Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006820
Gene name
Locationscaffold_1:1650857..1653309
Strand-
Gene length (bp)2452
Transcript length (bp)2175
Coding sequence length (bp)2175
Protein length (aa) 725

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04006 Mpp10 Mpp10 protein 4.9E-104 91 665

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13910|MPP10_SCHPO U3 small nucleolar ribonucleoprotein protein mpp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpp10 PE=1 SV=1 97 701 4.0E-48
sp|P47083|MPP10_YEAST U3 small nucleolar RNA-associated protein MPP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPP10 PE=1 SV=1 410 723 6.0E-42
sp|O00566|MPP10_HUMAN U3 small nucleolar ribonucleoprotein protein MPP10 OS=Homo sapiens GN=MPHOSPH10 PE=1 SV=2 424 630 1.0E-35
sp|Q810V0|MPP10_MOUSE U3 small nucleolar ribonucleoprotein protein MPP10 OS=Mus musculus GN=Mphosph10 PE=1 SV=2 424 630 1.0E-34

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0034457 Mpp10 complex Yes
GO:0005634 nucleus Yes
GO:0005732 sno(s)RNA-containing ribonucleoprotein complex Yes
GO:0008152 metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0043229 intracellular organelle No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0005575 cellular_component No
GO:1901360 organic cyclic compound metabolic process No
GO:0006396 RNA processing No
GO:0016070 RNA metabolic process No
GO:0034470 ncRNA processing No
GO:0110165 cellular anatomical entity No
GO:1990904 ribonucleoprotein complex No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0043226 organelle No
GO:0043170 macromolecule metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0016072 rRNA metabolic process No
GO:0044238 primary metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043227 membrane-bounded organelle No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006820
MSTSEALPVPRELDNVTNLLDEHLDSLAYGSSLIQNAALQAAKHIFDTSLGTETQSKVSIDSLLSSLNTLQKPKT
RSQARADKSQPQTVLNKSFEPTPLSSLLIEGMDQEQVWMQLDLRSQMVCDLLDYALETGKSEEGSSDGEEDGEGE
DDDDRLQKIMEAIEEGKDIDLDDIREELGEDMDVDEESATEDDESESSENAVDDTEHIVQLRSDEEQSDNADAAI
TLFDAIKASSRPKRKKHADHGLNDDFFDLDAFNAEIEQAEAKSSSRGQLADEDEDSEDEDMSLDLFAPVDEEVDE
SEDTNDVFYRDFFEPPRNADSRSPAKISSNRKSRVRFHDEVRVKKIKAKGKNLPLNLLRGINTSDDDGDDGEGNI
DVDLENLENEDEGAWSEDEPMEDSEFSDASDEQTMERFKDDLFAEDEEKDEDDDMTTHEKQQAALREQIAQMEDE
NVAKKDWTLMGEADSRSRPQNSLLEEDLEFERVMKAAPVISEEVVQGLEQRIKARILDNRFDDVVRVRPLEDKPF
LPSRMLELQDTKSTQSLAQLYENDYLASQSGAGNKGDEKIKKQHEEIEKDWEKICSKLDALCNAHFVPKQPKAVI
STVSNVATASMESALPTAMATSSMLAPEEVFNPAGGETRSRSELTPSEKRALHTKQRKAKKKQRDILEKSRDKVT
TPAKSIGKVKKEKQTALNNIVKTGKGVTVVGKQAKSNSSSKGRPKSRTQ*
Coding >AgabiH97|006820
ATGTCGACATCCGAGGCTCTCCCTGTTCCTCGCGAACTCGATAATGTGACAAATCTGCTGGATGAGCATCTTGAT
TCTCTAGCATATGGGAGCAGCCTCATTCAGAATGCCGCATTACAAGCCGCAAAACATATTTTTGACACATCACTA
GGAACTGAAACGCAATCGAAAGTCTCTATAGACAGCCTCTTGTCATCATTGAATACACTTCAAAAACCTAAGACA
AGGTCCCAGGCAAGAGCAGACAAGTCACAGCCTCAGACCGTCCTGAACAAATCCTTTGAGCCTACACCTCTTTCG
TCTCTGCTGATTGAAGGCATGGATCAGGAACAAGTCTGGATGCAGCTTGATCTGCGTTCCCAGATGGTATGTGAT
CTACTGGATTATGCATTGGAAACCGGAAAGAGTGAGGAAGGGTCGTCGGATGGCGAAGAAGACGGCGAAGGAGAA
GATGATGATGATAGGCTCCAAAAAATCATGGAAGCTATTGAGGAGGGGAAAGATATTGACTTAGACGATATCCGC
GAAGAGCTTGGAGAAGACATGGACGTAGACGAAGAAAGTGCAACAGAAGATGACGAGAGTGAAAGCTCGGAAAAT
GCTGTTGACGACACAGAGCATATTGTTCAGCTGCGGTCGGATGAAGAGCAGTCTGATAACGCAGATGCAGCAATA
ACACTGTTTGATGCCATTAAGGCCAGTTCTAGGCCGAAAAGAAAAAAGCATGCAGACCATGGGCTCAACGACGAT
TTTTTTGACCTGGATGCGTTCAATGCAGAAATAGAACAGGCAGAGGCTAAGTCATCTTCCCGTGGGCAACTTGCA
GACGAAGACGAAGACTCAGAGGATGAAGATATGTCACTCGATTTGTTCGCGCCCGTTGATGAAGAGGTAGATGAG
TCTGAAGATACAAATGATGTGTTTTACCGTGACTTTTTTGAACCCCCAAGGAATGCGGACTCACGGTCCCCAGCC
AAAATCTCTTCCAATCGCAAGAGCAGAGTGCGCTTCCACGACGAAGTGAGGGTGAAGAAGATTAAAGCGAAAGGA
AAGAATCTACCTCTCAATCTGCTTCGGGGCATAAACACTTCAGATGACGATGGTGACGACGGTGAAGGCAACATT
GACGTTGATCTAGAAAACCTAGAGAACGAGGATGAAGGCGCTTGGTCCGAAGATGAACCAATGGAAGACAGCGAA
TTCTCAGACGCGTCGGATGAGCAGACCATGGAAAGGTTTAAAGACGACCTGTTTGCAGAGGATGAAGAGAAGGAT
GAAGATGATGATATGACAACTCACGAAAAGCAGCAAGCCGCTCTTCGAGAGCAGATAGCACAAATGGAGGACGAA
AATGTTGCAAAGAAGGACTGGACACTGATGGGAGAGGCAGACAGTCGGTCGAGGCCACAAAATTCACTGCTTGAA
GAGGACCTCGAGTTTGAGCGTGTAATGAAAGCAGCGCCTGTGATATCCGAGGAAGTTGTTCAAGGATTGGAGCAA
AGGATCAAAGCACGTATTCTCGACAACAGGTTCGATGACGTCGTACGAGTTCGTCCTTTAGAGGATAAGCCTTTT
CTACCGTCTCGTATGCTTGAACTTCAAGACACGAAATCCACACAATCCCTAGCACAACTGTACGAAAACGACTAT
CTAGCGAGCCAAAGCGGTGCAGGAAATAAAGGAGACGAGAAGATAAAGAAGCAACATGAGGAGATTGAGAAGGAC
TGGGAGAAAATTTGCAGCAAACTTGACGCCCTGTGCAACGCACATTTTGTTCCGAAACAGCCCAAAGCAGTAATT
TCAACAGTCTCTAATGTGGCTACGGCCTCGATGGAATCTGCACTTCCGACTGCAATGGCGACCTCGAGCATGCTT
GCTCCGGAAGAGGTCTTTAATCCAGCGGGAGGCGAAACACGCTCACGATCTGAGCTCACTCCTTCCGAAAAGAGA
GCCTTGCATACGAAACAACGCAAAGCGAAGAAAAAGCAGCGCGACATATTGGAGAAAAGTCGTGATAAAGTCACT
ACACCCGCCAAAAGCATAGGGAAAGTCAAGAAAGAAAAACAAACTGCGCTGAACAATATTGTCAAGACAGGCAAA
GGTGTCACCGTTGTAGGTAAACAGGCGAAGAGTAACTCGTCATCTAAGGGACGGCCGAAGTCTCGAACACAATAA
Transcript >AgabiH97|006820
ATGTCGACATCCGAGGCTCTCCCTGTTCCTCGCGAACTCGATAATGTGACAAATCTGCTGGATGAGCATCTTGAT
TCTCTAGCATATGGGAGCAGCCTCATTCAGAATGCCGCATTACAAGCCGCAAAACATATTTTTGACACATCACTA
GGAACTGAAACGCAATCGAAAGTCTCTATAGACAGCCTCTTGTCATCATTGAATACACTTCAAAAACCTAAGACA
AGGTCCCAGGCAAGAGCAGACAAGTCACAGCCTCAGACCGTCCTGAACAAATCCTTTGAGCCTACACCTCTTTCG
TCTCTGCTGATTGAAGGCATGGATCAGGAACAAGTCTGGATGCAGCTTGATCTGCGTTCCCAGATGGTATGTGAT
CTACTGGATTATGCATTGGAAACCGGAAAGAGTGAGGAAGGGTCGTCGGATGGCGAAGAAGACGGCGAAGGAGAA
GATGATGATGATAGGCTCCAAAAAATCATGGAAGCTATTGAGGAGGGGAAAGATATTGACTTAGACGATATCCGC
GAAGAGCTTGGAGAAGACATGGACGTAGACGAAGAAAGTGCAACAGAAGATGACGAGAGTGAAAGCTCGGAAAAT
GCTGTTGACGACACAGAGCATATTGTTCAGCTGCGGTCGGATGAAGAGCAGTCTGATAACGCAGATGCAGCAATA
ACACTGTTTGATGCCATTAAGGCCAGTTCTAGGCCGAAAAGAAAAAAGCATGCAGACCATGGGCTCAACGACGAT
TTTTTTGACCTGGATGCGTTCAATGCAGAAATAGAACAGGCAGAGGCTAAGTCATCTTCCCGTGGGCAACTTGCA
GACGAAGACGAAGACTCAGAGGATGAAGATATGTCACTCGATTTGTTCGCGCCCGTTGATGAAGAGGTAGATGAG
TCTGAAGATACAAATGATGTGTTTTACCGTGACTTTTTTGAACCCCCAAGGAATGCGGACTCACGGTCCCCAGCC
AAAATCTCTTCCAATCGCAAGAGCAGAGTGCGCTTCCACGACGAAGTGAGGGTGAAGAAGATTAAAGCGAAAGGA
AAGAATCTACCTCTCAATCTGCTTCGGGGCATAAACACTTCAGATGACGATGGTGACGACGGTGAAGGCAACATT
GACGTTGATCTAGAAAACCTAGAGAACGAGGATGAAGGCGCTTGGTCCGAAGATGAACCAATGGAAGACAGCGAA
TTCTCAGACGCGTCGGATGAGCAGACCATGGAAAGGTTTAAAGACGACCTGTTTGCAGAGGATGAAGAGAAGGAT
GAAGATGATGATATGACAACTCACGAAAAGCAGCAAGCCGCTCTTCGAGAGCAGATAGCACAAATGGAGGACGAA
AATGTTGCAAAGAAGGACTGGACACTGATGGGAGAGGCAGACAGTCGGTCGAGGCCACAAAATTCACTGCTTGAA
GAGGACCTCGAGTTTGAGCGTGTAATGAAAGCAGCGCCTGTGATATCCGAGGAAGTTGTTCAAGGATTGGAGCAA
AGGATCAAAGCACGTATTCTCGACAACAGGTTCGATGACGTCGTACGAGTTCGTCCTTTAGAGGATAAGCCTTTT
CTACCGTCTCGTATGCTTGAACTTCAAGACACGAAATCCACACAATCCCTAGCACAACTGTACGAAAACGACTAT
CTAGCGAGCCAAAGCGGTGCAGGAAATAAAGGAGACGAGAAGATAAAGAAGCAACATGAGGAGATTGAGAAGGAC
TGGGAGAAAATTTGCAGCAAACTTGACGCCCTGTGCAACGCACATTTTGTTCCGAAACAGCCCAAAGCAGTAATT
TCAACAGTCTCTAATGTGGCTACGGCCTCGATGGAATCTGCACTTCCGACTGCAATGGCGACCTCGAGCATGCTT
GCTCCGGAAGAGGTCTTTAATCCAGCGGGAGGCGAAACACGCTCACGATCTGAGCTCACTCCTTCCGAAAAGAGA
GCCTTGCATACGAAACAACGCAAAGCGAAGAAAAAGCAGCGCGACATATTGGAGAAAAGTCGTGATAAAGTCACT
ACACCCGCCAAAAGCATAGGGAAAGTCAAGAAAGAAAAACAAACTGCGCTGAACAATATTGTCAAGACAGGCAAA
GGTGTCACCGTTGTAGGTAAACAGGCGAAGAGTAACTCGTCATCTAAGGGACGGCCGAAGTCTCGAACACAATAA
Gene >AgabiH97|006820
ATGTCGACATCCGAGGCTCTCCCTGTTCCTCGCGAACTCGATAATGTGACAAATCTGCTGGATGAGCATCTTGAT
TCTCTAGCATATGGGAGCAGCCTCATTCAGAATGCCGCATTACAAGCCGCAAAACATATTTTTGACACATGTACG
TTTTATATTCATCTTCTACAGGCCTCCCTAAATAACATCATTAGCACTAGGAACTGAAACGCAATCGAAAGTCTC
TATAGACAGCCTCTTGTCATCATTGAATACACTTCAAAAACCTAAGACAAGGTCCCAGGCAAGAGCAGACAAGTC
ACAGCCTCAGACCGTCCTGAACAAATCCTTTGAGCCTACACCTCTTTCGTCTCTGCTGATTGAAGGCATGGATCA
GGAACAAGTCTGGATGCAGCTTGATCTGCGTTCCCAGATGGTATGTGATCTACTGGATTATGCATTGGAAACCGG
AAAGAGTGAGGAAGGGTCGTCGGATGGCGAAGAAGACGGCGAAGGAGAAGATGATGATGATAGGCTCCAAAAAAT
CATGGAAGCTATTGAGGAGGGGAAAGATATTGACTTAGACGATATCCGCGAAGAGCTTGGAGAAGACATGGACGT
AGACGAAGAAAGTGCAACAGAAGATGACGAGAGTGAAAGCTCGGAAAATGCTGTTGACGACACAGAGCATATTGT
TCAGCTGCGGTCGGATGAAGAGCAGTCTGATAACGCAGATGCAGCAATAACACTGTTTGATGCCATTAAGGCCAG
TTCTAGGCCGAAAAGAAAAAAGCATGCAGACCATGGGCTCAACGACGATTTTTTTGACCTGGATGCGTTCAATGC
AGAAATAGAACAGGCAGAGGCTAAGTCATCTTCCCGTGGGCAACTTGCAGACGAAGACGAAGACTCAGAGGATGA
AGATATGTCACTCGATTTGTTCGCGCCCGTTGATGAAGAGGTAGATGAGTCTGAAGATACAAATGGTGCAAATTC
TATCTTGGTGTGTGTGTGCCTGAGTGCGAGCAATACTAAGAATCGTCTGTAGATGTGTTTTACCGTGACTTTTTT
GAACCCCCAAGGAATGCGGACTCACGGTCCCCAGCCAAAATCTCTTCCAATCGCAAGAGCAGAGTGCGCTTCCAC
GACGAAGTGAGGGTGAAGAAGATTAAAGCGAAAGGAAAGAATCTACCTCTCAATCTGCTTCGGGGCATAAACACT
TCAGATGACGATGGTGACGACGGTGAAGGCAACATTGACGTTGATCTAGAAAACCTAGAGAACGAGGATGAAGGC
GCTTGGTCCGAAGATGAACCAATGGAAGACAGCGAATTCTCAGACGCGTCGGATGAGCAGGCCAGTGAAGGGTTC
TCCTCCTCGCAGAGCCGGGCTTCTGACGAGGATGACAATCAGACCATGGAAAGGTTTAAAGACGACCTGTTTGCA
GAGGATGAAGAGAAGGATGAAGATGATGGTGTGCTCCTGAATAATTAGGTTTAAACAAAAGAGATATTGACTCTT
CCTTTCGGTAGATATGACAACTCACGAAAAGCAGCAAGCCGCTCTTCGAGAGCAGATAGCACAAATGGAGGACGA
AAATGTTGCAAAGAAGGACTGGACACTGATGGGAGAGGCAGACAGTCGGTCGAGGCCACAAAATTCACTGCTTGA
AGAGGACCTCGAGTTTGAGCGTGTAATGAAAGCAGCGCCTGTGATATCCGAGGAAGTTGTTCAAGGATTGGAGCA
AAGGATCAAAGCACGTATTCTCGACAACAGGTTCGATGACGTCGTACGAGTTCGTCCTTTAGAGGATAAGCCTTT
TCTACCGTCTCGTATGCTTGAACTTCAAGACACGAAATCCACACAATCCCTAGCACAACTGTACGAAAACGACTA
TCTAGCGAGCCAAAGCGGTGCAGGAAATAAAGGAGACGAGAAGATAAAGAAGCAACATGAGGAGATTGAGAAGGA
CTGGGAGAAAATTTGCAGCAAACTTGACGCCCTGTGCAACGCACATTTTGTTCCGAAACAGGTACGTCTGTGATT
TTGGCGGATTTCCCTCGCGTTGCTGAGAAGTGCCCAGCCCAAAGCAGTAATTTCAACAGTCTCTAATGTGGCTAC
GGCCTCGATGGAATCTGCACTTCCGACTGCAATGGCGACCTCGAGCATGCTTGCTCCGGAAGAGGTCTTTAATCC
AGCGGGAGGCGAAACACGCTCACGATCTGAGCTCACTCCTTCCGAAAAGAGAGCCTTGCATACGAAACAACGCAA
AGCGAAGAAAAAGCAGCGCGACATATTGGAGAAAAGTCGTGATAAAGTCACTACACCCGCCAAAAGCATAGGGAA
AGTCAAGAAAGAAAAACAAACTGCGCTGAACAATATTGTCAAGACAGGCAAAGGTGTCACCGTTGTAGGTAAACA
GGCGAAGAGTAACTCGTCATCTAAGGGACGGCCGAAGTCTCGAACACAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail