Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006910
Gene name
Locationscaffold_1:1669481..1670686
Strand+
Gene length (bp)1205
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 1.6E-12 6 95

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53929|YNK8_YEAST Uncharacterized protein YNL108C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNL108C PE=1 SV=1 1 124 4.0E-23
sp|Q12415|TFC7_YEAST Transcription factor tau 55 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFC7 PE=1 SV=1 1 126 8.0E-21

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006910
MPLEKIYIARHGFRLSWFTNVWQSPTGLARDPPLAAYGEFQAKELAHYFSSLPEDEKPTAIFSSPYYRCLQTALP
VAQTLGLPLLVEHGLSEFYCPIIPGTGLHPRPSSATSLKSFIAEIDPEWSSLWCSYPKSNKRMRGSIRTSCWELP
LRIGCCSLTELVPKVQDSTGATQEVLGAWEAKKLADGKHLEDGAMRDWGFEDLEIEAGKVIEEPGVPGTETHIEG
PSGAQTAHSML*
Coding >AgabiH97|006910
ATGCCGCTTGAGAAAATATACATCGCTCGTCATGGCTTCCGACTCAGTTGGTTCACCAATGTCTGGCAAAGCCCT
ACTGGACTTGCGCGCGATCCACCCCTAGCAGCATACGGTGAATTTCAGGCTAAAGAACTCGCGCACTATTTTTCA
AGTTTACCCGAGGATGAAAAGCCCACTGCCATCTTTTCCTCACCTTATTATCGATGTTTACAAACGGCTCTACCG
GTGGCACAAACCCTAGGTCTCCCTTTACTTGTCGAACACGGTTTATCCGAATTCTATTGCCCCATTATACCAGGA
ACAGGTCTCCATCCCCGTCCCAGTTCAGCCACCTCCCTCAAATCCTTCATCGCAGAGATCGATCCAGAATGGTCA
TCCCTCTGGTGTTCATACCCCAAATCGAACAAACGTATGCGGGGAAGCATACGAACATCCTGTTGGGAACTCCCT
TTACGAATTGGCTGTTGCTCCTTGACTGAACTGGTGCCCAAAGTTCAGGATAGCACCGGTGCTACGCAAGAGGTA
CTCGGTGCTTGGGAGGCAAAGAAGCTCGCAGATGGAAAGCATTTGGAAGATGGTGCTATGAGGGATTGGGGCTTT
GAAGATCTCGAAATCGAGGCTGGAAAGGTCATCGAAGAGCCCGGAGTCCCCGGTACCGAAACCCACATAGAAGGC
CCCTCAGGCGCTCAAACGGCTCATAGCATGCTGTAG
Transcript >AgabiH97|006910
ATGCCGCTTGAGAAAATATACATCGCTCGTCATGGCTTCCGACTCAGTTGGTTCACCAATGTCTGGCAAAGCCCT
ACTGGACTTGCGCGCGATCCACCCCTAGCAGCATACGGTGAATTTCAGGCTAAAGAACTCGCGCACTATTTTTCA
AGTTTACCCGAGGATGAAAAGCCCACTGCCATCTTTTCCTCACCTTATTATCGATGTTTACAAACGGCTCTACCG
GTGGCACAAACCCTAGGTCTCCCTTTACTTGTCGAACACGGTTTATCCGAATTCTATTGCCCCATTATACCAGGA
ACAGGTCTCCATCCCCGTCCCAGTTCAGCCACCTCCCTCAAATCCTTCATCGCAGAGATCGATCCAGAATGGTCA
TCCCTCTGGTGTTCATACCCCAAATCGAACAAACGTATGCGGGGAAGCATACGAACATCCTGTTGGGAACTCCCT
TTACGAATTGGCTGTTGCTCCTTGACTGAACTGGTGCCCAAAGTTCAGGATAGCACCGGTGCTACGCAAGAGGTA
CTCGGTGCTTGGGAGGCAAAGAAGCTCGCAGATGGAAAGCATTTGGAAGATGGTGCTATGAGGGATTGGGGCTTT
GAAGATCTCGAAATCGAGGCTGGAAAGGTCATCGAAGAGCCCGGAGTCCCCGGTACCGAAACCCACATAGAAGGC
CCCTCAGGCGCTCAAACGGCTCATAGCATGCTGTAG
Gene >AgabiH97|006910
ATGCCGCTTGAGAAAATATACATCGCTCGTCATGGCAAGGAATTTTCGATTCTCAAATTTTTTTATCGCACTCAC
TCATCTATAGGCTTCCGACTCAGTTGGTTCACCAATGTCTGGCAAGTAGATCCCTGATCGGTACTCAGACTTGAC
TCATAACACTACCCTTGTAGGAAGAGCCCTACTGGACTTGCGCGCGATCCACCCCTAGCAGCATACGGTGAAGTA
ACTTATCAGATCTTTACGTTAGATCTTTTCCCTCCCTGACAAAGGGTTCTCCCTTTCGCATCAGTTTCAGGCTAA
AGAACTCGCGCACTATTTTTCAAGTTTACCCGAGGATGAAAAGCCCACTGCCATCTTTTCCTCACCTTATTGTAA
ATAAAGAAAAATTCTCACAAGAGAACGAACGATCTTCTTAAAAACTTTTTTTATAGATCGATGTTTACAAACGGC
TCTACCGGTGGCACAAACCCTAGGTCTCCCTTTACTTGTCGAACACGGTTCGTCTAGCCTTTTGATCATTTTTTA
AGAAAACCCTGGTTTTTGATTGACACATTTACTTAACACCGTCTGGAAATATATCAAAAGGTTTATCCGAATTCT
ATTGCCCCATTATACCAGGAACAGGTCTCCATCCCCGTCCCAGTTCAGCCACCTCCCTCAAATCCTTCATCGCAG
AGATCGATCCAGAATGGTCATCCCTCTGGTACCCCTCTCAAAAGGGCGAAACCGTCTCGGAGGTCCATGACCGGA
CCGACGCCTTCCTCCAGGTGTTCATACCCCAAATCGAACAAACGTATGCGGGGAAGCATACGAACATCCTGTTGG
TCAGCCATGCTGCTACAGTGATCGCGCTCACGAGGTCGTTAATGGGAGATAGGGAACTCCCTTTACGAATTGGCT
GTTGCTCCTTGACTGAACTGGTGCCCAAAGTTCAGGATAGCACCGGTGCTACGCAAGAGGTACTCGGTGCTTGGG
AGGCAAAGAAGCTCGCAGATGGAAAGCATTTGGAAGATGGTGCTATGAGGGATTGGGGCTTTGAAGATCTCGAAA
TCGAGGCTGGAAAGGTTGGAAACATTTTTCAAGCCTAGAATCATGGTTAGCTGACCTTGGGATTTGGTCAGGTCA
TCGAAGAGCCCGGAGTCCCCGGTACCGAAACCCACATAGAAGGCCCCTCAGGCGCTCAAACGGCTCATAGCATGC
TGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail