Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006830
Gene name
Locationscaffold_1:1653763..1656913
Strand+
Gene length (bp)3150
Transcript length (bp)2589
Coding sequence length (bp)2589
Protein length (aa) 863

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02278 Lyase_8 Polysaccharide lyase family 8, super-sandwich domain 8.0E-70 486 734
PF08124 Lyase_8_N Polysaccharide lyase family 8, N terminal alpha-helical domain 3.6E-15 248 404
PF02884 Lyase_8_C Polysaccharide lyase family 8, C-terminal beta-sandwich domain 4.9E-13 751 821

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q59288|CSLA_PEDHD Chondroitinase-AC OS=Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / NCIB 9290) GN=cslA PE=1 SV=1 128 858 3.0E-40
sp|Q9AQS0|XANLY_BACGL Xanthan lyase OS=Bacillus sp. (strain GL1) GN=xly PE=1 SV=1 185 774 6.0E-11

GO

GO Term Description Terminal node
GO:0005576 extracellular region Yes
GO:0016829 lyase activity Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 111.48 62.17 160.79
Initials Initials knots 64.59 38.29 90.90
Pileal_Stipeal_center Stage I stipe center 46.40 27.88 64.91
Pileal_Stipeal_shell Stage I stipe shell 29.79 17.73 41.85
DIF_stipe_center Stage II stipe center 56.39 33.61 79.17
DIF_stipe_shell Stage II stipe shell 57.95 34.54 81.37
DIF_stipe_skin Stage II stipe skin 41.85 25.17 58.54
DIF_cap_skin Stage II cap skin 27.65 16.43 38.87
DIF_cap_tissue Stage II cap tissue 38.56 23.04 54.07
DIF_gill_tissue Stage II gill tissue 42.40 25.34 59.45
YFB_stipe_center Young fruiting body stipe center 77.02 45.23 108.80
YFB_stipe_shell Young fruiting body stipe shell 80.56 47.43 113.69
YFB_stipe_skin Young fruiting body stipe skin 50.47 30.31 70.64
YFB_cap_skin Young fruiting body cap skin 20.20 11.83 28.58
YFB_cap_tissue Young fruiting body cap tissue 44.04 26.33 61.74
YFB_gill_tissue Young fruiting body gill tissue 26.27 15.33 37.20
YFB_veil Young fruiting body veil 27.92 16.52 39.31

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.256555 no
Casing YFB_stipe_shell 0.336597 no
Casing YFB_stipe_skin 0.002084 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.052745 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.010728 yes
Casing DIF_stipe_shell 0.017783 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.024946 yes
DIF_gill_tissue YFB_stipe_shell 0.012880 yes
DIF_gill_tissue YFB_stipe_skin 0.653022 no
DIF_gill_tissue YFB_cap_skin 0.006387 yes
DIF_gill_tissue YFB_cap_tissue 0.942227 no
DIF_gill_tissue YFB_gill_tissue 0.085387 no
DIF_gill_tissue YFB_veil 0.146322 no
YFB_stipe_center YFB_stipe_shell 0.933586 no
YFB_stipe_center YFB_stipe_skin 0.134423 no
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.038278 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.089301 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.026461 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.001140 yes
YFB_stipe_skin YFB_cap_tissue 0.743856 no
YFB_stipe_skin YFB_gill_tissue 0.011350 yes
YFB_stipe_skin YFB_veil 0.020260 yes
YFB_cap_skin YFB_cap_tissue 0.003365 yes
YFB_cap_skin YFB_gill_tissue 0.454694 no
YFB_cap_skin YFB_veil 0.317243 no
YFB_cap_tissue YFB_gill_tissue 0.060892 no
YFB_cap_tissue YFB_veil 0.104906 no
YFB_gill_tissue YFB_veil 0.905063 no
Initials DIF_gill_tissue 0.141674 no
Initials YFB_stipe_center 0.662254 no
Initials YFB_stipe_shell 0.547798 no
Initials YFB_stipe_skin 0.466367 no
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.194366 no
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.001140 yes
Initials Pileal_Stipeal_center 0.278683 no
Initials Pileal_Stipeal_shell 0.001625 yes
Initials DIF_stipe_center 0.749181 no
Initials DIF_stipe_shell 0.811448 no
Initials DIF_stipe_skin 0.121880 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.057350 no
Pileal_Stipeal_center DIF_gill_tissue 0.848035 no
Pileal_Stipeal_center YFB_stipe_center 0.066207 no
Pileal_Stipeal_center YFB_stipe_shell 0.037818 yes
Pileal_Stipeal_center YFB_stipe_skin 0.858362 no
Pileal_Stipeal_center YFB_cap_skin 0.002084 yes
Pileal_Stipeal_center YFB_cap_tissue 0.920680 no
Pileal_Stipeal_center YFB_gill_tissue 0.032038 yes
Pileal_Stipeal_center YFB_veil 0.057350 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.112416 no
Pileal_Stipeal_center DIF_stipe_center 0.601051 no
Pileal_Stipeal_center DIF_stipe_shell 0.530650 no
Pileal_Stipeal_center DIF_stipe_skin 0.821079 no
Pileal_Stipeal_center DIF_cap_skin 0.049257 yes
Pileal_Stipeal_center DIF_cap_tissue 0.626833 no
Pileal_Stipeal_shell DIF_gill_tissue 0.251119 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.048212 yes
Pileal_Stipeal_shell YFB_cap_skin 0.195806 no
Pileal_Stipeal_shell YFB_cap_tissue 0.188408 no
Pileal_Stipeal_shell YFB_gill_tissue 0.775193 no
Pileal_Stipeal_shell YFB_veil 0.900052 no
Pileal_Stipeal_shell DIF_stipe_center 0.014668 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.010412 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.270961 no
Pileal_Stipeal_shell DIF_cap_skin 0.882559 no
Pileal_Stipeal_shell DIF_cap_tissue 0.455910 no
DIF_stipe_center DIF_gill_tissue 0.382297 no
DIF_stipe_center YFB_stipe_center 0.338773 no
DIF_stipe_center YFB_stipe_shell 0.244911 no
DIF_stipe_center YFB_stipe_skin 0.798950 no
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.470241 no
DIF_stipe_center YFB_gill_tissue 0.001625 yes
DIF_stipe_center YFB_veil 0.004928 yes
DIF_stipe_center DIF_stipe_shell 0.959501 no
DIF_stipe_center DIF_stipe_skin 0.353184 no
DIF_stipe_center DIF_cap_skin 0.005671 yes
DIF_stipe_center DIF_cap_tissue 0.198538 no
DIF_stipe_shell DIF_gill_tissue 0.330557 no
DIF_stipe_shell YFB_stipe_center 0.399688 no
DIF_stipe_shell YFB_stipe_shell 0.302114 no
DIF_stipe_shell YFB_stipe_skin 0.738373 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.411559 no
DIF_stipe_shell YFB_gill_tissue 0.001625 yes
DIF_stipe_shell YFB_veil 0.004160 yes
DIF_stipe_shell DIF_stipe_skin 0.302791 no
DIF_stipe_shell DIF_cap_skin 0.005302 yes
DIF_stipe_shell DIF_cap_tissue 0.163833 no
DIF_stipe_skin DIF_gill_tissue 0.980942 no
DIF_stipe_skin YFB_stipe_center 0.024698 yes
DIF_stipe_skin YFB_stipe_shell 0.012577 yes
DIF_stipe_skin YFB_stipe_skin 0.617510 no
DIF_stipe_skin YFB_cap_skin 0.006742 yes
DIF_stipe_skin YFB_cap_tissue 0.922323 no
DIF_stipe_skin YFB_gill_tissue 0.091835 no
DIF_stipe_skin YFB_veil 0.160518 no
DIF_stipe_skin DIF_cap_skin 0.146589 no
DIF_stipe_skin DIF_cap_tissue 0.867116 no
DIF_cap_skin DIF_gill_tissue 0.136175 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.019169 yes
DIF_cap_skin YFB_cap_skin 0.328018 no
DIF_cap_skin YFB_cap_tissue 0.096464 no
DIF_cap_skin YFB_gill_tissue 0.923312 no
DIF_cap_skin YFB_veil 0.986251 no
DIF_cap_skin DIF_cap_tissue 0.288092 no
DIF_cap_tissue DIF_gill_tissue 0.840537 no
DIF_cap_tissue YFB_stipe_center 0.010093 yes
DIF_cap_tissue YFB_stipe_shell 0.004160 yes
DIF_cap_tissue YFB_stipe_skin 0.412952 no
DIF_cap_tissue YFB_cap_skin 0.015529 yes
DIF_cap_tissue YFB_cap_tissue 0.756976 no
DIF_cap_tissue YFB_gill_tissue 0.196632 no
DIF_cap_tissue YFB_veil 0.298146 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006830
MKPLFNLPRTLFFHVSLFLSLLACPDLVSSASTSTSSTSLSSTHGIVVPSGSSSSRVLSSLTTSHVQSASSSLST
RISQTSATAPNSSKMTTIATSTFVNPSLNSSATATSTATVTTPSDPAILEEIEMLRTQVIDIIIGPLGQASAIPA
WLTSLGPDGKWPDSEVDYTTGCPARRANWPAQTHWQRILVMAAAWHGGLQGGENFVGDENLRKKTLLAIDYWFGR
DLTNLECMINGGTPSCPCDNPDNTLWNTNWFSNVILIPNLVGSSCILLNETLTAAQLDHCTKITNRSYDLFLRPF
NEVNFLTGANVLDVAKIGIDGALLNPNITQITDAYRRIHEEVVIQPAIKADGIRPDGSFGQHGGVLYNGNYGKDF
TNDIVAFEIEAAETRFAANSESRSALALLFEGDHWMIFRNTVTGVLHWDFSALGRFISFPVIDTQATGSIKLNLT
QIDVLGRLWDQPALVQFAESLSEHDMNANAGRLIGNRMFYNNDYMVHRGPNYVTTVKMYSTRTKYGECLNSQNIL
GFHLSDGAVYTYLKGNEYEDIAVAWDWNLIPGITTDYEATKLTCSSGVTGIEDFVGGVSNDDTGIAVMRYTNPLT
GDLNWQKAWFFLEGDVQHTMISNITSTSDSPVFSVLDQRLHDDAIFMDDGEPFRANDGPTPLSSATLWHGGVGYD
LSGLGDDDILHVEVGPKSGNWSAIGTSTEPPSTFDLFAAWIEHGTPASSISYSTFPGTSFTGFMGKQAKLRLQSV
VNDGSVGAIYDEEHQTVMVVFWEEDGGSVTIRPPRLAPITISADGNIALIYRFSDAAVYVSDPSQTLTEVQVNLE
LGTGWKPPFWGFHRSKDFSIFLPTGGLAGSSVRQPLN*
Coding >AgabiH97|006830
ATGAAGCCTCTCTTCAATCTCCCTCGTACTCTCTTTTTCCACGTCTCTTTGTTCCTTTCCCTCTTGGCGTGCCCC
GATCTGGTTTCAAGCGCGTCCACCTCTACATCATCCACCTCTTTATCCTCAACTCATGGCATTGTTGTGCCATCC
GGTTCTTCATCATCTCGGGTGCTTTCCTCGCTGACCACCTCACATGTACAATCTGCATCGTCCTCTTTGAGCACT
CGTATATCGCAGACATCTGCTACCGCCCCCAATTCATCCAAGATGACGACTATAGCCACTTCAACCTTTGTCAAT
CCTTCTTTGAATTCATCTGCCACAGCAACATCCACTGCTACGGTGACTACGCCTTCCGATCCCGCTATACTGGAA
GAAATAGAAATGTTGCGAACCCAAGTAATCGACATTATCATTGGCCCACTTGGTCAAGCGAGTGCAATACCTGCT
TGGCTGACATCCCTGGGTCCTGATGGCAAATGGCCTGATAGTGAAGTTGACTATACAACTGGCTGCCCTGCCCGC
CGGGCCAACTGGCCAGCCCAGACACATTGGCAGCGTATTCTCGTGATGGCAGCTGCATGGCACGGCGGATTACAA
GGAGGGGAAAACTTCGTCGGAGATGAAAATCTCCGTAAGAAAACACTACTGGCTATAGACTATTGGTTCGGGCGT
GATCTCACCAATCTTGAATGCATGATCAACGGTGGTACTCCGTCTTGTCCATGTGATAATCCTGATAATACCCTG
TGGAACACCAACTGGTTTTCTAATGTTATACTGATTCCGAACCTCGTTGGGTCATCATGCATACTGTTGAACGAG
ACTTTGACCGCGGCACAGTTGGATCACTGTACAAAAATAACCAACCGCTCATATGATCTCTTCTTGCGCCCATTT
AATGAAGTCAACTTCCTGACAGGTGCAAATGTTTTGGATGTCGCCAAAATTGGAATTGATGGGGCTCTACTCAAC
CCCAATATCACACAAATAACCGATGCATATCGTCGCATACATGAAGAGGTTGTAATTCAACCAGCTATCAAAGCC
GATGGTATCAGACCTGATGGGTCTTTCGGTCAGCATGGTGGTGTTCTCTACAACGGTAACTACGGCAAGGACTTT
ACAAACGACATCGTGGCCTTTGAAATTGAGGCGGCCGAGACACGTTTTGCTGCAAATTCCGAGTCTCGATCCGCT
CTTGCTCTTCTCTTCGAAGGTGACCATTGGATGATCTTTCGCAACACCGTCACGGGGGTGCTACACTGGGATTTT
TCTGCTCTTGGGCGATTTATCAGCTTTCCTGTCATTGATACTCAGGCCACCGGAAGTATCAAACTAAATCTTACT
CAGATTGATGTCCTTGGACGGCTTTGGGATCAACCGGCTCTTGTCCAATTTGCCGAAAGTCTTTCTGAACACGAC
ATGAATGCCAATGCAGGTCGGCTCATCGGCAATCGTATGTTCTACAACAACGACTACATGGTTCACCGTGGCCCG
AACTACGTTACTACTGTTAAGATGTATTCCACAAGAACAAAGTATGGTGAATGTCTAAACTCTCAGAATATATTG
GGTTTCCATCTCTCAGACGGAGCTGTATACACCTATTTGAAGGGCAATGAGTATGAAGATATTGCTGTCGCCTGG
GACTGGAACCTTATTCCGGGAATTACTACCGACTATGAAGCGACCAAACTTACTTGTTCCAGCGGCGTCACTGGG
ATTGAAGATTTCGTTGGTGGTGTGTCTAATGACGATACTGGTATCGCCGTCATGCGCTACACGAATCCCTTGACT
GGCGACTTGAATTGGCAAAAAGCGTGGTTTTTCCTCGAGGGCGACGTCCAACACACCATGATTTCCAATATCACA
TCCACATCCGACAGCCCTGTCTTCTCCGTACTTGACCAACGTCTCCATGATGACGCTATTTTCATGGATGACGGT
GAACCGTTCAGAGCCAATGATGGACCTACTCCTTTGTCTTCAGCGACGCTTTGGCATGGCGGGGTAGGTTATGAC
CTGTCGGGCCTTGGAGATGATGACATCCTCCACGTTGAGGTTGGTCCAAAGTCAGGGAACTGGTCAGCGATCGGT
ACTTCAACTGAACCACCATCAACATTTGACCTCTTCGCTGCCTGGATTGAACACGGAACGCCCGCATCATCTATT
TCCTATTCCACATTCCCCGGTACCAGTTTCACTGGTTTCATGGGCAAGCAGGCCAAGCTTCGTTTGCAATCTGTT
GTGAATGACGGGAGCGTGGGGGCCATATACGACGAGGAACACCAAACAGTAATGGTTGTGTTTTGGGAAGAAGAT
GGTGGTAGTGTTACAATCAGACCCCCGAGATTGGCCCCGATCACTATTAGCGCGGACGGCAACATAGCTCTGATT
TATCGGTTTTCAGACGCTGCAGTTTATGTGTCAGATCCTTCTCAAACACTTACGGAAGTACAAGTCAATTTGGAA
TTGGGTACGGGCTGGAAGCCACCATTCTGGGGTTTCCACAGGTCCAAAGACTTCAGTATATTCCTTCCAACGGGT
GGCCTAGCAGGTAGTAGCGTGCGCCAGCCATTGAATTAG
Transcript >AgabiH97|006830
ATGAAGCCTCTCTTCAATCTCCCTCGTACTCTCTTTTTCCACGTCTCTTTGTTCCTTTCCCTCTTGGCGTGCCCC
GATCTGGTTTCAAGCGCGTCCACCTCTACATCATCCACCTCTTTATCCTCAACTCATGGCATTGTTGTGCCATCC
GGTTCTTCATCATCTCGGGTGCTTTCCTCGCTGACCACCTCACATGTACAATCTGCATCGTCCTCTTTGAGCACT
CGTATATCGCAGACATCTGCTACCGCCCCCAATTCATCCAAGATGACGACTATAGCCACTTCAACCTTTGTCAAT
CCTTCTTTGAATTCATCTGCCACAGCAACATCCACTGCTACGGTGACTACGCCTTCCGATCCCGCTATACTGGAA
GAAATAGAAATGTTGCGAACCCAAGTAATCGACATTATCATTGGCCCACTTGGTCAAGCGAGTGCAATACCTGCT
TGGCTGACATCCCTGGGTCCTGATGGCAAATGGCCTGATAGTGAAGTTGACTATACAACTGGCTGCCCTGCCCGC
CGGGCCAACTGGCCAGCCCAGACACATTGGCAGCGTATTCTCGTGATGGCAGCTGCATGGCACGGCGGATTACAA
GGAGGGGAAAACTTCGTCGGAGATGAAAATCTCCGTAAGAAAACACTACTGGCTATAGACTATTGGTTCGGGCGT
GATCTCACCAATCTTGAATGCATGATCAACGGTGGTACTCCGTCTTGTCCATGTGATAATCCTGATAATACCCTG
TGGAACACCAACTGGTTTTCTAATGTTATACTGATTCCGAACCTCGTTGGGTCATCATGCATACTGTTGAACGAG
ACTTTGACCGCGGCACAGTTGGATCACTGTACAAAAATAACCAACCGCTCATATGATCTCTTCTTGCGCCCATTT
AATGAAGTCAACTTCCTGACAGGTGCAAATGTTTTGGATGTCGCCAAAATTGGAATTGATGGGGCTCTACTCAAC
CCCAATATCACACAAATAACCGATGCATATCGTCGCATACATGAAGAGGTTGTAATTCAACCAGCTATCAAAGCC
GATGGTATCAGACCTGATGGGTCTTTCGGTCAGCATGGTGGTGTTCTCTACAACGGTAACTACGGCAAGGACTTT
ACAAACGACATCGTGGCCTTTGAAATTGAGGCGGCCGAGACACGTTTTGCTGCAAATTCCGAGTCTCGATCCGCT
CTTGCTCTTCTCTTCGAAGGTGACCATTGGATGATCTTTCGCAACACCGTCACGGGGGTGCTACACTGGGATTTT
TCTGCTCTTGGGCGATTTATCAGCTTTCCTGTCATTGATACTCAGGCCACCGGAAGTATCAAACTAAATCTTACT
CAGATTGATGTCCTTGGACGGCTTTGGGATCAACCGGCTCTTGTCCAATTTGCCGAAAGTCTTTCTGAACACGAC
ATGAATGCCAATGCAGGTCGGCTCATCGGCAATCGTATGTTCTACAACAACGACTACATGGTTCACCGTGGCCCG
AACTACGTTACTACTGTTAAGATGTATTCCACAAGAACAAAGTATGGTGAATGTCTAAACTCTCAGAATATATTG
GGTTTCCATCTCTCAGACGGAGCTGTATACACCTATTTGAAGGGCAATGAGTATGAAGATATTGCTGTCGCCTGG
GACTGGAACCTTATTCCGGGAATTACTACCGACTATGAAGCGACCAAACTTACTTGTTCCAGCGGCGTCACTGGG
ATTGAAGATTTCGTTGGTGGTGTGTCTAATGACGATACTGGTATCGCCGTCATGCGCTACACGAATCCCTTGACT
GGCGACTTGAATTGGCAAAAAGCGTGGTTTTTCCTCGAGGGCGACGTCCAACACACCATGATTTCCAATATCACA
TCCACATCCGACAGCCCTGTCTTCTCCGTACTTGACCAACGTCTCCATGATGACGCTATTTTCATGGATGACGGT
GAACCGTTCAGAGCCAATGATGGACCTACTCCTTTGTCTTCAGCGACGCTTTGGCATGGCGGGGTAGGTTATGAC
CTGTCGGGCCTTGGAGATGATGACATCCTCCACGTTGAGGTTGGTCCAAAGTCAGGGAACTGGTCAGCGATCGGT
ACTTCAACTGAACCACCATCAACATTTGACCTCTTCGCTGCCTGGATTGAACACGGAACGCCCGCATCATCTATT
TCCTATTCCACATTCCCCGGTACCAGTTTCACTGGTTTCATGGGCAAGCAGGCCAAGCTTCGTTTGCAATCTGTT
GTGAATGACGGGAGCGTGGGGGCCATATACGACGAGGAACACCAAACAGTAATGGTTGTGTTTTGGGAAGAAGAT
GGTGGTAGTGTTACAATCAGACCCCCGAGATTGGCCCCGATCACTATTAGCGCGGACGGCAACATAGCTCTGATT
TATCGGTTTTCAGACGCTGCAGTTTATGTGTCAGATCCTTCTCAAACACTTACGGAAGTACAAGTCAATTTGGAA
TTGGGTACGGGCTGGAAGCCACCATTCTGGGGTTTCCACAGGTCCAAAGACTTCAGTATATTCCTTCCAACGGGT
GGCCTAGCAGGTAGTAGCGTGCGCCAGCCATTGAATTAG
Gene >AgabiH97|006830
ATGAAGCCTCTCTTCAATCTCCCTCGTACTCTCTTTTTCCACGTCTCTTTGTTCCTTTCCCTCTTGGCGTGCCCC
GATCTGGTTTCAAGCGCGTCCACCTCTACATCATCCACCTCTTTATCCTCAACTCATGGCATTGTTGTGCCATCC
GGTTCTTCATCATCTCGGGTGCTTTCCTCGCTGACCACCTCACATGTACAATCTGCATCGTCCTCTTTGAGCACT
CGTATATCGCAGACATCTGCTACCGCCCCCAATTCATCCAAGATGACGACTATAGCCACTTCAACCTTTGTCAAT
CCTTCTTTGAATTCATCTGCCACAGCAACATCCACTGCTACGGTGACTACGCCTTCCGATCCCGCTATACTGGAA
GAAATAGAAATGTTGCGAACCCAAGTAATCGACATTATCATTGGCCCACTTGGTCAAGCGAGTGCAATACCTGCT
TGGTTTGTGTTGAACATTCTAACCAGGTCTCGAACAGCAATAGCTAATCCACGCTAGGCTGACATCCCTGGGTCC
TGATGGCAAATGGCCTGATAGTGAAGTTGACTATACAACTGGCTGCCCTGCCCGCCGGGCCAACTGGCCAGCCCA
GACACATTGGCAGCGTATTCGTGAGTTCTTGCTTGGGGCGATCGTGGAAAAGCCTTCTCATGAATTTTAGTCGTG
ATGGCAGCTGCATGGCACGGCGGATTACAAGGAGGGGAAAACTTCGTCGGAGATGAAAATCTCCGTAAGAAAACA
CTACTGGCTATAGACTATTGGTTCGGGCGTGATCTCACCAATCTTGAATGCATGATCAACGGTGGTACTCCGTCT
TGTCCATGTGATAATCCTGATAATACCCTGTGGTATGAAGATGCTGCATTGAAATAAGGGCCACTACTGAAATAT
TTTTTCAAGGAACACCAACTGGTTTTCTAATGTTCGTCGCTGTCTTCTGTTTAGCACCCATCACCAATTGATTGT
ACTAGGTTATACTGATTCCGAACCTCGTTGGGTCATCATGCATACTGTTGAACGAGACTTTGACCGCGGCACAGT
TGGATCACTGTACAAAAATAACCAACCGCTCATATGATCTCTTCTTGCGCCCATTTAATGAAGTCAACTTCCTGA
CAGGTGCAAATGTTTTGGATGTCGCCAAAATTGGAATTGATGGGGCTCTACTCAACCCCAATATCACACAAATAA
CCGATGCATATCGTCGCATACATGAAGAGGTTGTAATTCAACCAGCTATCAAAGCCGATGGTATCAGACCTGATG
GGTCTTTCGGTGCGATATCATCTGGATTCTGATTCCTTGTCTCATTTCTGTATTTCAGGTCAGCATGGTGGTGTT
CTCTACAACGGTAACTACGGTAAGTGGGGTTGATTGAGTTCATAATATGTTTCGTGTGCTCAGGTTTTTTGCAGG
CAAGGACTTGTGAGTGGAGAATTGAAATTGAGGAACTCTCATATTGATTCTTCGAAGTACAAACGACATCGTGGC
CTTTGAAATTGAGGCGGCCGAGACACGTTTTGCTGCAAATTCCGAGTCTCGATCCGCTCTTGCTCTTCTCTTCGA
AGGTGACCATTGGATGATCTTTCGCAACACCGTCACGGGGGTGCTACACTGGGATTTTGTGAGTACCTCACTAAT
CTCATTTGACTCTTACTCAGTCAGGTCTAGTCTGCTCTTGGGCGATTTATCAGCTTTCCTGTCATTGATACTCAG
TACGTTCTACTCTACTTTTTCCTATCAGATAAATGTAAAACCATCTCTTTAGGGCCACCGGAAGTATCAAACTAA
ATCTTACTCAGATTGATGTCCTTGGACGGCTTTGGGATCAACCGGCTCTTGTCCAATTTGCCGAAAGTCTTTCTG
AACACGACATGAATGCCAATGCAGGTCGGCTCATCGGCAATCGTATGTTCTACAACAACGACTACATGGTTAGCT
TCCTCGCCTCCAAGCCTAGATTCTGATTTATAGTTCGTCAGGTTCACCGTGGCCCGAACTACGTTACTACTGTTA
AGATGTATTCCACAAGAACAAAGTATGGTGAATGTCTAAACTCTCAGAATGTATGTATTGTTGGACTTCCATTGT
TCGGGCTCTCCTTCATCGATACTCCTTTAGATATTGGGTTTCCATCTCTCAGACGGAGCTGTATACACCTATTTG
AAGGGCAATGAGTATGAAGATATTGCTGTCGCCTGGGACTGGAACCTTATTCCGGGAATTACTACCGACTATGAA
GCGACCAAACTTACTTGTTCCAGCGGCGTCACTGGGATTGAAGATTTCGTTGGTGGTGTGTCTAATGACGATACT
GGTATCGCCGTCATGCGCTACACGAATCCCTTGACTGGCGACTTGAATTGGCAAAAAGCGTGGTTTTTCCTCGAG
GGCGACGTCCAACACACCATGATTTCCAATATCACATCCACATCCGACAGCCCTGTCTTCTCCGTACTTGACCAA
CGTCTCCATGATGACGCTATTTTCATGGATGACGGTGAACCGTTCAGAGCCAATGATGGACCTACTCCTTTGTCT
TCAGCGACGCTTTGGCATGGCGGGGTAGGTTATGACCTGTCGGGCCTTGGAGATGATGACATCCTCCACGTTGAG
GTTGGTCCAAAGTCAGGGAACTGGTCAGCGATCGGTACTTCAACTGAACCACCATCAACATTTGACCTCTTCGCT
GCCTGGATTGAACACGGAACGCCCGCATCATCTATTTCCTATTCCACATTCCCCGGTACCAGTTTCACTGGTTTC
ATGGGCAAGCAGGCCAAGCTTCGTTTGCAATCTGTTGTGAATGACGGGAGCGTGGGGGCCATATACGACGAGGAA
CACCAAACAGTAATGGTTGTGTTTTGGGAAGAAGATGGTGGTAGTGTTACAATCAGACCCCCGAGATTGGCCCCG
ATCACTATTAGCGCGGACGGCAACATAGCTCTGATTTATCGGTTTTCAGACGCTGCAGTTTATGTGTCAGATCCT
TCTCAAACACTTACGGAAGTACAAGTCAATTTGGAATTGGGTACGGGCTGGAAGCCACCATTCTGGGGTTTCCAC
AGGTCCAAAGACTTCAGTATATTCCTTCCAACGGGTGGCCTAGCAGGTAGTAGCGTGCGCCAGCCATTGAATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail