Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006840
Gene name
Locationscaffold_1:1657101..1658375
Strand-
Gene length (bp)1274
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00189 Ribosomal_S3_C Ribosomal protein S3, C-terminal domain 1.6E-25 117 199
PF07650 KH_2 KH domain 9.9E-12 31 103

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P62909|RS3_RAT 40S ribosomal protein S3 OS=Rattus norvegicus GN=Rps3 PE=1 SV=1 12 248 5.0E-122
sp|P62908|RS3_MOUSE 40S ribosomal protein S3 OS=Mus musculus GN=Rps3 PE=1 SV=1 12 248 5.0E-122
sp|E2RH47|RS3_CANLF 40S ribosomal protein S3 OS=Canis lupus familiaris GN=RPS3 PE=1 SV=1 12 248 5.0E-122
sp|Q0Z8U2|RS3_PIG 40S ribosomal protein S3 OS=Sus scrofa GN=RPS3 PE=1 SV=1 12 248 6.0E-122
sp|P23396|RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 12 248 6.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P62909|RS3_RAT 40S ribosomal protein S3 OS=Rattus norvegicus GN=Rps3 PE=1 SV=1 12 248 5.0E-122
sp|P62908|RS3_MOUSE 40S ribosomal protein S3 OS=Mus musculus GN=Rps3 PE=1 SV=1 12 248 5.0E-122
sp|E2RH47|RS3_CANLF 40S ribosomal protein S3 OS=Canis lupus familiaris GN=RPS3 PE=1 SV=1 12 248 5.0E-122
sp|Q0Z8U2|RS3_PIG 40S ribosomal protein S3 OS=Sus scrofa GN=RPS3 PE=1 SV=1 12 248 6.0E-122
sp|P23396|RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 12 248 6.0E-122
sp|Q3T169|RS3_BOVIN 40S ribosomal protein S3 OS=Bos taurus GN=RPS3 PE=2 SV=1 12 248 6.0E-122
sp|P02350|RS31_XENLA 40S ribosomal protein S3-A OS=Xenopus laevis GN=rps3-a PE=2 SV=2 12 238 1.0E-121
sp|Q9SIP7|RS31_ARATH 40S ribosomal protein S3-1 OS=Arabidopsis thaliana GN=RPS3A PE=1 SV=1 12 257 1.0E-121
sp|Q5R465|RS3_PONAB 40S ribosomal protein S3 OS=Pongo abelii GN=RPS3 PE=2 SV=1 12 248 2.0E-121
sp|P47835|RS32_XENLA 40S ribosomal protein S3-B OS=Xenopus laevis GN=rps3-b PE=2 SV=1 12 238 5.0E-121
sp|P79891|RS3_AMBME 40S ribosomal protein S3 OS=Ambystoma mexicanum GN=RPS3 PE=2 SV=1 12 238 7.0E-121
sp|Q9FJA6|RS33_ARATH 40S ribosomal protein S3-3 OS=Arabidopsis thaliana GN=RPS3C PE=1 SV=1 12 254 1.0E-120
sp|Q90YS2|RS3_ICTPU 40S ribosomal protein S3 OS=Ictalurus punctatus GN=rps3 PE=2 SV=1 12 253 2.0E-120
sp|Q9M339|RS32_ARATH 40S ribosomal protein S3-2 OS=Arabidopsis thaliana GN=RPS3B PE=1 SV=1 12 224 5.0E-119
sp|O60128|RS3_SCHPO 40S ribosomal protein S3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps3 PE=1 SV=1 12 261 1.0E-118
sp|P48153|RS3_MANSE 40S ribosomal protein S3 OS=Manduca sexta GN=RpS3 PE=2 SV=1 15 250 2.0E-115
sp|Q06559|RS3_DROME 40S ribosomal protein S3 OS=Drosophila melanogaster GN=RpS3 PE=1 SV=1 16 242 3.0E-114
sp|P05750|RS3_YEAST 40S ribosomal protein S3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS3 PE=1 SV=5 12 240 9.0E-109
sp|P48152|RS3_CAEEL 40S ribosomal protein S3 OS=Caenorhabditis elegans GN=rps-3 PE=3 SV=1 13 250 1.0E-105
sp|P90526|RS3_DICDI 40S ribosomal protein S3 OS=Dictyostelium discoideum GN=rps3 PE=1 SV=1 13 223 4.0E-82
sp|Q8SQM3|RS3_ENCCU 40S ribosomal protein S3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPS3 PE=1 SV=2 21 224 1.0E-54
sp|Q46GA1|RS3_METBF 30S ribosomal protein S3 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps3 PE=3 SV=1 19 261 1.0E-35
sp|P20281|RS3_HALMA 30S ribosomal protein S3 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps3 PE=3 SV=2 16 223 3.0E-34
sp|Q3IMY2|RS3_NATPD 30S ribosomal protein S3 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps3 PE=3 SV=1 16 249 1.0E-33
sp|O59424|RS3_PYRHO 30S ribosomal protein S3 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps3 PE=3 SV=1 19 236 2.0E-33
sp|P54034|RS3_METJA 30S ribosomal protein S3 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps3 PE=3 SV=1 20 232 2.0E-32
sp|Q8PV44|RS3_METMA 30S ribosomal protein S3 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps3 PE=3 SV=1 19 234 6.0E-32
sp|A3CT03|RS3_METMJ 30S ribosomal protein S3 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps3 PE=3 SV=1 19 233 6.0E-32
sp|Q8TRU1|RS3_METAC 30S ribosomal protein S3 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps3 PE=3 SV=1 19 223 2.0E-31
sp|C5A280|RS3_THEGJ 30S ribosomal protein S3 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps3 PE=3 SV=1 20 217 2.0E-31
sp|Q18GF5|RS3_HALWD 30S ribosomal protein S3 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps3 PE=3 SV=1 16 267 4.0E-31
sp|Q5JDH5|RS3_THEKO 30S ribosomal protein S3 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps3 PE=3 SV=1 20 217 4.0E-31
sp|O26116|RS3_METTH 30S ribosomal protein S3 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps3 PE=3 SV=1 19 236 2.0E-30
sp|Q8U004|RS3_PYRFU 30S ribosomal protein S3 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps3 PE=1 SV=1 19 236 3.0E-30
sp|Q12ZU5|RS3_METBU 30S ribosomal protein S3 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps3 PE=3 SV=1 19 221 2.0E-29
sp|P15009|RS3_HALSA 30S ribosomal protein S3 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps3 PE=3 SV=3 16 223 4.0E-29
sp|A2SPK9|RS3_METLZ 30S ribosomal protein S3 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps3 PE=3 SV=1 16 221 4.0E-29
sp|A7I5P5|RS3_METB6 30S ribosomal protein S3 OS=Methanoregula boonei (strain 6A8) GN=rps3 PE=3 SV=1 19 200 7.0E-29
sp|Q9V1U1|RS3_PYRAB 30S ribosomal protein S3 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps3 PE=3 SV=1 19 236 9.0E-29
sp|B6YSL9|RS3_THEON 30S ribosomal protein S3 OS=Thermococcus onnurineus (strain NA1) GN=rps3 PE=3 SV=1 19 226 1.0E-28
sp|Q2NFW2|RS3_METST 30S ribosomal protein S3 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps3 PE=3 SV=1 19 229 2.0E-28
sp|C6A165|RS3_THESM 30S ribosomal protein S3 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rps3 PE=3 SV=1 19 232 2.0E-28
sp|Q0W1Y3|RS3_METAR 30S ribosomal protein S3 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps3 PE=3 SV=1 20 221 2.0E-28
sp|Q2FT39|RS3_METHJ 30S ribosomal protein S3 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps3 PE=3 SV=1 19 221 3.0E-28
sp|A4FWB6|RS3_METM5 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps3 PE=3 SV=1 20 229 8.0E-28
sp|A5UL83|RS3_METS3 30S ribosomal protein S3 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps3 PE=3 SV=1 19 224 1.0E-27
sp|A0B9W4|RS3_METTP 30S ribosomal protein S3 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps3 PE=3 SV=1 19 221 2.0E-27
sp|A6VGZ0|RS3_METM7 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps3 PE=3 SV=1 20 229 3.0E-27
sp|A9A9Q9|RS3_METM6 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps3 PE=3 SV=1 20 229 5.0E-27
sp|A6UWU3|RS3_META3 30S ribosomal protein S3 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps3 PE=3 SV=1 20 225 7.0E-27
sp|Q6LXE7|RS3_METMP 30S ribosomal protein S3 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps3 PE=3 SV=1 20 229 2.0E-25
sp|A1RXG6|RS3_THEPD 30S ribosomal protein S3 OS=Thermofilum pendens (strain Hrk 5) GN=rps3 PE=3 SV=2 17 221 1.0E-24
sp|A6UQ49|RS3_METVS 30S ribosomal protein S3 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps3 PE=3 SV=1 20 229 2.0E-24
sp|A8AA20|RS3_IGNH4 30S ribosomal protein S3 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps3 PE=3 SV=1 19 252 4.0E-23
sp|A2BMC5|RS3_HYPBU 30S ribosomal protein S3 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps3 PE=3 SV=1 19 214 3.0E-21
sp|O28360|RS3_ARCFU 30S ribosomal protein S3 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps3 PE=3 SV=1 19 237 3.0E-21
sp|Q9UXA0|RS3_SULSO 30S ribosomal protein S3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps3 PE=3 SV=1 19 212 5.0E-21
sp|Q6L1C1|RS3_PICTO 30S ribosomal protein S3 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps3 PE=3 SV=1 18 238 3.0E-20
sp|Q9YF78|RS3_AERPE 30S ribosomal protein S3 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps3 PE=3 SV=1 20 205 3.0E-20
sp|A3DNB3|RS3_STAMF 30S ribosomal protein S3 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps3 PE=3 SV=1 19 221 2.0E-19
sp|Q4JB46|RS3_SULAC 30S ribosomal protein S3 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps3 PE=3 SV=1 19 201 3.0E-19
sp|A3MTL3|RS3_PYRCJ 30S ribosomal protein S3 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps3 PE=3 SV=2 32 199 1.0E-18
sp|Q975I7|RS3_SULTO 30S ribosomal protein S3 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps3 PE=3 SV=1 19 201 5.0E-18
sp|A1RV98|RS3_PYRIL 30S ribosomal protein S3 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps3 PE=3 SV=1 32 199 1.0E-17
sp|Q8ZWI0|RS3_PYRAE 30S ribosomal protein S3 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps3 PE=3 SV=2 32 220 2.0E-17
sp|A4YCX2|RS3_METS5 30S ribosomal protein S3 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps3 PE=3 SV=1 19 201 2.0E-17
sp|A4WIY8|RS3_PYRAR 30S ribosomal protein S3 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps3 PE=3 SV=2 32 199 2.0E-16
sp|Q97BX1|RS3_THEVO 30S ribosomal protein S3 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps3 PE=3 SV=1 18 221 6.0E-16
sp|Q9HIR5|RS3_THEAC 30S ribosomal protein S3 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps3 PE=3 SV=1 18 221 2.0E-15
sp|Q8TX35|RS3_METKA 30S ribosomal protein S3 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps3 PE=3 SV=1 123 224 2.0E-13
sp|Q5NHW2|RS3_FRATT 30S ribosomal protein S3 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpsC PE=3 SV=1 31 213 2.0E-13
sp|Q14JB4|RS3_FRAT1 30S ribosomal protein S3 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpsC PE=3 SV=1 31 213 2.0E-13
sp|A0Q4I9|RS3_FRATN 30S ribosomal protein S3 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpsC PE=3 SV=1 31 213 5.0E-13
sp|A4IZS8|RS3_FRATW 30S ribosomal protein S3 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpsC PE=3 SV=1 31 213 6.0E-13
sp|Q0BNS1|RS3_FRATO 30S ribosomal protein S3 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpsC PE=3 SV=1 31 213 6.0E-13
sp|Q2A5G4|RS3_FRATH 30S ribosomal protein S3 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpsC PE=3 SV=1 31 213 6.0E-13
sp|A7N9T2|RS3_FRATF 30S ribosomal protein S3 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpsC PE=3 SV=1 31 213 6.0E-13
sp|B2SDX9|RS3_FRATM 30S ribosomal protein S3 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpsC PE=3 SV=1 31 213 8.0E-13
sp|A0RVX9|RS3_CENSY 30S ribosomal protein S3 OS=Cenarchaeum symbiosum (strain A) GN=rps3 PE=3 SV=1 31 192 8.0E-12
sp|B9L6M7|RS3_NAUPA 30S ribosomal protein S3 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpsC PE=3 SV=1 31 203 6.0E-11
sp|Q6KI49|RS3_MYCMO 30S ribosomal protein S3 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpsC PE=3 SV=1 51 208 6.0E-10
sp|Q7MPI2|RS3_VIBVY 30S ribosomal protein S3 OS=Vibrio vulnificus (strain YJ016) GN=rpsC PE=3 SV=1 25 228 3.0E-09
sp|Q8DE45|RS3_VIBVU 30S ribosomal protein S3 OS=Vibrio vulnificus (strain CMCP6) GN=rpsC PE=3 SV=1 25 228 3.0E-09
sp|A1B033|RS3_PARDP 30S ribosomal protein S3 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsC PE=3 SV=1 31 208 4.0E-09
sp|C3LRQ2|RS3_VIBCM 30S ribosomal protein S3 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsC PE=3 SV=1 25 228 7.0E-09
sp|Q9KNZ0|RS3_VIBCH 30S ribosomal protein S3 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsC PE=3 SV=1 25 228 7.0E-09
sp|A5F543|RS3_VIBC3 30S ribosomal protein S3 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsC PE=3 SV=1 25 228 7.0E-09
sp|Q7M8E0|RS3_WOLSU 30S ribosomal protein S3 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsC PE=3 SV=1 31 213 1.0E-08
sp|Q88XY0|RS3_LACPL 30S ribosomal protein S3 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsC PE=3 SV=1 21 202 2.0E-08
sp|A5VLJ9|RS3_LACRD 30S ribosomal protein S3 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsC PE=3 SV=1 21 202 2.0E-08
sp|O84527|RS3_CHLTR 30S ribosomal protein S3 OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpsC PE=3 SV=1 21 218 3.0E-08
sp|P80372|RS3_THET8 30S ribosomal protein S3 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpsC PE=1 SV=3 35 216 5.0E-08
sp|P62663|RS3_THET2 30S ribosomal protein S3 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpsC PE=1 SV=2 35 216 5.0E-08
sp|Q9HWE1|RS3_PSEAE 30S ribosomal protein S3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rpsC PE=3 SV=1 20 216 7.0E-08
sp|Q02T74|RS3_PSEAB 30S ribosomal protein S3 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rpsC PE=3 SV=1 20 216 7.0E-08
sp|A6UZJ4|RS3_PSEA7 30S ribosomal protein S3 OS=Pseudomonas aeruginosa (strain PA7) GN=rpsC PE=3 SV=1 20 216 7.0E-08
sp|Q0ANQ6|RS3_MARMM 30S ribosomal protein S3 OS=Maricaulis maris (strain MCS10) GN=rpsC PE=3 SV=1 54 208 8.0E-08
sp|A7N0I3|RS3_VIBCB 30S ribosomal protein S3 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsC PE=3 SV=1 25 228 9.0E-08
sp|B0BCG1|RS3_CHLTB 30S ribosomal protein S3 OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpsC PE=3 SV=1 21 218 1.0E-07
sp|B0B896|RS3_CHLT2 30S ribosomal protein S3 OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpsC PE=3 SV=1 21 218 1.0E-07
sp|Q65QW1|RS3_MANSM 30S ribosomal protein S3 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsC PE=3 SV=2 25 202 1.0E-07
sp|Q9PJM0|RS3_CHLMU 30S ribosomal protein S3 OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpsC PE=3 SV=1 32 218 1.0E-07
sp|B5FG15|RS3_VIBFM 30S ribosomal protein S3 OS=Vibrio fischeri (strain MJ11) GN=rpsC PE=3 SV=1 25 228 2.0E-07
sp|Q5E8A9|RS3_VIBF1 30S ribosomal protein S3 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsC PE=3 SV=1 25 228 2.0E-07
sp|Q4K539|RS3_PSEF5 30S ribosomal protein S3 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpsC PE=3 SV=1 22 216 2.0E-07
sp|B7VLF1|RS3_VIBTL 30S ribosomal protein S3 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsC PE=3 SV=1 25 228 2.0E-07
sp|Q1IFW0|RS3_PSEE4 30S ribosomal protein S3 OS=Pseudomonas entomophila (strain L48) GN=rpsC PE=3 SV=1 22 216 2.0E-07
sp|A1AVK6|RS3_RUTMC 30S ribosomal protein S3 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpsC PE=3 SV=1 4 202 2.0E-07
sp|Q88QM9|RS3_PSEPK 30S ribosomal protein S3 OS=Pseudomonas putida (strain KT2440) GN=rpsC PE=3 SV=2 22 216 2.0E-07
sp|A5VXQ3|RS3_PSEP1 30S ribosomal protein S3 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpsC PE=3 SV=1 22 216 2.0E-07
sp|Q6MJ20|RS3_BDEBA 30S ribosomal protein S3 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsC PE=3 SV=1 32 202 2.0E-07
sp|A4VHN6|RS3_PSEU5 30S ribosomal protein S3 OS=Pseudomonas stutzeri (strain A1501) GN=rpsC PE=3 SV=1 22 216 2.0E-07
sp|Q7NQF8|RS3_CHRVO 30S ribosomal protein S3 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rpsC PE=3 SV=1 31 209 2.0E-07
sp|Q87T07|RS3_VIBPA 30S ribosomal protein S3 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsC PE=3 SV=1 25 228 2.0E-07
sp|Q74L83|RS3_LACJO 30S ribosomal protein S3 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsC PE=3 SV=1 21 202 3.0E-07
sp|Q5LW56|RS3_RUEPO 30S ribosomal protein S3 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsC PE=3 SV=1 32 218 4.0E-07
sp|A6QCQ4|RS3_SULNB 30S ribosomal protein S3 OS=Sulfurovum sp. (strain NBC37-1) GN=rpsC PE=3 SV=1 31 203 5.0E-07
sp|Q7MTL9|RS3_PORGI 30S ribosomal protein S3 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsC PE=3 SV=1 107 203 5.0E-07
sp|B2RLY6|RS3_PORG3 30S ribosomal protein S3 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpsC PE=3 SV=1 107 203 5.0E-07
sp|P55827|RS3_AGGAC 30S ribosomal protein S3 OS=Aggregatibacter actinomycetemcomitans GN=rpsC PE=3 SV=2 31 202 5.0E-07
sp|A6TEW6|RS3_KLEP7 30S ribosomal protein S3 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|B5XNA0|RS3_KLEP3 30S ribosomal protein S3 OS=Klebsiella pneumoniae (strain 342) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|B2VK58|RS3_ERWT9 30S ribosomal protein S3 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|Q01W98|RS3_SOLUE 30S ribosomal protein S3 OS=Solibacter usitatus (strain Ellin6076) GN=rpsC PE=3 SV=1 31 202 5.0E-07
sp|B1JIW7|RS3_YERPY 30S ribosomal protein S3 OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|Q664S7|RS3_YERPS 30S ribosomal protein S3 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|A4TGZ8|RS3_YERPP 30S ribosomal protein S3 OS=Yersinia pestis (strain Pestoides F) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|Q1CCV0|RS3_YERPN 30S ribosomal protein S3 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|A9R902|RS3_YERPG 30S ribosomal protein S3 OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|Q8ZJA6|RS3_YERPE 30S ribosomal protein S3 OS=Yersinia pestis GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|B2K5M4|RS3_YERPB 30S ribosomal protein S3 OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|A7FNM9|RS3_YERP3 30S ribosomal protein S3 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|A1JS29|RS3_YERE8 30S ribosomal protein S3 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsC PE=3 SV=1 31 218 5.0E-07
sp|Q9CL37|RS3_PASMU 30S ribosomal protein S3 OS=Pasteurella multocida (strain Pm70) GN=rpsC PE=3 SV=1 25 202 6.0E-07
sp|A3N364|RS3_ACTP2 30S ribosomal protein S3 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsC PE=3 SV=1 25 202 7.0E-07
sp|Q03ZN9|RS3_LEUMM 30S ribosomal protein S3 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsC PE=3 SV=1 32 202 7.0E-07
sp|Q3KLH5|RS3_CHLTA 30S ribosomal protein S3 OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpsC PE=3 SV=1 21 218 7.0E-07
sp|A6VLJ4|RS3_ACTSZ 30S ribosomal protein S3 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsC PE=3 SV=1 25 202 7.0E-07
sp|Q046B9|RS3_LACGA 30S ribosomal protein S3 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsC PE=3 SV=1 21 202 8.0E-07
sp|Q74MZ4|RS3_NANEQ 30S ribosomal protein S3 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps3 PE=3 SV=2 20 224 8.0E-07
sp|B6EPT1|RS3_ALISL 30S ribosomal protein S3 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpsC PE=3 SV=1 25 228 8.0E-07
sp|A8YXL1|RS3_LACH4 30S ribosomal protein S3 OS=Lactobacillus helveticus (strain DPC 4571) GN=rpsC PE=3 SV=1 21 202 8.0E-07
sp|A5UHT6|RS3_HAEIG 30S ribosomal protein S3 OS=Haemophilus influenzae (strain PittGG) GN=rpsC PE=3 SV=1 31 202 9.0E-07
sp|A5UDU1|RS3_HAEIE 30S ribosomal protein S3 OS=Haemophilus influenzae (strain PittEE) GN=rpsC PE=3 SV=1 31 202 9.0E-07
sp|Q4QMB6|RS3_HAEI8 30S ribosomal protein S3 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsC PE=3 SV=1 31 202 9.0E-07
sp|A5IYY0|RS3_MYCAP 30S ribosomal protein S3 OS=Mycoplasma agalactiae (strain PG2) GN=rpsC PE=3 SV=1 30 207 9.0E-07
sp|Q47J97|RS3_DECAR 30S ribosomal protein S3 OS=Dechloromonas aromatica (strain RCB) GN=rpsC PE=3 SV=1 31 202 9.0E-07
sp|P44372|RS3_HAEIN 30S ribosomal protein S3 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsC PE=3 SV=2 31 202 9.0E-07
sp|C4ZBS5|RS3_EUBR3 30S ribosomal protein S3 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rpsC PE=3 SV=1 21 203 9.0E-07
sp|Q1H4N1|RS3_METFK 30S ribosomal protein S3 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpsC PE=3 SV=1 31 202 9.0E-07
sp|Q1C2V3|RS3_YERPA 30S ribosomal protein S3 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsC PE=3 SV=1 31 218 1.0E-06
sp|Q6LVB0|RS3_PHOPR 30S ribosomal protein S3 OS=Photobacterium profundum GN=rpsC PE=3 SV=1 25 202 1.0E-06
sp|Q4ZMQ0|RS3_PSEU2 30S ribosomal protein S3 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpsC PE=3 SV=1 31 216 1.0E-06
sp|Q889W5|RS3_PSESM 30S ribosomal protein S3 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpsC PE=3 SV=1 31 216 1.0E-06
sp|Q3K5Z4|RS3_PSEPF 30S ribosomal protein S3 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpsC PE=3 SV=1 31 216 1.0E-06
sp|Q48D42|RS3_PSE14 30S ribosomal protein S3 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpsC PE=3 SV=1 31 216 1.0E-06
sp|A4VSG0|RS3_STRSY 30S ribosomal protein S3 OS=Streptococcus suis (strain 05ZYH33) GN=rpsC PE=3 SV=1 32 202 1.0E-06
sp|A4VYP9|RS3_STRS2 30S ribosomal protein S3 OS=Streptococcus suis (strain 98HAH33) GN=rpsC PE=3 SV=1 32 202 1.0E-06
sp|Q16AE5|RS3_ROSDO 30S ribosomal protein S3 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsC PE=3 SV=1 32 205 1.0E-06
sp|P46172|RS3_BUCAK 30S ribosomal protein S3 (Fragment) OS=Buchnera aphidicola subsp. Acyrthosiphon kondoi GN=rpsC PE=3 SV=1 31 218 1.0E-06
sp|B9KEE6|RS3_CAMLR 30S ribosomal protein S3 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpsC PE=3 SV=1 31 213 2.0E-06
sp|Q034Y9|RS3_LACC3 30S ribosomal protein S3 OS=Lactobacillus casei (strain ATCC 334) GN=rpsC PE=3 SV=1 21 220 2.0E-06
sp|B0RZU6|RS3_FINM2 30S ribosomal protein S3 OS=Finegoldia magna (strain ATCC 29328) GN=rpsC PE=3 SV=1 31 203 2.0E-06
sp|A7H106|RS3_CAMC5 30S ribosomal protein S3 OS=Campylobacter curvus (strain 525.92) GN=rpsC PE=3 SV=1 31 218 2.0E-06
sp|Q03PW3|RS3_LACBA 30S ribosomal protein S3 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsC PE=3 SV=1 21 202 2.0E-06
sp|Q2NQM8|RS3_SODGM 30S ribosomal protein S3 OS=Sodalis glossinidius (strain morsitans) GN=rpsC PE=3 SV=1 31 218 2.0E-06
sp|A5USI3|RS3_ROSS1 30S ribosomal protein S3 OS=Roseiflexus sp. (strain RS-1) GN=rpsC PE=3 SV=1 32 208 2.0E-06
sp|Q4A5C7|RS3_MYCS5 30S ribosomal protein S3 OS=Mycoplasma synoviae (strain 53) GN=rpsC PE=3 SV=1 69 207 2.0E-06
sp|A1T0D6|RS3_PSYIN 30S ribosomal protein S3 OS=Psychromonas ingrahamii (strain 37) GN=rpsC PE=3 SV=1 13 202 2.0E-06
sp|A9NAN0|RS3_COXBR 30S ribosomal protein S3 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsC PE=3 SV=1 28 208 2.0E-06
sp|A9KD25|RS3_COXBN 30S ribosomal protein S3 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsC PE=3 SV=1 28 208 2.0E-06
sp|B6J257|RS3_COXB2 30S ribosomal protein S3 OS=Coxiella burnetii (strain CbuG_Q212) GN=rpsC PE=3 SV=1 28 208 2.0E-06
sp|B6J5D8|RS3_COXB1 30S ribosomal protein S3 OS=Coxiella burnetii (strain CbuK_Q154) GN=rpsC PE=3 SV=1 28 208 2.0E-06
sp|A8GKJ1|RS3_SERP5 30S ribosomal protein S3 OS=Serratia proteamaculans (strain 568) GN=rpsC PE=3 SV=1 31 218 2.0E-06
sp|Q04G79|RS3_OENOB 30S ribosomal protein S3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsC PE=3 SV=1 124 209 2.0E-06
sp|B9KL97|RS3_RHOSK 30S ribosomal protein S3 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rpsC PE=3 SV=1 31 208 2.0E-06
sp|Q3J5R6|RS3_RHOS4 30S ribosomal protein S3 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpsC PE=3 SV=1 31 208 2.0E-06
sp|A3PGL7|RS3_RHOS1 30S ribosomal protein S3 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpsC PE=3 SV=1 31 208 2.0E-06
sp|Q03EC2|RS3_PEDPA 30S ribosomal protein S3 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsC PE=3 SV=1 21 202 2.0E-06
sp|P56010|RS3_HELPY 30S ribosomal protein S3 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsC PE=3 SV=1 31 202 2.0E-06
sp|C1DAS3|RS3_LARHH 30S ribosomal protein S3 OS=Laribacter hongkongensis (strain HLHK9) GN=rpsC PE=3 SV=1 31 217 3.0E-06
sp|A7Z0P4|RS3_BACMF 30S ribosomal protein S3 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsC PE=3 SV=1 31 202 3.0E-06
sp|Q4FLM4|RS3_PELUB 30S ribosomal protein S3 OS=Pelagibacter ubique (strain HTCC1062) GN=rpsC PE=3 SV=1 13 202 3.0E-06
sp|A0ALW2|RS3_LISW6 30S ribosomal protein S3 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsC PE=3 SV=1 32 202 3.0E-06
sp|P66548|RS3_LISMO 30S ribosomal protein S3 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsC PE=3 SV=1 32 202 3.0E-06
sp|Q71WF2|RS3_LISMF 30S ribosomal protein S3 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsC PE=3 SV=1 32 202 3.0E-06
sp|P66549|RS3_LISIN 30S ribosomal protein S3 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsC PE=3 SV=1 32 202 3.0E-06
sp|Q9RXJ6|RS3_DEIRA 30S ribosomal protein S3 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsC PE=3 SV=1 31 203 3.0E-06
sp|B7IHV2|RS3_THEAB 30S ribosomal protein S3 OS=Thermosipho africanus (strain TCF52B) GN=rpsC PE=3 SV=1 31 202 3.0E-06
sp|Q2N9B7|RS3_ERYLH 30S ribosomal protein S3 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpsC PE=3 SV=1 48 208 3.0E-06
sp|Q7VKD7|RS3_HAEDU 30S ribosomal protein S3 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsC PE=3 SV=1 25 202 4.0E-06
sp|Q3YWU5|RS3_SHISS 30S ribosomal protein S3 OS=Shigella sonnei (strain Ss046) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|Q0SZY8|RS3_SHIF8 30S ribosomal protein S3 OS=Shigella flexneri serotype 5b (strain 8401) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|Q32B37|RS3_SHIDS 30S ribosomal protein S3 OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|Q31VW2|RS3_SHIBS 30S ribosomal protein S3 OS=Shigella boydii serotype 4 (strain Sb227) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B2U2T2|RS3_SHIB3 30S ribosomal protein S3 OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|P0A7V6|RS3_SALTY 30S ribosomal protein S3 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpsC PE=3 SV=2 31 220 5.0E-06
sp|P0A7V7|RS3_SALTI 30S ribosomal protein S3 OS=Salmonella typhi GN=rpsC PE=3 SV=2 31 220 5.0E-06
sp|B4TXD6|RS3_SALSV 30S ribosomal protein S3 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B5BGY0|RS3_SALPK 30S ribosomal protein S3 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|C0Q0B0|RS3_SALPC 30S ribosomal protein S3 OS=Salmonella paratyphi C (strain RKS4594) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|A9MSZ2|RS3_SALPB 30S ribosomal protein S3 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|Q5PIV8|RS3_SALPA 30S ribosomal protein S3 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpsC PE=3 SV=3 31 220 5.0E-06
sp|B4SUT4|RS3_SALNS 30S ribosomal protein S3 OS=Salmonella newport (strain SL254) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B4TKK9|RS3_SALHS 30S ribosomal protein S3 OS=Salmonella heidelberg (strain SL476) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B5RH21|RS3_SALG2 30S ribosomal protein S3 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B5R285|RS3_SALEP 30S ribosomal protein S3 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B5FJK8|RS3_SALDC 30S ribosomal protein S3 OS=Salmonella dublin (strain CT_02021853) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|Q57J38|RS3_SALCH 30S ribosomal protein S3 OS=Salmonella choleraesuis (strain SC-B67) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|A9MN54|RS3_SALAR 30S ribosomal protein S3 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B5F7T9|RS3_SALA4 30S ribosomal protein S3 OS=Salmonella agona (strain SL483) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B7LRT0|RS3_ESCF3 30S ribosomal protein S3 OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|A4WFC2|RS3_ENT38 30S ribosomal protein S3 OS=Enterobacter sp. (strain 638) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|Q1R612|RS3_ECOUT 30S ribosomal protein S3 OS=Escherichia coli (strain UTI89 / UPEC) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B1LHC8|RS3_ECOSM 30S ribosomal protein S3 OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B6I228|RS3_ECOSE 30S ribosomal protein S3 OS=Escherichia coli (strain SE11) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B7NDT5|RS3_ECOLU 30S ribosomal protein S3 OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|P0A7V3|RS3_ECOLI 30S ribosomal protein S3 OS=Escherichia coli (strain K12) GN=rpsC PE=1 SV=2 31 220 5.0E-06
sp|B1IPY5|RS3_ECOLC 30S ribosomal protein S3 OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|P0A7V4|RS3_ECOL6 30S ribosomal protein S3 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rpsC PE=3 SV=2 31 220 5.0E-06
sp|Q0TCE7|RS3_ECOL5 30S ribosomal protein S3 OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|A1AGK2|RS3_ECOK1 30S ribosomal protein S3 OS=Escherichia coli O1:K1 / APEC GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|A8A5B9|RS3_ECOHS 30S ribosomal protein S3 OS=Escherichia coli O9:H4 (strain HS) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|C4ZUG9|RS3_ECOBW 30S ribosomal protein S3 OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B7M1M8|RS3_ECO8A 30S ribosomal protein S3 OS=Escherichia coli O8 (strain IAI1) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B7N198|RS3_ECO81 30S ribosomal protein S3 OS=Escherichia coli O81 (strain ED1a) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B7NLN3|RS3_ECO7I 30S ribosomal protein S3 OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B5YTN5|RS3_ECO5E 30S ribosomal protein S3 OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|P0A7V5|RS3_ECO57 30S ribosomal protein S3 OS=Escherichia coli O157:H7 GN=rpsC PE=3 SV=2 31 220 5.0E-06
sp|B7L4K3|RS3_ECO55 30S ribosomal protein S3 OS=Escherichia coli (strain 55989 / EAEC) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B7MCS9|RS3_ECO45 30S ribosomal protein S3 OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B7UK38|RS3_ECO27 30S ribosomal protein S3 OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|A7ZSK3|RS3_ECO24 30S ribosomal protein S3 OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|A8AQL0|RS3_CITK8 30S ribosomal protein S3 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpsC PE=3 SV=1 31 220 5.0E-06
sp|B8E1D9|RS3_DICTD 30S ribosomal protein S3 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpsC PE=3 SV=1 32 217 5.0E-06
sp|B1MW08|RS3_LEUCK 30S ribosomal protein S3 OS=Leuconostoc citreum (strain KM20) GN=rpsC PE=3 SV=1 32 202 5.0E-06
sp|A7H650|RS3_CAMJD 30S ribosomal protein S3 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsC PE=3 SV=1 31 213 5.0E-06
sp|A4XZ84|RS3_PSEMY 30S ribosomal protein S3 OS=Pseudomonas mendocina (strain ymp) GN=rpsC PE=3 SV=1 31 216 5.0E-06
sp|A0RM17|RS3_CAMFF 30S ribosomal protein S3 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpsC PE=3 SV=1 4 214 5.0E-06
sp|Q65PA1|RS3_BACLD 30S ribosomal protein S3 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsC PE=3 SV=1 31 202 5.0E-06
sp|Q0I099|RS3_SHESR 30S ribosomal protein S3 OS=Shewanella sp. (strain MR-7) GN=rpsC PE=3 SV=1 20 209 5.0E-06
sp|Q0HNT1|RS3_SHESM 30S ribosomal protein S3 OS=Shewanella sp. (strain MR-4) GN=rpsC PE=3 SV=1 20 209 5.0E-06
sp|A0KRN0|RS3_SHESA 30S ribosomal protein S3 OS=Shewanella sp. (strain ANA-3) GN=rpsC PE=3 SV=1 20 209 5.0E-06
sp|P59183|RS3_SHEON 30S ribosomal protein S3 OS=Shewanella oneidensis (strain MR-1) GN=rpsC PE=3 SV=1 20 209 5.0E-06
sp|O85388|RS3_COXBU 30S ribosomal protein S3 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsC PE=3 SV=2 28 208 5.0E-06
sp|Q5HS96|RS3_CAMJR 30S ribosomal protein S3 OS=Campylobacter jejuni (strain RM1221) GN=rpsC PE=3 SV=1 31 213 6.0E-06
sp|A1W1V4|RS3_CAMJJ 30S ribosomal protein S3 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsC PE=3 SV=1 31 213 6.0E-06
sp|Q9PLX7|RS3_CAMJE 30S ribosomal protein S3 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsC PE=3 SV=1 31 213 6.0E-06
sp|A8FP15|RS3_CAMJ8 30S ribosomal protein S3 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsC PE=3 SV=1 31 213 6.0E-06
sp|Q21M51|RS3_SACD2 30S ribosomal protein S3 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpsC PE=3 SV=1 31 202 6.0E-06
sp|B3PMP1|RS3_MYCA5 30S ribosomal protein S3 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rpsC PE=3 SV=1 49 202 6.0E-06
sp|Q30TV8|RS3_SULDN 30S ribosomal protein S3 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsC PE=3 SV=1 31 202 6.0E-06
sp|P59184|RS3_SHIFL 30S ribosomal protein S3 OS=Shigella flexneri GN=rpsC PE=3 SV=1 31 220 6.0E-06
sp|C5CGQ8|RS3_KOSOT 30S ribosomal protein S3 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsC PE=3 SV=1 55 202 7.0E-06
sp|A6Q1I4|RS3_NITSB 30S ribosomal protein S3 OS=Nitratiruptor sp. (strain SB155-2) GN=rpsC PE=3 SV=1 31 202 7.0E-06
sp|A6LEI5|RS3_PARD8 30S ribosomal protein S3 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsC PE=3 SV=1 30 203 7.0E-06
sp|B8G6R9|RS3_CHLAD 30S ribosomal protein S3 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsC PE=3 SV=1 31 242 8.0E-06
sp|B6JNF1|RS3_HELP2 30S ribosomal protein S3 OS=Helicobacter pylori (strain P12) GN=rpsC PE=3 SV=1 31 203 8.0E-06
sp|P21465|RS3_BACSU 30S ribosomal protein S3 OS=Bacillus subtilis (strain 168) GN=rpsC PE=1 SV=4 31 202 9.0E-06
sp|Q0P3L7|RR3_OSTTA 30S ribosomal protein S3, chloroplastic OS=Ostreococcus tauri GN=rps3 PE=3 SV=1 32 202 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0003723 RNA binding Yes
GO:1901576 organic substance biosynthetic process No
GO:0003676 nucleic acid binding No
GO:0019538 protein metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0043604 amide biosynthetic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005198 structural molecule activity No
GO:0009059 macromolecule biosynthetic process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006840
MKESKAQDPQKMSAQISKKRKFVADGVFRAELNEFFTRELAEEGYSGCDVRVTHARTEIIIRATHTQEVLGEKGR
RIRELTALVQKRFKFPENSLELYAEKVQYRGLSAIAQCESLRYKLLGGLAVRRACYGVLRFVMESGAKGCEVVVS
GKLRAARAKSMKFTDGFMIHSGQPVREFVDYAVRHVLLKQGVLGIKVKIMKGHDPEGQLGPKKPLPDAVQIYEPP
VDKVVLEPSSEQREPVPVPVAAPAAEEPYVPPQDEAFQQQEAYGAEQQTVF*
Coding >AgabiH97|006840
ATGAAGGAAAGCAAGGCTCAAGATCCCCAAAAAATGTCCGCCCAAATCAGCAAGAAGCGCAAGTTTGTAGCTGAT
GGTGTTTTCCGCGCCGAACTAAACGAATTCTTCACTCGCGAGCTTGCTGAAGAGGGTTACTCTGGATGCGACGTA
CGCGTCACTCACGCTCGCACAGAGATCATTATTCGCGCCACCCATACTCAGGAAGTTCTCGGTGAGAAGGGTCGC
CGCATTCGTGAACTCACTGCCCTCGTTCAAAAACGATTCAAATTCCCCGAAAACTCTCTCGAACTCTACGCCGAA
AAAGTGCAGTACCGTGGATTGTCTGCCATTGCTCAATGCGAGTCTTTACGTTACAAACTTCTTGGTGGTCTCGCT
GTCCGACGGGCGTGTTATGGTGTCCTTCGATTTGTTATGGAGTCTGGTGCCAAGGGTTGTGAGGTGGTTGTTTCT
GGCAAGCTTCGTGCTGCCCGTGCCAAGTCTATGAAATTCACCGATGGTTTCATGATTCACTCTGGACAACCTGTC
CGCGAGTTTGTTGACTACGCTGTCCGTCACGTACTTCTTAAACAGGGTGTCCTCGGTATCAAGGTGAAAATCATG
AAGGGACATGATCCTGAAGGTCAACTCGGACCCAAGAAACCTCTACCTGACGCAGTCCAAATCTACGAGCCCCCT
GTTGATAAAGTTGTTCTTGAGCCATCCTCAGAGCAACGCGAACCAGTCCCAGTGCCCGTTGCAGCACCTGCTGCA
GAAGAACCTTATGTTCCTCCTCAGGATGAAGCATTCCAGCAACAAGAGGCATATGGAGCGGAACAGCAGACTGTA
TTCTAG
Transcript >AgabiH97|006840
ATGAAGGAAAGCAAGGCTCAAGATCCCCAAAAAATGTCCGCCCAAATCAGCAAGAAGCGCAAGTTTGTAGCTGAT
GGTGTTTTCCGCGCCGAACTAAACGAATTCTTCACTCGCGAGCTTGCTGAAGAGGGTTACTCTGGATGCGACGTA
CGCGTCACTCACGCTCGCACAGAGATCATTATTCGCGCCACCCATACTCAGGAAGTTCTCGGTGAGAAGGGTCGC
CGCATTCGTGAACTCACTGCCCTCGTTCAAAAACGATTCAAATTCCCCGAAAACTCTCTCGAACTCTACGCCGAA
AAAGTGCAGTACCGTGGATTGTCTGCCATTGCTCAATGCGAGTCTTTACGTTACAAACTTCTTGGTGGTCTCGCT
GTCCGACGGGCGTGTTATGGTGTCCTTCGATTTGTTATGGAGTCTGGTGCCAAGGGTTGTGAGGTGGTTGTTTCT
GGCAAGCTTCGTGCTGCCCGTGCCAAGTCTATGAAATTCACCGATGGTTTCATGATTCACTCTGGACAACCTGTC
CGCGAGTTTGTTGACTACGCTGTCCGTCACGTACTTCTTAAACAGGGTGTCCTCGGTATCAAGGTGAAAATCATG
AAGGGACATGATCCTGAAGGTCAACTCGGACCCAAGAAACCTCTACCTGACGCAGTCCAAATCTACGAGCCCCCT
GTTGATAAAGTTGTTCTTGAGCCATCCTCAGAGCAACGCGAACCAGTCCCAGTGCCCGTTGCAGCACCTGCTGCA
GAAGAACCTTATGTTCCTCCTCAGGATGAAGCATTCCAGCAACAAGAGGCATATGGAGCGGAACAGCAGACTGTA
TTCTAG
Gene >AgabiH97|006840
ATGAAGGAAAGGTGGATTGAATGAAAGGAAAGAAATAACTCACCATGTAAGGAGTCAAGACACGTATCACAAGAA
GAAAAGAAAACGCGAGCTTCGATTCCCGTACAAGAGTCACATGTTCTGCTTCGGCATAATCCGAATACTGTGTAG
ATCCATCAGCCACCCATTTCAATTAGGTGATCGGTACTCCACAATCTCGACGACCACCCAGCAAGGCTCAAGGTA
AGTATCGAACCCAGAGATATACAGACGAGACAAACTCAACGTCGATCATCCTTAGATCCCCAAAAAATGTCCGCC
CAAATCAGCAAGAAGCGCAAGTTTGTAGCTGATGGTGTTTTCCGCGCCGAACTAAACGAATTCTTCACTCGCGAG
CTTGCTGAAGAGGGTTACTCTGGATGCGACGTACGCGTCACTCACGCTCGCACAGAGGTACATATTCTCTATTGT
TCCTGAAGTGGATAGACAAATTTAAAGATGAATATTTTCCAATCAGATCATTATTCGCGCCACCCATACTCAGGA
AGTTCTCGGTGAGAAGGGTCGCCGCATTCGTGAACTCACTGCCCTCGTTCAAAAACGATTCAAATTCCCCGAAAA
CTCTCTCGAACTCTACGCCGAAAAAGTGCAGTACCGTGGATTGTCTGCCATTGCTCAATGCGAGTCTTTACGTTA
CAAACTTCTTGGTGGTCTCGCTGTCCGACGGTGAGCTTTACGTTTCCTTACATCTCTTCGTTGACTCCTATTCTA
AAACACCAAGTGCTTCTCAGGGCGTGTTATGGTGTCCTTCGATTTGTTATGGAGTCTGGTGCCAAGGGTTGTGAG
GTGGTTGTTTCTGGCAAGCTTCGTGCTGCCCGTGCCAAGTCTATGAAATTCACCGATGGTTTCATGATTCACTCT
GGACAACCTGTCCGCGAGTTTGTTGACTACGCTGTCCGTCACGTACTTCTTAAACAGGGTGTCCTCGGTATCAAG
GTGAAAATGTACGAGACAATACTTCTTTTCCATCGCATACTTTGACTAAATTTGCCCATTATAGCATGAAGGGAC
ATGATCCTGAAGGTCAACTCGGACCCAAGAAACCTCTACCTGACGCAGTCCAAATCTACGAGCCCCCTGTTGATA
AAGTTGTTCTTGAGCCATCCTCAGAGCAACGCGAACCAGTCCCAGTGCCCGTTGCAGCACCTGCTGCAGAAGAAC
CTTATGTTCCTCCTCAGGATGAAGCATTCCAGCAACAAGAGGCATATGGAGCGGAACAGCAGACTGTATTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail