF1A_ARCFU Elongation factor 1-alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=tuf PE=3 SV=1 56 447 6.0E-143
sp|P19486|EF1A_THEAC Elongation factor 1-alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=tuf PE=3 SV=2 56 452 1.0E-142
sp|A6UV43|EF1A_META3 Elongation factor 1-alpha OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=tuf PE=3 SV=1 56 455 2.0E-139
sp|O27132|EF1A_METTH Elongation factor 1-alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=tuf PE=1 SV=1 59 446 4.0E-139
sp|Q6L202|EF1A_PICTO Elongation factor 1-alpha OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=tuf PE=3 SV=1 56 452 2.0E-138
sp|A5ULM5|EF1A_METS3 Elongation factor 1-alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=tuf PE=3 SV=2 59 450 2.0E-138
sp|Q3IUD8|EF1A_NATPD Elongation factor 1-alpha OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=tuf PE=3 SV=1 56 452 4.0E-138
sp|Q8TRC4|EF1A_METAC Elongation factor 1-alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=tuf PE=3 SV=1 56 452 4.0E-138
sp|Q2NEL1|EF1A_METST Elongation factor 1-alpha OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=tuf PE=3 SV=1 52 454 5.0E-138
sp|Q976B1|EF1A_SULTO Elongation factor 1-alpha OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=tuf PE=3 SV=1 57 450 1.0E-136
sp|Q18EY5|EF1A_HALWD Elongation factor 1-alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=tuf PE=3 SV=1 56 452 3.0E-136
sp|Q5JFZ4|EF1A_THEKO Elongation factor 1-alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tuf PE=3 SV=1 56 454 7.0E-136
sp|Q12WT3|EF1A_METBU Elongation factor 1-alpha OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=tuf PE=3 SV=1 56 450 3.0E-135
sp|A1RRJ3|EF1A_PYRIL Elongation factor 1-alpha OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=tuf PE=3 SV=1 57 450 3.0E-135
sp|A3MV69|EF1A_PYRCJ Elongation factor 1-alpha OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=tuf PE=3 SV=1 57 450 3.0E-135
sp|B6YVG2|EF1A_THEON Elongation factor 1-alpha OS=Thermococcus onnurineus (strain NA1) GN=tuf PE=3 SV=1 56 454 4.0E-135
sp|A4WKK8|EF1A_PYRAR Elongation factor 1-alpha OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=tuf PE=3 SV=1 57 450 4.0E-135
sp|Q9HM89|EF1A_HALSA Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=tuf PE=3 SV=1 56 452 5.0E-135
sp|B0R8C3|EF1A_HALS3 Elongation factor 1-alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=tuf PE=3 SV=1 56 452 5.0E-135
sp|P17197|EF1A_THECE Elongation factor 1-alpha OS=Thermococcus celer GN=tuf PE=3 SV=1 56 454 9.0E-135
sp|O93729|EF1A_PYRAE Elongation factor 1-alpha OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=tuf PE=3 SV=1 57 450 1.0E-134
sp|A8MAJ1|EF1A_CALMQ Elongation factor 1-alpha OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=tuf PE=3 SV=1 56 447 2.0E-134
sp|A0B7D6|EF1A_METTP Elongation factor 1-alpha OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=tuf PE=3 SV=1 56 450 2.0E-134
sp|Q8U152|EF1A_PYRFU Elongation factor 1-alpha OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tuf PE=3 SV=1 56 452 4.0E-134
sp|C5A5P4|EF1A_THEGJ Elongation factor 1-alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=tuf PE=3 SV=1 56 454 6.0E-134
sp|Q0W8G2|EF1A_METAR Elongation factor 1-alpha OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=tuf PE=3 SV=1 56 450 9.0E-134
sp|P26751|EF1A_PYRWO Elongation factor 1-alpha OS=Pyrococcus woesei GN=tuf PE=3 SV=1 56 452 1.0E-133
sp|Q8PUR8|EF1A_METMA Elongation factor 1-alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=tuf PE=3 SV=1 56 452 2.0E-133
sp|P16018|EF1A_HALMA Elongation factor 1-alpha OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=tuf PE=1 SV=2 56 452 1.0E-132
sp|Q464Z4|EF1A_METBF Elongation factor 1-alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=tuf PE=3 SV=1 56 452 2.0E-132
sp|O59153|EF1A_PYRHO Elongation factor 1-alpha OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tuf PE=1 SV=1 56 452 2.0E-130
sp|Q9V0V7|EF1A_PYRAB Elongation factor 1-alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tuf PE=3 SV=1 56 452 5.0E-130
sp|Q74MI6|EF1A_NANEQ Elongation factor 1-alpha OS=Nanoarchaeum equitans (strain Kin4-M) GN=tuf PE=3 SV=1 56 450 4.0E-112
sp|Q5R6Y0|HBS1L_PONAB HBS1-like protein OS=Pongo abelii GN=HBS1L PE=2 SV=1 56 447 1.0E-89
sp|Q9Y450|HBS1L_HUMAN HBS1-like protein OS=Homo sapiens GN=HBS1L PE=1 SV=1 56 450 3.0E-89
sp|Q2KHZ2|HBS1L_BOVIN HBS1-like protein OS=Bos taurus GN=HBS1L PE=2 SV=1 56 450 8.0E-86
sp|Q69ZS7|HBS1L_MOUSE HBS1-like protein OS=Mus musculus GN=Hbs1l PE=1 SV=2 56 450 1.0E-85
sp|Q6AXM7|HBS1L_RAT HBS1-like protein OS=Rattus norvegicus GN=Hbs1l PE=1 SV=1 56 450 1.0E-85
sp|P15170|ERF3A_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens GN=GSPT1 PE=1 SV=1 56 454 2.0E-80
sp|Q8R050|ERF3A_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Mus musculus GN=Gspt1 PE=1 SV=2 56 454 6.0E-79
sp|Q149F3|ERF3B_MOUSE Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Mus musculus GN=Gspt2 PE=1 SV=1 56 454 4.0E-77
sp|Q8IYD1|ERF3B_HUMAN Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens GN=GSPT2 PE=1 SV=2 56 454 7.0E-77
sp|Q5R4B3|ERF3B_PONAB Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Pongo abelii GN=GSPT2 PE=2 SV=1 56 454 1.0E-76
sp|Q9HGI4|ERF3_ZYGRO Eukaryotic peptide chain release factor GTP-binding subunit OS=Zygosaccharomyces rouxii GN=SUP35 PE=3 SV=2 56 447 3.0E-76
sp|Q9HGI7|ERF3_CANMA Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida maltosa GN=SUP35 PE=3 SV=2 56 447 2.0E-75
sp|O74718|ERF3_SCHPO Eukaryotic peptide chain release factor GTP-binding subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sup35 PE=1 SV=2 56 451 4.0E-75
sp|P23637|ERF3_OGAPI Eukaryotic peptide chain release factor GTP-binding subunit OS=Ogataea pini GN=SUP2 PE=3 SV=1 56 447 1.0E-74
sp|Q9HGI8|ERF3_KLULA Eukaryotic peptide chain release factor GTP-binding subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SUP35 PE=3 SV=1 56 447 2.0E-72
sp|O13354|ERF3_CANAX Eukaryotic peptide chain release factor GTP-binding subunit OS=Candida albicans GN=SUP35 PE=3 SV=1 56 447 2.0E-72
sp|Q9HGI6|ERF3_DEBHA Eukaryotic peptide chain release factor GTP-binding subunit OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SUP35 PE=3 SV=4 56 450 2.0E-72
sp|P05453|ERF3_YEAST Eukaryotic peptide chain release factor GTP-binding subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SUP35 PE=1 SV=1 56 447 3.0E-70
sp|O74774|HBS1_SCHPO Elongation factor 1 alpha-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hbs1 PE=1 SV=4 56 450 8.0E-70
sp|Q8SS29|EF1A_ENCCU Elongation factor 1-alpha OS=Encephalitozoon cuniculi (strain GB-M1) GN=TEF1 PE=1 SV=2 56 445 3.0E-64
sp|Q7YZN9|ERF3_DICDI Eukaryotic peptide chain release factor GTP-binding subunit OS=Dictyostelium discoideum GN=erf3 PE=2 SV=1 56 455 6.0E-63
sp|P32769|HBS1_YEAST Elongation factor 1 alpha-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HBS1 PE=1 SV=2 56 450 1.0E-47
sp|Q5PBH1|EFTU_ANAMM Elongation factor Tu OS=Anaplasma marginale (strain St. Maries) GN=tuf1 PE=3 SV=1 71 450 1.0E-44
sp|B9MQH1|EFTU_CALBD Elongation factor Tu OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tuf PE=3 SV=1 31 450 3.0E-44
sp|Q2GJ61|EFTU_ANAPZ Elongation factor Tu OS=Anaplasma phagocytophilum (strain HZ) GN=tuf1 PE=3 SV=1 71 450 3.0E-44
sp|Q1D776|EFTU2_MYXXD Elongation factor Tu 2 OS=Myxococcus xanthus (strain DK 1622) GN=tuf2 PE=3 SV=1 30 450 4.0E-44
sp|Q1D7V1|EFTU1_MYXXD Elongation factor Tu 1 OS=Myxococcus xanthus (strain DK 1622) GN=tuf1 PE=3 SV=1 30 450 4.0E-44
sp|P13442|NODQ_RHIME Bifunctional enzyme NodQ OS=Rhizobium meliloti (strain 1021) GN=nodQ PE=3 SV=1 68 471 4.0E-44
sp|A2CI56|EFTU_CHLAT Elongation factor Tu, chloroplastic OS=Chlorokybus atmophyticus GN=tufA PE=3 SV=1 30 450 1.0E-43
sp|A8ANW5|CYSN_CITK8 Sulfate adenylyltransferase subunit 1 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cysN PE=3 SV=1 65 445 1.0E-43
sp|Q250N4|EFTU_DESHY Elongation factor Tu OS=Desulfitobacterium hafniense (strain Y51) GN=tuf PE=3 SV=1 30 450 2.0E-43
sp|B8G1W4|EFTU_DESHD Elongation factor Tu OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=tuf PE=3 SV=1 30 450 2.0E-43
sp|A4XI37|EFTU_CALS8 Elongation factor Tu OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tuf PE=3 SV=1 31 450 2.0E-43
sp|Q01698|EFTU_THEAQ Elongation factor Tu OS=Thermus aquaticus GN=tuf PE=1 SV=2 46 450 3.0E-43
sp|O07309|NODQ_RHISB Bifunctional enzyme NodQ OS=Rhizobium sp. (strain BR816) GN=nodQ PE=3 SV=1 63 471 5.0E-43
sp|P42479|EFTU_STIAU Elongation factor Tu OS=Stigmatella aurantiaca GN=tuf PE=3 SV=2 30 450 6.0E-43
sp|Q5HAS0|EFTU_EHRRW Elongation factor Tu OS=Ehrlichia ruminantium (strain Welgevonden) GN=tuf1 PE=3 SV=1 61 450 6.0E-43
sp|Q5FFE6|EFTU_EHRRG Elongation factor Tu OS=Ehrlichia ruminantium (strain Gardel) GN=tuf1 PE=3 SV=1 61 450 6.0E-43
sp|P60339|EFTU2_THET8 Elongation factor Tu-B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufB PE=1 SV=2 46 450 9.0E-43
sp|Q72GW4|EFTU_THET2 Elongation factor Tu OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tuf1 PE=3 SV=1 46 450 1.0E-42
sp|P60338|EFTU1_THETH Elongation factor Tu-A OS=Thermus thermophilus GN=tufA PE=1 SV=2 46 450 1.0E-42
sp|Q5SHN6|EFTU1_THET8 Elongation factor Tu-A OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tufA PE=1 SV=3 46 450 1.0E-42
sp|Q8AAP9|CYSN_BACTN Sulfate adenylyltransferase subunit 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=cysN PE=3 SV=1 67 447 1.0E-42
sp|B0TC54|EFTU_HELMI Elongation factor Tu OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=tuf PE=3 SV=1 31 450 1.0E-42
sp|A7MJ69|CYSN_CROS8 Sulfate adenylyltransferase subunit 1 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cysN PE=3 SV=1 68 445 1.0E-42
sp|Q1MPT8|EFTU_LAWIP Elongation factor Tu OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=tuf PE=3 SV=1 30 450 2.0E-42
sp|Q92GW4|EFTU_RICCN Elongation factor Tu OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tuf PE=3 SV=1 31 451 3.0E-42
sp|A5FZW7|EFTU_ACICJ Elongation factor Tu OS=Acidiphilium cryptum (strain JF-5) GN=tuf PE=3 SV=1 31 452 3.0E-42
sp|Q9TJQ8|EFTU_PROWI Elongation factor Tu, plastid OS=Prototheca wickerhamii GN=tufA PE=3 SV=1 31 452 4.0E-42
sp|A8GT71|EFTU_RICRS Elongation factor Tu OS=Rickettsia rickettsii (strain Sheila Smith) GN=tuf PE=3 SV=1 31 451 4.0E-42
sp|B0BUR2|EFTU_RICRO Elongation factor Tu OS=Rickettsia rickettsii (strain Iowa) GN=tuf PE=3 SV=1 31 451 4.0E-42
sp|C4K2I2|EFTU_RICPU Elongation factor Tu OS=Rickettsia peacockii (strain Rustic) GN=tuf PE=3 SV=1 31 451 4.0E-42
sp|C3PPA9|EFTU_RICAE Elongation factor Tu OS=Rickettsia africae (strain ESF-5) GN=tuf PE=3 SV=1 31 451 4.0E-42
sp|A8F2E9|EFTU_RICM5 Elongation factor Tu OS=Rickettsia massiliae (strain Mtu5) GN=tuf PE=3 SV=2 31 451 6.0E-42
sp|P0A3B0|EFTU_RICSI Elongation factor Tu OS=Rickettsia sibirica GN=tuf PE=3 SV=1 31 451 7.0E-42
sp|P0A3A9|EFTU_RICRI Elongation factor Tu OS=Rickettsia rickettsii GN=tuf PE=3 SV=1 31 451 7.0E-42
sp|Q8KTA1|EFTU_RICMO Elongation factor Tu OS=Rickettsia montanensis GN=tuf PE=3 SV=1 31 451 9.0E-42
sp|A5V604|EFTU_SPHWW Elongation factor Tu OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=tuf PE=3 SV=1 31 452 9.0E-42
sp|A8EZL8|EFTU_RICCK Elongation factor Tu OS=Rickettsia canadensis (strain McKiel) GN=tuf PE=3 SV=1 31 451 1.0E-41
sp|Q8KT99|EFTU_RICHE Elongation factor Tu OS=Rickettsia helvetica GN=tuf PE=3 SV=1 31 451 1.0E-41
sp|Q8KTA6|EFTU_RICPA Elongation factor Tu OS=Rickettsia parkeri GN=tuf PE=3 SV=1 31 451 1.0E-41
sp|Q5LES3|CYSN_BACFN Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=cysN PE=3 SV=1 67 454 1.0E-41
sp|A5CCA0|EFTU1_ORITB Elongation factor Tu 1 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf1 PE=3 SV=1 57 452 1.0E-41
sp|Q5GWR8|EFTU_XANOR Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tuf1 PE=3 SV=1 31 452 1.0E-41
sp|Q2NZX1|EFTU_XANOM Elongation factor Tu OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tuf1 PE=3 SV=1 31 452 1.0E-41
sp|P48865|EFTU_RICPR Elongation factor Tu OS=Rickettsia prowazekii (strain Madrid E) GN=tuf PE=3 SV=2 31 451 2.0E-41
sp|Q30X13|EFTU_DESAG Elongation factor Tu OS=Desulfovibrio alaskensis (strain G20) GN=tuf PE=3 SV=1 30 450 2.0E-41
sp|Q64VQ9|CYSN_BACFR Sulfate adenylyltransferase subunit 1 OS=Bacteroides fragilis (strain YCH46) GN=cysN PE=3 SV=1 67 454 2.0E-41
sp|Q06J54|EFTU_BIGNA Elongation factor Tu, chloroplastic OS=Bigelowiella natans GN=tufA PE=3 SV=1 30 450 3.0E-41
sp|O50274|CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysNC PE=3 SV=1 68 449 3.0E-41
sp|Q8UE16|EFTU_AGRFC Elongation factor Tu OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=tufA PE=3 SV=1 31 450 3.0E-41
sp|A5CCL4|EFTU2_ORITB Elongation factor Tu 2 OS=Orientia tsutsugamushi (strain Boryong) GN=tuf2 PE=3 SV=2 57 452 3.0E-41
sp|Q1QN32|EFTU_NITHX Elongation factor Tu OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=tuf PE=3 SV=1 31 450 4.0E-41
sp|A6X0A2|EFTU_OCHA4 Elongation factor Tu OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=tuf1 PE=3 SV=1 31 450 4.0E-41
sp|Q6AP73|EFTU2_DESPS Elongation factor Tu 2 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf2 PE=3 SV=1 30 450 4.0E-41
sp|A6YG72|EFTU_LEPTE Elongation factor Tu, chloroplastic OS=Leptosira terrestris GN=tufA PE=3 SV=1 30 450 4.0E-41
sp|C4LAG3|CYSN_TOLAT Sulfate adenylyltransferase subunit 1 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=cysN PE=3 SV=1 65 445 5.0E-41
sp|P52978|NODQ_RHITR Bifunctional enzyme NodQ OS=Rhizobium tropici GN=nodQ PE=3 SV=1 67 471 5.0E-41
sp|Q3YRK7|EFTU_EHRCJ Elongation factor Tu OS=Ehrlichia canis (strain Jake) GN=tuf1 PE=3 SV=1 61 450 6.0E-41
sp|Q2G8Y2|EFTU_NOVAD Elongation factor Tu OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=tuf PE=3 SV=1 31 452 7.0E-41
sp|A6LLL1|EFTU_THEM4 Elongation factor Tu OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tuf PE=3 SV=1 30 450 8.0E-41
sp|A1VAK4|EFTU_DESVV Elongation factor Tu OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=tuf PE=3 SV=1 30 450 9.0E-41
sp|Q727D5|EFTU_DESVH Elongation factor Tu OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=tuf PE=3 SV=1 30 450 9.0E-41
sp|A5GAW4|EFTU_GEOUR Elongation factor Tu OS=Geobacter uraniireducens (strain Rf4) GN=tuf1 PE=3 SV=1 31 450 1.0E-40
sp|P75022|EFTU_RHIRD Elongation factor Tu OS=Rhizobium radiobacter GN=tufA PE=3 SV=1 31 450 1.0E-40
sp|P17245|EFTU_CYAPA Elongation factor Tu, cyanelle OS=Cyanophora paradoxa GN=tufA PE=3 SV=2 61 452 1.0E-40
sp|A5D5K0|EFTU1_PELTS Elongation factor Tu 1 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf1 PE=3 SV=1 30 450 1.0E-40
sp|Q8KT95|EFTU_RICTY Elongation factor Tu OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tuf PE=3 SV=2 31 451 1.0E-40
sp|A5D5I8|EFTU2_PELTS Elongation factor Tu 2 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=tuf2 PE=3 SV=1 30 450 1.0E-40
sp|P64025|EFTU_BRUSU Elongation factor Tu OS=Brucella suis biovar 1 (strain 1330) GN=tufA PE=3 SV=1 31 450 1.0E-40
sp|A5VR08|EFTU_BRUO2 Elongation factor Tu OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=tuf1 PE=3 SV=1 31 450 1.0E-40
sp|P64024|EFTU_BRUME Elongation factor Tu OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=tufA PE=3 SV=1 31 450 1.0E-40
sp|A9M5Q2|EFTU_BRUC2 Elongation factor Tu OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=tuf1 PE=3 SV=1 31 450 1.0E-40
sp|Q2YM08|EFTU_BRUA2 Elongation factor Tu OS=Brucella abortus (strain 2308) GN=tuf1 PE=3 SV=1 31 450 1.0E-40
sp|A1ALS6|EFTU_PELPD Elongation factor Tu OS=Pelobacter propionicus (strain DSM 2379) GN=tuf1 PE=3 SV=1 31 450 1.0E-40
sp|Q5YPG4|EFTU_NOCFA Elongation factor Tu OS=Nocardia farcinica (strain IFM 10152) GN=tuf PE=3 SV=2 31 452 2.0E-40
sp|A8GPF2|EFTU_RICAH Elongation factor Tu OS=Rickettsia akari (strain Hartford) GN=tuf PE=3 SV=1 31 451 2.0E-40
sp|Q2K9N2|EFTU1_RHIEC Elongation factor Tu 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tuf1 PE=3 SV=1 31 450 2.0E-40
sp|A8F4Q9|EFTU_PSELT Elongation factor Tu OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=tuf PE=3 SV=1 61 450 2.0E-40
sp|B0CH34|EFTU_BRUSI Elongation factor Tu OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=tuf1 PE=3 SV=1 31 450 2.0E-40
sp|Q6AP86|EFTU1_DESPS Elongation factor Tu 1 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tuf1 PE=3 SV=1 30 450 2.0E-40
sp|Q2GFN6|EFTU_EHRCR Elongation factor Tu OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=tuf1 PE=3 SV=1 61 450 2.0E-40
sp|Q482Z9|CYSN_COLP3 Sulfate adenylyltransferase subunit 1 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=cysN PE=3 SV=1 68 445 2.0E-40
sp|Q3SSW8|EFTU_NITWN Elongation factor Tu OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=tuf PE=3 SV=1 31 450 2.0E-40
sp|Q8KT97|EFTU_RICFE Elongation factor Tu OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tuf PE=3 SV=1 31 451 3.0E-40
sp|A5N4N1|EFTU_CLOK5 Elongation factor Tu OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=tuf1 PE=3 SV=1 30 452 3.0E-40
sp|A9VP75|EFTU_BACWK Elongation factor Tu OS=Bacillus weihenstephanensis (strain KBAB4) GN=tuf PE=3 SV=1 31 450 3.0E-40
sp|B1LBP2|EFTU_THESQ Elongation factor Tu OS=Thermotoga sp. (strain RQ2) GN=tuf PE=3 SV=1 71 450 3.0E-40
sp|A5IM81|EFTU_THEP1 Elongation factor Tu OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tuf PE=3 SV=1 71 450 3.0E-40
sp|Q8BFR5|EFTU_MOUSE Elongation factor Tu, mitochondrial OS=Mus musculus GN=Tufm PE=1 SV=1 58 450 3.0E-40
sp|A0QS98|EFTU_MYCS2 Elongation factor Tu OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=tuf PE=1 SV=1 71 452 3.0E-40
sp|A8Z5T8|EFTU_SULMW Elongation factor Tu OS=Sulcia muelleri (strain GWSS) GN=tuf PE=3 SV=1 40 451 3.0E-40
sp|B8DLL9|EFTU_DESVM Elongation factor Tu OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=tuf PE=3 SV=1 30 450 4.0E-40
sp|A7ZCN0|EFTU_CAMC1 Elongation factor Tu OS=Campylobacter concisus (strain 13826) GN=tuf PE=3 SV=1 36 450 5.0E-40
sp|P13537|EFTU_THEMA Elongation factor Tu OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tuf PE=3 SV=2 71 450 5.0E-40
sp|A7HBL7|EFTU_ANADF Elongation factor Tu OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tuf1 PE=3 SV=1 30 450 5.0E-40
sp|P49410|EFTU_BOVIN Elongation factor Tu, mitochondrial OS=Bos taurus GN=TUFM PE=1 SV=1 58 447 6.0E-40
sp|A7ZQJ5|CYSN_ECO24 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cysN PE=3 SV=1 68 445 7.0E-40
sp|B9IZJ2|EFTU_BACCQ Elongation factor Tu OS=Bacillus cereus (strain Q1) GN=tuf PE=3 SV=1 31 450 7.0E-40
sp|B7HQU2|EFTU_BACC7 Elongation factor Tu OS=Bacillus cereus (strain AH187) GN=tuf PE=3 SV=1 31 450 7.0E-40
sp|Q73F98|EFTU_BACC1 Elongation factor Tu OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tuf PE=3 SV=1 31 450 7.0E-40
sp|A6U842|EFTU_SINMW Elongation factor Tu OS=Sinorhizobium medicae (strain WSM419) GN=tuf1 PE=3 SV=1 31 450 8.0E-40
sp|Q925Y6|EFTU_RHIME Elongation factor Tu OS=Rhizobium meliloti (strain 1021) GN=tufA PE=3 SV=1 31 450 8.0E-40
sp|B6I6E1|CYSN_ECOSE Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SE11) GN=cysN PE=3 SV=1 68 445 8.0E-40
sp|B7IT17|EFTU_BACC2 Elongation factor Tu OS=Bacillus cereus (strain G9842) GN=tuf PE=3 SV=1 31 450 9.0E-40
sp|A7I3U7|EFTU_CAMHC Elongation factor Tu OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=tuf PE=3 SV=1 36 450 9.0E-40
sp|P42473|EFTU_CHLP8 Elongation factor Tu OS=Chlorobaculum parvum (strain NCIB 8327) GN=tuf PE=3 SV=1 30 450 1.0E-39
sp|A0L5V8|EFTU_MAGMM Elongation factor Tu OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=tuf1 PE=3 SV=1 30 450 1.0E-39
sp|B8ELG5|EFTU_METSB Elongation factor Tu OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=tuf PE=3 SV=1 30 450 1.0E-39
sp|P42477|EFTU_HERAU Elongation factor Tu OS=Herpetosiphon aurantiacus GN=tuf PE=3 SV=1 30 450 1.0E-39
sp|Q6HPR0|EFTU_BACHK Elongation factor Tu OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tuf PE=3 SV=1 31 450 1.0E-39
sp|Q63H92|EFTU_BACCZ Elongation factor Tu OS=Bacillus cereus (strain ZK / E33L) GN=tuf PE=3 SV=1 31 450 1.0E-39
sp|Q814C4|EFTU_BACCR Elongation factor Tu OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tuf PE=3 SV=1 31 450 1.0E-39
sp|B7HJ46|EFTU_BACC4 Elongation factor Tu OS=Bacillus cereus (strain B4264) GN=tuf PE=3 SV=1 31 450 1.0E-39
sp|C1ET37|EFTU_BACC3 Elongation factor Tu OS=Bacillus cereus (strain 03BB102) GN=tuf PE=3 SV=1 31 450 1.0E-39
sp|B7JKB7|EFTU_BACC0 Elongation factor Tu OS=Bacillus cereus (strain AH820) GN=tuf PE=3 SV=1 31 450 1.0E-39
sp|Q81VT2|EFTU_BACAN Elongation factor Tu OS=Bacillus anthracis GN=tuf PE=3 SV=1 31 450 1.0E-39
sp|A0R8H8|EFTU_BACAH Elongation factor Tu OS=Bacillus thuringiensis (strain Al Hakam) GN=tuf PE=3 SV=1 31 450 1.0E-39
sp|C3LJ80|EFTU_BACAC Elongation factor Tu OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=tuf PE=3 SV=1 31 450 1.0E-39
sp|C3P9Q3|EFTU_BACAA Elongation factor Tu OS=Bacillus anthracis (strain A0248) GN=tuf PE=3 SV=1 31 450 1.0E-39
sp|O66429|EFTU_AQUAE Elongation factor Tu OS=Aquifex aeolicus (strain VF5) GN=tufA PE=3 SV=1 30 450 1.0E-39
sp|P9WNN1|EFTU_MYCTU Elongation factor Tu OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tuf PE=1 SV=1 71 452 1.0E-39
sp|P9WNN0|EFTU_MYCTO Elongation factor Tu OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=tuf PE=3 SV=1 71 452 1.0E-39
sp|A5U071|EFTU_MYCTA Elongation factor Tu OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=tuf PE=3 SV=1 71 452 1.0E-39
sp|C1AL18|EFTU_MYCBT Elongation factor Tu OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=tuf PE=3 SV=1 71 452 1.0E-39
sp|A1KGG5|EFTU_MYCBP Elongation factor Tu OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=tuf PE=3 SV=1 71 452 1.0E-39
sp|P0A559|EFTU_MYCBO Elongation factor Tu OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=tuf PE=3 SV=1 71 452 1.0E-39
sp|Q2K9L8|EFTU2_RHIEC Elongation factor Tu 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tuf2 PE=3 SV=1 31 447 1.0E-39
sp|A1T4L6|EFTU_MYCVP Elongation factor Tu OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=tuf PE=3 SV=1 71 452 1.0E-39
sp|A0LRL8|EFTU_ACIC1 Elongation factor Tu OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=tuf PE=3 SV=1 31 452 1.0E-39
sp|Q5NQ65|EFTU_ZYMMO Elongation factor Tu OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tuf PE=3 SV=1 31 452 1.0E-39
sp|P85834|EFTU_RAT Elongation factor Tu, mitochondrial OS=Rattus norvegicus GN=Tufm PE=1 SV=1 58 450 1.0E-39
sp|Q1ACI3|EFTU_CHAVU Elongation factor Tu, chloroplastic OS=Chara vulgaris GN=tufA PE=3 SV=1 38 450 1.0E-39
sp|O50293|EFTU_AQUPY Elongation factor Tu OS=Aquifex pyrophilus GN=tuf PE=3 SV=1 30 450 1.0E-39
sp|B8D9K1|CYSN_BUCA5 Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=cysN PE=3 SV=1 68 455 2.0E-39
sp|B8J1A0|EFTU_DESDA Elongation factor Tu OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=tuf PE=3 SV=1 30 452 2.0E-39
sp|A9ISD9|EFTU_BART1 Elongation factor Tu OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=tuf1 PE=3 SV=1 31 450 2.0E-39
sp|Q47LJ1|EFTU_THEFY Elongation factor Tu OS=Thermobifida fusca (strain YX) GN=tuf PE=3 SV=1 31 452 2.0E-39
sp|P57498|CYSN_BUCAI Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysN PE=3 SV=1 68 455 2.0E-39
sp|B6JET1|EFTU_OLICO Elongation factor Tu OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=tuf PE=3 SV=1 30 450 2.0E-39
sp|Q73SD1|EFTU_MYCPA Elongation factor Tu OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=tuf PE=3 SV=1 71 452 2.0E-39
sp|A0QL35|EFTU_MYCA1 Elongation factor Tu OS=Mycobacterium avium (strain 104) GN=tuf PE=3 SV=1 71 452 2.0E-39
sp|B7LXG3|CYSN_ECO8A Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O8 (strain IAI1) GN=cysN PE=3 SV=1 68 445 2.0E-39
sp|B7LEG9|CYSN_ECO55 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain 55989 / EAEC) GN=cysN PE=3 SV=1 68 445 2.0E-39
sp|A9H3R7|EFTU_GLUDA Elongation factor Tu OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=tuf PE=3 SV=1 31 450 2.0E-39
sp|Q748X8|EFTU_GEOSL Elongation factor Tu OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tuf1 PE=3 SV=1 31 450 2.0E-39
sp|C0ZIH6|EFTU_BREBN Elongation factor Tu OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=tuf PE=3 SV=1 31 451 2.0E-39
sp|B7N6Y1|CYSN_ECOLU Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cysN PE=3 SV=1 68 445 2.0E-39
sp|Q21RV6|EFTU2_RHOFT Elongation factor Tu 2 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf2 PE=3 SV=1 30 450 3.0E-39
sp|Q3BWY6|EFTU_XANC5 Elongation factor Tu OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tuf1 PE=3 SV=1 31 452 3.0E-39
sp|Q8NL22|EFTU_XANAC Elongation factor Tu OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tufA PE=3 SV=1 31 452 3.0E-39
sp|P02992|EFTU_YEAST Elongation factor Tu, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUF1 PE=1 SV=1 32 450 3.0E-39
sp|P50371|EFTU_CHACO Elongation factor Tu, chloroplastic OS=Chara connivens GN=tufA PE=3 SV=1 38 447 3.0E-39
sp|Q134R0|EFTU2_RHOPS Elongation factor Tu 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf2 PE=3 SV=1 31 450 4.0E-39
sp|C5CGR6|EFTU_KOSOT Elongation factor Tu OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tuf PE=3 SV=1 30 450 4.0E-39
sp|B8D7V3|CYSN_BUCAT Sulfate adenylyltransferase subunit 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=cysN PE=3 SV=1 68 455 4.0E-39
sp|P49411|EFTU_HUMAN Elongation factor Tu, mitochondrial OS=Homo sapiens GN=TUFM PE=1 SV=2 58 447 4.0E-39
sp|Q134S7|EFTU1_RHOPS Elongation factor Tu 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=tuf1 PE=3 SV=1 31 450 4.0E-39
sp|Q21SF0|EFTU1_RHOFT Elongation factor Tu 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tuf1 PE=3 SV=1 30 450 4.0E-39
sp|A0PM42|EFTU_MYCUA Elongation factor Tu OS=Mycobacterium ulcerans (strain Agy99) GN=tuf PE=3 SV=1 71 452 5.0E-39
sp|B2HSL3|EFTU_MYCMM Elongation factor Tu OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=tuf PE=3 SV=1 71 452 5.0E-39
sp|Q1R7U0|CYSN_ECOUT Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain UTI89 / UPEC) GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|Q8FEJ1|CYSN_ECOL6 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|A1AEU5|CYSN_ECOK1 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O1:K1 / APEC GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|B7MKM5|CYSN_ECO45 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|Q3YYB1|CYSN_SHISS Sulfate adenylyltransferase subunit 1 OS=Shigella sonnei (strain Ss046) GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|B1LQ72|CYSN_ECOSM Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|P23845|CYSN_ECOLI Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12) GN=cysN PE=1 SV=1 68 445 5.0E-39
sp|Q0TEA7|CYSN_ECOL5 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|B1XCS7|CYSN_ECODH Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / DH10B) GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|C4ZZQ5|CYSN_ECOBW Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|B7MZ52|CYSN_ECO81 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O81 (strain ED1a) GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|B7NT95|CYSN_ECO7I Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cysN PE=3 SV=1 68 445 5.0E-39
sp|Q1MIE3|EFTU_RHIL3 Elongation factor Tu OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tuf1 PE=3 SV=1 31 450 5.0E-39
sp|A8A3N0|CYSN_ECOHS Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O9:H4 (strain HS) GN=cysN PE=3 SV=1 68 445 6.0E-39
sp|B7UHH0|CYSN_ECO27 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cysN PE=3 SV=1 65 445 6.0E-39
sp|B7IHU4|EFTU_THEAB Elongation factor Tu OS=Thermosipho africanus (strain TCF52B) GN=tuf PE=3 SV=1 30 450 6.0E-39
sp|B5Z3B3|CYSN_ECO5E Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cysN PE=3 SV=1 68 445 6.0E-39
sp|Q8X7X7|CYSN_ECO57 Sulfate adenylyltransferase subunit 1 OS=Escherichia coli O157:H7 GN=cysN PE=3 SV=1 68 445 6.0E-39
sp|Q7UMW2|CYSNC_RHOBA Bifunctional enzyme CysN/CysC OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=cysNC PE=3 SV=1 63 362 6.0E-39
sp|Q32CH9|CYSN_SHIDS Sulfate adenylyltransferase subunit 1 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysN PE=3 SV=1 68 445 7.0E-39
sp|B2VG01|CYSN_ERWT9 Sulfate adenylyltransferase subunit 1 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cysN PE=3 SV=1 65 445 7.0E-39
sp|A9BHA7|EFTU_PETMO Elongation factor Tu OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=tuf PE=3 SV=1 61 450 8.0E-39
sp|Q9MUP0|EFTU_MESVI Elongation factor Tu, chloroplastic OS=Mesostigma viride GN=tufA PE=3 SV=1 30 450 8.0E-39
sp|P56292|EFTU_CHLVU Elongation factor Tu, chloroplastic OS=Chlorella vulgaris GN=tufA PE=3 SV=1 30 450 8.0E-39
sp|Q3J8Q0|EFTU_NITOC Elongation factor Tu OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tuf1 PE=3 SV=1 31 450 9.0E-39
sp|A8EWR6|CYSN_ARCB4 Sulfate adenylyltransferase subunit 1 OS=Arcobacter butzleri (strain RM4018) GN=cysN PE=3 SV=1 62 449 9.0E-39
sp|Q605B0|EFTU_METCA Elongation factor Tu OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tuf1 PE=3 SV=1 30 450 9.0E-39
sp|O50340|EFTU_FERIS Elongation factor Tu OS=Fervidobacterium islandicum GN=tuf PE=3 SV=1 70 450 9.0E-39
sp|C5BSJ5|CYSN_TERTT Sulfate adenylyltransferase subunit 1 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=cysN PE=3 SV=1 68 445 1.0E-38
sp|Q2EEV7|EFTU_HELSJ Elongation factor Tu, plastid OS=Helicosporidium sp. subsp. Simulium jonesii GN=tufA PE=3 SV=2 30 447 1.0E-38
sp|Q211E6|EFTU_RHOPB Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisB18) GN=tuf PE=3 SV=1 31 450 1.0E-38
sp|P9WNM5|CYSNC_MYCTU Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysNC PE=1 SV=1 61 447 1.0E-38
sp|P9WNM4|CYSNC_MYCTO Bifunctional enzyme CysN/CysC OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysNC PE=3 SV=1 61 447 1.0E-38
sp|Q2RFP5|EFTU_MOOTA Elongation factor Tu OS=Moorella thermoacetica (strain ATCC 39073) GN=tuf PE=3 SV=1 30 450 1.0E-38
sp|P02991|EFTU_EUGGR Elongation factor Tu, chloroplastic OS=Euglena gracilis GN=tufA PE=1 SV=1 30 450 1.0E-38
sp|Q8KTA3|EFTU_RICRH Elongation factor Tu OS=Rickettsia rhipicephali GN=tuf PE=3 SV=1 31 451 1.0E-38
sp|Q1BDD3|EFTU_MYCSS Elongation factor Tu OS=Mycobacterium sp. (strain MCS) GN=tuf PE=3 SV=1 71 452 1.0E-38
sp|A1UBL1|EFTU_MYCSK Elongation factor Tu OS=Mycobacterium sp. (strain KMS) GN=tuf PE=3 SV=1 71 452 1.0E-38
sp|A3PV96|EFTU_MYCSJ Elongation factor Tu OS=Mycobacterium sp. (strain JLS) GN=tuf PE=3 SV=1 71 452 1.0E-38
sp|Q67JU1|EFTU_SYMTH Elongation factor Tu OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tuf PE=3 SV=1 30 452 1.0E-38
sp|A7HM54|EFTU_FERNB Elongation factor Tu OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tuf PE=3 SV=1 70 450 2.0E-38
sp|A4FPM7|EFTU_SACEN Elongation factor Tu OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tuf PE=3 SV=1 31 452 2.0E-38
sp|Q04B37|EFTU_LACDB Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tuf PE=3 SV=1 40 451 2.0E-38
sp|Q1GAQ0|EFTU_LACDA Elongation factor Tu OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tuf PE=3 SV=1 40 451 2.0E-38
sp|A6Q1L5|EFTU_NITSB Elongation factor Tu OS=Nitratiruptor sp. (strain SB155-2) GN=tuf PE=3 SV=1 36 450 2.0E-38
sp|B5RDQ7|CYSN_SALG2 Sulfate adenylyltransferase subunit 1 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cysN PE=3 SV=1 65 452 2.0E-38
sp|A7GZK6|EFTU_CAMC5 Elongation factor Tu OS=Campylobacter curvus (strain 525.92) GN=tuf PE=3 SV=1 71 450 2.0E-38
sp|Q2JUX4|EFTU_SYNJA Elongation factor Tu OS=Synechococcus sp. (strain JA-3-3Ab) GN=tuf PE=3 SV=1 31 452 2.0E-38
sp|Q20EU5|EFTU_OLTVI Elongation factor Tu, chloroplastic OS=Oltmannsiellopsis viridis GN=tufA PE=3 SV=1 30 450 2.0E-38
sp|C5C0J3|EFTU_BEUC1 Elongation factor Tu OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=tuf PE=3 SV=1 71 357 2.0E-38
sp|A8HTW6|EFTU_AZOC5 Elongation factor Tu OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=tuf1 PE=3 SV=1 31 450 2.0E-38
sp|C4LL63|EFTU_CORK4 Elongation factor Tu OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=tuf PE=3 SV=1 71 452 2.0E-38
sp|A1JJT0|CYSN_YERE8 Sulfate adenylyltransferase subunit 1 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=cysN PE=3 SV=1 68 445 2.0E-38
sp|A6LPP6|EFTU_CLOB8 Elongation factor Tu OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tuf1 PE=3 SV=1 31 450 2.0E-38
sp|Q2IXR2|EFTU_RHOP2 Elongation factor Tu OS=Rhodopseudomonas palustris (strain HaA2) GN=tuf1 PE=3 SV=1 31 450 3.0E-38
sp|Q0T1I2|CYSN_SHIF8 Sulfate adenylyltransferase subunit 1 OS=Shigella flexneri serotype 5b (strain 8401) GN=cysN PE=3 SV=1 68 445 3.0E-38
sp|Q6FZC0|EFTU1_BARQU Elongation factor Tu 1 OS=Bartonella quintana (strain Toulouse) GN=tuf1 PE=3 SV=1 31 450 3.0E-38
sp|A4SCQ7|EFTU_CHLPM Elongation factor Tu OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=tuf PE=3 SV=1 40 451 3.0E-38
sp|P17746|EFTU_CHLRE Elongation factor Tu, chloroplastic OS=Chlamydomonas reinhardtii GN=tufA PE=3 SV=1 31 450 3.0E-38
sp|B2G6R2|EFTU_LACRJ Elongation factor Tu OS=Lactobacillus reuteri (strain JCM 1112) GN=tuf PE=3 SV=1 30 450 3.0E-38
sp|A5VJ92|EFTU_LACRD Elongation factor Tu OS=Lactobacillus reuteri (strain DSM 20016) GN=tuf PE=3 SV=1 30 450 3.0E-38
sp|Q1QUF9|CYSN_CHRSD Sulfate adenylyltransferase subunit 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=cysN PE=3 SV=1 68 445 3.0E-38
sp|Q06SH3|EFTU_STIHE Elongation factor Tu, chloroplastic OS=Stigeoclonium helveticum GN=tufA PE=3 SV=1 31 450 3.0E-38
sp|B5FTS9|CYSN_SALDC Sulfate adenylyltransferase subunit 1 OS=Salmonella dublin (strain CT_02021853) GN=cysN PE=3 SV=1 65 452 3.0E-38
sp|B5QW22|CYSN_SALEP Sulfate adenylyltransferase subunit 1 OS=Salmonella enteritidis PT4 (strain P125109) GN=cysN PE=3 SV=1 65 452 3.0E-38
sp|B4SBU5|EFTU_PELPB Elongation factor Tu OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=tuf PE=3 SV=1 40 450 3.0E-38
sp|Q83JX8|CYSN_SHIFL Sulfate adenylyltransferase subunit 1 OS=Shigella flexneri GN=cysN PE=3 SV=1 68 445 3.0E-38
sp|B3WE38|EFTU_LACCB Elongation factor Tu OS=Lactobacillus casei (strain BL23) GN=tuf PE=3 SV=1 30 450 3.0E-38
sp|Q039K9|EFTU_LACC3 Elongation factor Tu OS=Lactobacillus casei (strain ATCC 334) GN=tuf PE=3 SV=1 30 450 3.0E-38
sp|Q6FZL2|EFTU2_BARQU Elongation factor Tu 2 OS=Bartonella quintana (strain Toulouse) GN=tuf2 PE=3 SV=1 31 450 3.0E-38
sp|Q07KJ2|EFTU_RHOP5 Elongation factor Tu OS=Rhodopseudomonas palustris (strain BisA53) GN=tuf1 PE=3 SV=1 31 450 3.0E-38
sp|C0Q9Y7|EFTU_DESAH Elongation factor Tu OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=tuf PE=3 SV=1 30 450 4.0E-38
sp|B2GIL2|EFTU_KOCRD Elongation factor Tu OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=tuf PE=3 SV=1 31 452 4.0E-38
sp|A5EX84|EFTU_DICNV Elongation factor Tu OS=Dichelobacter nodosus (strain VCS1703A) GN=tuf PE=3 SV=1 30 450 4.0E-38
sp|B4TTW5|CYSN_SALSV Sulfate adenylyltransferase subunit 1 OS=Salmonella schwarzengrund (strain CVM19633) GN=cysN PE=3 SV=1 65 452 4.0E-38
sp|B5F415|CYSN_SALA4 Sulfate adenylyltransferase subunit 1 OS=Salmonella agona (strain SL483) GN=cysN PE=3 SV=1 65 452 4.0E-38
sp|A9N2D8|CYSN_SALPB Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cysN PE=3 SV=1 68 452 4.0E-38
sp|Q9TKZ5|EFTU_NEPOL Elongation factor Tu, chloroplastic OS=Nephroselmis olivacea GN=tufA PE=3 SV=1 30 450 4.0E-38
sp|A5FIJ9|EFTU_FLAJ1 Elongation factor Tu OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=tuf PE=3 SV=1 30 450 4.0E-38
sp|Q2W2H3|EFTU_MAGSA Elongation factor Tu OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=tuf1 PE=3 SV=1 31 452 4.0E-38
sp|Q6A6L7|EFTU_PROAC Elongation factor Tu OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tuf PE=3 SV=1 71 452 4.0E-38
sp|B9K884|EFTU_THENN Elongation factor Tu OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tuf PE=3 SV=1 71 450 5.0E-38
sp|B2GBC2|EFTU_LACF3 Elongation factor Tu OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=tuf PE=3 SV=1 30 450 5.0E-38
sp|A1R8U9|EFTU_ARTAT Elongation factor Tu OS=Arthrobacter aurescens (strain TC1) GN=tuf PE=3 SV=1 71 452 5.0E-38
sp|C0PXB1|CYSN_SALPC Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi C (strain RKS4594) GN=cysN PE=3 SV=1 68 452 5.0E-38
sp|Q57KJ0|CYSN_SALCH Sulfate adenylyltransferase subunit 1 OS=Salmonella choleraesuis (strain SC-B67) GN=cysN PE=3 SV=1 68 452 5.0E-38
sp|Q1LI13|EFTU_CUPMC Elongation factor Tu OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=tuf1 PE=3 SV=1 30 450 5.0E-38
sp|B2TZI0|CYSN_SHIB3 Sulfate adenylyltransferase subunit 1 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cysN PE=3 SV=1 68 445 5.0E-38
sp|B7LWK4|CYSN_ESCF3 Sulfate adenylyltransferase subunit 1 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cysN PE=3 SV=1 68 445 5.0E-38
sp|A5GW14|EFTU_SYNR3 Elongation factor Tu OS=Synechococcus sp. (strain RCC307) GN=tuf PE=3 SV=1 30 450 5.0E-38
sp|B7JUP5|EFTU_CYAP8 Elongation factor Tu OS=Cyanothece sp. (strain PCC 8801) GN=tuf PE=3 SV=1 31 452 5.0E-38
sp|P09953|EFTU_MICLU Elongation factor Tu OS=Micrococcus luteus GN=tuf PE=3 SV=1 71 452 5.0E-38
sp|B5BEY8|CYSN_SALPK Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi A (strain AKU_12601) GN=cysN PE=3 SV=1 65 452 5.0E-38
sp|Q5PEH2|CYSN_SALPA Sulfate adenylyltransferase subunit 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cysN PE=3 SV=1 65 452 5.0E-38
sp|Q9ZT91|EFTM_ARATH Elongation factor Tu, mitochondrial OS=Arabidopsis thaliana GN=TUFA PE=1 SV=1 58 450 5.0E-38
sp|Q8ZMF5|CYSN_SALTY Sulfate adenylyltransferase subunit 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysN PE=3 SV=1 65 452 5.0E-38
sp|Q7N8L0|CYSN_PHOLL Sulfate adenylyltransferase subunit 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysN PE=3 SV=1 68 334 6.0E-38
sp|A0LIH6|EFTU_SYNFM Elongation factor Tu OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=tuf1 PE=3 SV=1 30 450 6.0E-38
sp|P42480|EFTU_HYMOC Elongation factor Tu OS=Hymenobacter ocellatus GN=tuf PE=3 SV=1 71 450 6.0E-38
sp|Q8KHX9|EFTU_BARHE Elongation factor Tu OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=tuf1 PE=3 SV=1 31 450 7.0E-38
sp|A7GK18|EFTU_BACCN Elongation factor Tu OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=tuf PE=3 SV=1 30 450 7.0E-38
sp|A6TWJ8|EFTU2_ALKMQ Elongation factor Tu 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=tuf2 PE=3 SV=2 70 450 7.0E-38
sp|A6TWI4|EFTU1_ALKMQ Elongation factor Tu 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=tuf1 PE=3 SV=1 70 450 8.0E-38
sp|B4TFX1|CYSN_SALHS Sulfate adenylyltransferase subunit 1 OS=Salmonella heidelberg (strain SL476) GN=cysN PE=3 SV=1 65 452 8.0E-38
sp|Q1RHL9|EFTU_RICBR Elongation factor Tu OS=Rickettsia bellii (strain RML369-C) GN=tuf PE=3 SV=1 31 450 9.0E-38
sp|A8GVB2|EFTU_RICB8 Elongation factor Tu OS=Rickettsia bellii (strain OSU 85-389) GN=tuf PE=3 SV=1 31 450 9.0E-38
sp|Q9P9Q9|EFTU_XYLFA Elongation factor Tu OS=Xylella fastidiosa (strain 9a5c) GN=tufA PE=1 SV=3 46 450 9.0E-38
sp|Q2NJ20|EFTU_AYWBP Elongation factor Tu OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=tuf PE=3 SV=1 46 445 9.0E-38
sp|B4S5M9|EFTU_PROA2 Elongation factor Tu OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=tuf PE=3 SV=1 30 450 1.0E-37
sp|Q46WC7|EFTU_CUPPJ Elongation factor Tu OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tuf1 PE=3 SV=1 30 450 1.0E-37
sp|O21245|EFTU_RECAM Elongation factor Tu, mitochondrial OS=Reclinomonas americana GN=TUFA PE=3 SV=1 30 450 1.0E-37
sp|Q3AMT6|EFTU_SYNSC Elongation factor Tu OS=Synechococcus sp. (strain CC9605) GN=tuf PE=3 SV=1 30 450 1.0E-37
sp|A2BT83|EFTU_PROMS Elongation factor Tu OS=Prochlorococcus marinus (strain AS9601) GN=tuf PE=3 SV=1 30 452 1.0E-37
sp|A2BYN4|EFTU_PROM5 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9515) GN=tuf PE=3 SV=1 30 450 1.0E-37
sp|Q39Y08|EFTU_GEOMG Elongation factor Tu OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=tuf1 PE=3 SV=1 31 450 1.0E-37
sp|Q46IW4|EFTU_PROMT Elongation factor Tu OS=Prochlorococcus marinus (strain NATL2A) GN=tuf PE=3 SV=1 30 450 1.0E-37
sp|Q6YQV8|EFTU_ONYPE Elongation factor Tu OS=Onion yellows phytoplasma (strain OY-M) GN=tuf PE=3 SV=1 30 445 1.0E-37
sp|Q6N4Q4|EFTU_RHOPA Elongation factor Tu OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=tuf1 PE=3 SV=1 31 450 1.0E-37
sp|Q0K5Z9|EFTU_CUPNH Elongation factor Tu OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tuf1 PE=3 SV=1 30 450 1.0E-37
sp|A0JZ88|EFTU_ARTS2 Elongation factor Tu OS=Arthrobacter sp. (strain FB24) GN=tuf PE=3 SV=1 71 452 1.0E-37
sp|Q1IX70|EFTU_DEIGD Elongation factor Tu OS=Deinococcus geothermalis (strain DSM 11300) GN=tuf1 PE=3 SV=1 71 450 1.0E-37
sp|B1IUS8|CYSN_ECOLC Sulfate adenylyltransferase subunit 1 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cysN PE=3 SV=1 68 445 1.0E-37
sp|A6GYU7|EFTU_FLAPJ Elongation factor Tu OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=tuf PE=3 SV=1 71 450 1.0E-37
sp|A7HWP7|EFTU_PARL1 Elongation factor Tu OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=tuf1 PE=3 SV=1 30 452 2.0E-37
sp|Q03F25|EFTU_PEDPA Elongation factor Tu OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=tuf PE=3 SV=1 30 451 2.0E-37
sp|Q877P8|EFTU_XYLFT Elongation factor Tu OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tufA PE=3 SV=2 46 450 2.0E-37
sp|Q1GP97|EFTU_SPHAL Elongation factor Tu OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=tuf PE=3 SV=1 31 452 2.0E-37
sp|Q4MYA4|EFTU_THEPA Elongation factor Tu, apicoplast OS=Theileria parva GN=tufA PE=3 SV=1 30 447 2.0E-37
sp|A4YSJ0|EFTU_BRASO Elongation factor Tu OS=Bradyrhizobium sp. (strain ORS278) GN=tuf PE=3 SV=1 31 450 2.0E-37
sp|A5ELM9|EFTU_BRASB Elongation factor Tu OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=tuf PE=3 SV=1 31 450 2.0E-37
sp|Q2NVM8|CYSN_SODGM Sulfate adenylyltransferase subunit 1 OS=Sodalis glossinidius (strain morsitans) GN=cysN PE=3 SV=1 68 445 2.0E-37
sp|B4T461|CYSN_SALNS Sulfate adenylyltransferase subunit 1 OS=Salmonella newport (strain SL254) GN=cysN PE=3 SV=1 65 452 2.0E-37
sp|A2C4U5|EFTU_PROM1 Elongation factor Tu OS=Prochlorococcus marinus (strain NATL1A) GN=tuf PE=3 SV=1 30 450 2.0E-37
sp|B8HD11|EFTU_ARTCA Elongation factor Tu OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=tuf PE=3 SV=1 71 452 2.0E-37
sp|Q8Z470|CYSN_SALTI Sulfate adenylyltransferase subunit 1 OS=Salmonella typhi GN=cysN PE=3 SV=1 65 452 2.0E-37
sp|Q11HA6|EFTU_CHESB Elongation factor Tu OS=Chelativorans sp. (strain BNC1) GN=tuf1 PE=3 SV=1 31 450 2.0E-37
sp|Q0SQC8|EFTU_CLOPS Elongation factor Tu OS=Clostridium perfringens (strain SM101 / Type A) GN=tuf1 PE=3 SV=1 31 450 2.0E-37
sp|Q8XFP8|EFTU_CLOPE Elongation factor Tu OS=Clostridium perfringens (strain 13 / Type A) GN=tufA PE=3 SV=1 31 450 2.0E-37
sp|Q0TMN0|EFTU_CLOP1 Elongation factor Tu OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=tuf1 PE=3 SV=1 31 450 2.0E-37
sp|P46280|EFTU2_SOYBN Elongation factor Tu, chloroplastic OS=Glycine max GN=TUFB1 PE=3 SV=1 6 450 3.0E-37
sp|Q981F7|EFTU_RHILO Elongation factor Tu OS=Rhizobium loti (strain MAFF303099) GN=tufA PE=3 SV=1 31 450 3.0E-37
sp|B2UQY9|EFTU_AKKM8 Elongation factor Tu OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=tuf PE=3 SV=1 30 450 3.0E-37
sp|B3PII1|CYSN_CELJU Sulfate adenylyltransferase subunit 1 OS=Cellvibrio japonicus (strain Ueda107) GN=cysN PE=3 SV=1 68 445 3.0E-37
sp|A8G708|EFTU_PROM2 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9215) GN=tuf PE=3 SV=1 30 452 3.0E-37
sp|Q0AUG3|EFTU2_SYNWW Elongation factor Tu 2 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tuf2 PE=3 SV=1 31 452 3.0E-37
sp|A3PEZ7|EFTU_PROM0 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9301) GN=tuf PE=3 SV=1 30 452 3.0E-37
sp|Q318N5|EFTU_PROM9 Elongation factor Tu OS=Prochlorococcus marinus (strain MIT 9312) GN=tuf PE=3 SV=1 30 452 3.0E-37
sp|Q7UZY7|EFTU_PROMP Elongation factor Tu OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=tuf PE=3 SV=1 30 450 3.0E-37
sp|Q2JFH8|EFTU_FRASC Elongation factor Tu OS=Frankia sp. (strain CcI3) GN=tuf PE=3 SV=1 30 452 4.0E-37
sp|B9KFF9|EFTU_CAMLR Elongation factor Tu OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=tuf PE=3 SV=1 36 452 4.0E-37
sp|A1A0T1|EFTU_BIFAA Elongation factor Tu OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=tuf PE=3 SV=1 30 450 4.0E-37
sp|Q2SU25|EFTU_BURTA Elongation factor Tu OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tuf1 PE=3 SV=1 30 450 4.0E-37
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0016462 pyrophosphatase activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006950
MHDKHLHFSLALTTTSLYLSLHLHSPKPLQKWERKKPTLTLSLSATSTPASLPLLEAAELGKGSFKYAWVLDKLK
AERERGITIDIALWKFETPKFMVTVIDAPGHRDFIKNMITGTSQADCAILIIAGGTGEFEAGISKDGQTREHALL
AFTLGVRQLIVAVNKMDTTKWSEDRFNEIIKETSTFIKKVGYNPKTVAFVPISGWHGDNMLEESANMPWYKGWTK
ETKGGVTKGKTLLDAIDAIEPPVRPSDKPLRLPLQDVYKIGGIGTVPVGRVETGIIKAGMVVTFAPSNVTTEVKS
VEMHHEQLEQGSPGDNVGFNVKNVSVKDIRRGNVASDSKNDPAKEAASFNAQVIVLNHPGQIGAGYAPVLDCHTA
HIACKFAELKEKIDRRTGKSLEDNPKFVKSGDAAIVKLIPSKPMCVESYNEYPPLGRFAVRDMRQTVAVGIIKSV
DKTDKSGGKVTKSAEKAAKKK*
Coding >AgabiH97|006950
ATGCATGACAAACACCTCCACTTTTCTCTTGCTCTTACCACCACCTCCCTTTATCTCTCTCTCCATCTCCACTCA
CCTAAACCTCTTCAAAAATGGGAAAGGAAAAAACCCACGTTAACGTTGTCGTTATCGGCCACGTCGACTCCGGCA
AGTCTACCACTACTGGAAGCTGCTGAGCTCGGCAAAGGCTCCTTCAAATATGCCTGGGTGCTCGATAAGCTGAAA
GCTGAGCGTGAGCGTGGTATCACCATTGATATTGCGCTCTGGAAGTTCGAGACTCCCAAGTTCATGGTTACTGTC
ATTGATGCCCCTGGACACCGTGACTTCATCAAAAACATGATTACCGGTACTTCCCAGGCCGACTGTGCTATTCTA
ATCATCGCCGGTGGTACTGGTGAATTCGAGGCTGGTATCTCCAAGGATGGTCAGACTCGCGAGCACGCTCTCCTT
GCCTTCACTCTTGGTGTCCGTCAACTCATTGTTGCCGTCAACAAGATGGACACAACCAAGTGGAGTGAGGACCGC
TTCAATGAAATCATCAAGGAAACCTCCACCTTCATCAAGAAGGTCGGCTACAACCCCAAGACCGTTGCCTTCGTC
CCCATCTCAGGATGGCACGGTGATAACATGTTGGAGGAATCCGCCAACATGCCATGGTACAAGGGCTGGACCAAG
GAAACCAAGGGTGGTGTCACTAAGGGCAAGACTCTTCTTGATGCTATCGATGCTATCGAGCCCCCCGTCCGTCCC
TCCGACAAGCCCCTTCGTCTCCCCCTCCAGGATGTTTACAAGATCGGTGGTATCGGTACGGTGCCCGTTGGTCGT
GTTGAGACTGGTATTATCAAGGCCGGCATGGTTGTCACATTTGCGCCTTCGAACGTCACTACTGAAGTGAAGTCC
GTTGAAATGCACCACGAGCAGCTCGAACAAGGTTCCCCTGGTGACAATGTTGGTTTCAACGTCAAGAACGTTTCC
GTCAAGGATATTCGACGTGGAAACGTCGCTTCTGATTCCAAGAACGACCCCGCCAAGGAGGCTGCCTCGTTCAAC
GCCCAAGTCATCGTCCTCAATCACCCCGGTCAGATTGGTGCTGGTTACGCACCCGTCCTCGATTGCCACACCGCC
CACATTGCCTGCAAGTTCGCCGAACTCAAGGAGAAGATTGATCGCCGAACTGGCAAGTCCCTCGAAGACAACCCA
AAATTCGTCAAATCCGGTGATGCCGCCATTGTCAAGCTTATTCCCAGCAAGCCCATGTGTGTTGAATCCTACAAC
GAGTATCCACCTCTTGGTCGTTTCGCCGTCCGTGACATGAGGCAGACAGTTGCCGTCGGAATCATCAAGTCTGTC
GATAAGACTGACAAGTCGGGTGGAAAGGTGACAAAATCCGCTGAGAAGGCTGCCAAGAAGAAATAA
Transcript >AgabiH97|006950
ATGCATGACAAACACCTCCACTTTTCTCTTGCTCTTACCACCACCTCCCTTTATCTCTCTCTCCATCTCCACTCA
CCTAAACCTCTTCAAAAATGGGAAAGGAAAAAACCCACGTTAACGTTGTCGTTATCGGCCACGTCGACTCCGGCA
AGTCTACCACTACTGGAAGCTGCTGAGCTCGGCAAAGGCTCCTTCAAATATGCCTGGGTGCTCGATAAGCTGAAA
GCTGAGCGTGAGCGTGGTATCACCATTGATATTGCGCTCTGGAAGTTCGAGACTCCCAAGTTCATGGTTACTGTC
ATTGATGCCCCTGGACACCGTGACTTCATCAAAAACATGATTACCGGTACTTCCCAGGCCGACTGTGCTATTCTA
ATCATCGCCGGTGGTACTGGTGAATTCGAGGCTGGTATCTCCAAGGATGGTCAGACTCGCGAGCACGCTCTCCTT
GCCTTCACTCTTGGTGTCCGTCAACTCATTGTTGCCGTCAACAAGATGGACACAACCAAGTGGAGTGAGGACCGC
TTCAATGAAATCATCAAGGAAACCTCCACCTTCATCAAGAAGGTCGGCTACAACCCCAAGACCGTTGCCTTCGTC
CCCATCTCAGGATGGCACGGTGATAACATGTTGGAGGAATCCGCCAACATGCCATGGTACAAGGGCTGGACCAAG
GAAACCAAGGGTGGTGTCACTAAGGGCAAGACTCTTCTTGATGCTATCGATGCTATCGAGCCCCCCGTCCGTCCC
TCCGACAAGCCCCTTCGTCTCCCCCTCCAGGATGTTTACAAGATCGGTGGTATCGGTACGGTGCCCGTTGGTCGT
GTTGAGACTGGTATTATCAAGGCCGGCATGGTTGTCACATTTGCGCCTTCGAACGTCACTACTGAAGTGAAGTCC
GTTGAAATGCACCACGAGCAGCTCGAACAAGGTTCCCCTGGTGACAATGTTGGTTTCAACGTCAAGAACGTTTCC
GTCAAGGATATTCGACGTGGAAACGTCGCTTCTGATTCCAAGAACGACCCCGCCAAGGAGGCTGCCTCGTTCAAC
GCCCAAGTCATCGTCCTCAATCACCCCGGTCAGATTGGTGCTGGTTACGCACCCGTCCTCGATTGCCACACCGCC
CACATTGCCTGCAAGTTCGCCGAACTCAAGGAGAAGATTGATCGCCGAACTGGCAAGTCCCTCGAAGACAACCCA
AAATTCGTCAAATCCGGTGATGCCGCCATTGTCAAGCTTATTCCCAGCAAGCCCATGTGTGTTGAATCCTACAAC
GAGTATCCACCTCTTGGTCGTTTCGCCGTCCGTGACATGAGGCAGACAGTTGCCGTCGGAATCATCAAGTCTGTC
GATAAGACTGACAAGTCGGGTGGAAAGGTGACAAAATCCGCTGAGAAGGCTGCCAAGAAGAAATAA
Gene >AgabiH97|006950
ATGCATGTCTGTTCGTCTTGCTCTGATTGGGCGTCGGAAGGGCCGAGTGGGCCCGGTGCCGGTTCCGGTGCCGAG
AGTAGGGCGGAGGGGAGTCACGATGAGAAAGATCACGCACTGTTTTATCAGCCATCTATCGATAAAAAAAAAATT
TGCCCGTTGCAGTATAACTAGGACAAACACCTCCACTTTTCTCTTGCTCTTACCACCACCTCCCTTTATCTCTCT
CTCCATCTCCACTCACCTAAGTAAGTCTTCCGATCTATAATACGTTTCCCCGGCGTATCCAGCGATCGTCAATGG
ATCTAACCACCCTCGCCCGGATGGATATGACTTTAACTGCCCTTTTTTCCCTCCCATCATATCCGATATCGCATA
TTGACCACCAATTTTACAGACCTCTTCAAAAATGGGAAAGGAAAAAACCCACGTTAACGTTGTCGGTGGGTGTTG
GCTCACATTCCTTATCTCGTTCATCGCCTCATACGTTATCAGTTATCGGCCACGTCGACTCCGGCAAGTCTACCA
CTACTGGTCACTTGATCTACAAGTGTGGTGGTATCGATAAGCGTACCATTGAAAAATTCGAGAAGGAAGCTGCTG
AGCTCGGCAAAGGCTCCTTCAAATATGGTGAGCAAGTACGGTCCAGTCTGCAGCATCCATGAAATAACTCGTTTC
ACAGCCTGGGTGCTCGATAAGCTGAAAGCTGAGCGTGAGCGTGGTATCACCATTGATATTGCGCTCTGGAAGTTC
GAGACTCCCAAGTTCATGGTTACTGTATGCTATCTGTTTGACGTGTTTCGCTATTTTTTAATCTAATCTATGCGC
ACACCTTTAGGTCATTGATGCCCCTGGACACCGTGACTTCATCAAAAACATGATTACCGGTACTTCCCAGGCCGA
CTGTGCTATTCTAATCATCGCCGGTGGTACTGGTGAATTCGAGGCTGGTATCTCCAAGGATGGTCAGACTCGCGA
GCACGCTCTCCTTGCCTTCACTCTTGGTGTCCGTCAACTCATTGTTGCCGTCAACAAGATGGACACAACCAAGGT
TTGATCAAAAATTTGTTACTCCTCAATGATTACTTACAATTTGAACAGTGGAGTGAGGACCGCTTCAATGAAATC
ATCAAGGAAACCTCCACCTTCATCAAGAAGGTCGGCTACAACCCCAAGACCGTTGCCTTCGTCCCCATCTCAGGA
TGGCACGGTGATAACATGTTGGAGGAATCCGCCAAGTAAGTGCATCCGAAACATTAGATTACCTAAAGTTCTCAA
CGACAATGTTTAGCATGCCATGGTACAAGGGCTGGACCAAGGAAACCAAGGGTGGTGTCACTAAGGGCAAGACTC
TTCTTGATGCTATCGATGCTATCGAGCCCCCCGTCCGTCCCTCCGACAAGCCCCTTCGTCTCCCCCTCCAGGATG
TTTACAAGATCGGTGGTATCGGTACGGTGCCCGTTGGTCGTGTTGAGACTGGTATTATCAAGGCCGGCATGGTTG
TCACATTTGCGCCTTCGAACGTCACTACTGAAGTGAAGTCCGTTGAAATGCACCACGAGCAGCTCGAACAAGGTT
CCCCTGGTGACAATGTTGGTTTCAACGTCAAGTACGCATTGTGATAGACATTTTGTGTGCTTGCACGATCTCACA
TTGTTCTCTAGGAACGTTTCCGTCAAGGATATTCGACGTGGAAACGTCGCTTCTGATTCCAAGAACGACCCCGCC
AAGGAGGCTGCCTCGTTCAACGCCCAAGTCATCGTCCTCAATCACCCCGGTCAGATTGGTGCTGGTTACGCACCC
GTCCTCGATTGCCACACCGCCCACATTGCCTGCAAGTTCGCCGAACTCAAGGAGAAGATTGATCGCCGAACTGGC
AAGTCCCTCGAAGACAACCCAAAATTCGTCAAATCCGGTGATGCCGCCATTGTCAAGCTTATTCCCAGCAAGCCC
ATGTGTGTTGGTGAGTGATAGATTGTTGAATTCTTGAGATCTTGTTTTCACATGATTGGCAGAATCCTACAACGA
GTATCCACCTCTTGGTCGTTTCGCCGTCCGTGACATGAGGCAGACAGTTGCCGTCGGAATCATCAAGTCTGTCGA
TAAGACTGACAAGTCGGGTGGAAAGGGTTCGTATTTGCTACCTCCAAATTTGCAGACATACTCAAAATCTTTTCA
ATGCAGTGACAAAATCCGCTGAGAAGGCTGCCAAGAAGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail