Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006800
Gene name
Locationscaffold_1:1647752..1649256
Strand-
Gene length (bp)1504
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02182 SAD_SRA SAD/SRA domain 3.0E-50 129 288

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 129 289 2.0E-34
sp|Q680I0|ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana GN=ORTH5 PE=2 SV=1 134 289 3.0E-34
sp|Q9C8E1|ORTH4_ARATH Putative E3 ubiquitin-protein ligase ORTHRUS 4 OS=Arabidopsis thaliana GN=ORTH4 PE=3 SV=1 134 289 3.0E-34
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 129 289 4.0E-34
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 115 295 7.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FKA7|ORTH1_ARATH E3 ubiquitin-protein ligase ORTHRUS 1 OS=Arabidopsis thaliana GN=ORTH1 PE=1 SV=1 129 289 2.0E-34
sp|Q680I0|ORTH5_ARATH E3 ubiquitin-protein ligase ORTHRUS 5 OS=Arabidopsis thaliana GN=ORTH5 PE=2 SV=1 134 289 3.0E-34
sp|Q9C8E1|ORTH4_ARATH Putative E3 ubiquitin-protein ligase ORTHRUS 4 OS=Arabidopsis thaliana GN=ORTH4 PE=3 SV=1 134 289 3.0E-34
sp|Q96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens GN=UHRF1 PE=1 SV=1 129 289 4.0E-34
sp|Q7TPK1|UHRF1_RAT E3 ubiquitin-protein ligase UHRF1 OS=Rattus norvegicus GN=Uhrf1 PE=1 SV=2 115 295 7.0E-33
sp|Q8VDF2|UHRF1_MOUSE E3 ubiquitin-protein ligase UHRF1 OS=Mus musculus GN=Uhrf1 PE=1 SV=2 115 295 8.0E-33
sp|Q8VYZ0|ORTH2_ARATH E3 ubiquitin-protein ligase ORTHRUS 2 OS=Arabidopsis thaliana GN=ORTH2 PE=1 SV=1 126 289 2.0E-32
sp|A7E320|UHRF1_BOVIN E3 ubiquitin-protein ligase UHRF1 OS=Bos taurus GN=UHRF1 PE=2 SV=1 129 284 5.0E-32
sp|B6CHA3|UHRF1_XENLA E3 ubiquitin-protein ligase UHRF1 OS=Xenopus laevis GN=uhrf1 PE=2 SV=1 129 292 7.0E-32
sp|F6UA42|UHRF1_XENTR E3 ubiquitin-protein ligase UHRF1 OS=Xenopus tropicalis GN=uhrf1 PE=3 SV=2 129 292 1.0E-31
sp|E7EZF3|UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio GN=uhrf1 PE=1 SV=1 129 284 3.0E-31
sp|Q7TMI3|UHRF2_MOUSE E3 ubiquitin-protein ligase UHRF2 OS=Mus musculus GN=Uhrf2 PE=1 SV=1 129 292 4.0E-30
sp|Q96PU4|UHRF2_HUMAN E3 ubiquitin-protein ligase UHRF2 OS=Homo sapiens GN=UHRF2 PE=1 SV=1 129 292 1.0E-29
sp|Q681I0|ORTHL_ARATH E3 ubiquitin-protein ligase ORTHRUS-LIKE 1 OS=Arabidopsis thaliana GN=ORTHL PE=2 SV=1 108 289 2.0E-26
sp|Q9FVS2|ORTH3_ARATH E3 ubiquitin-protein ligase ORTHRUS 3 OS=Arabidopsis thaliana GN=ORTH3 PE=3 SV=2 134 289 7.0E-25
sp|Q8GZB6|SUVH4_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH4 OS=Arabidopsis thaliana GN=SUVH4 PE=1 SV=2 127 291 2.0E-19
sp|O82175|SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana GN=SUVH5 PE=1 SV=1 127 295 1.0E-17
sp|Q8VZ17|SUVH6_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH6 OS=Arabidopsis thaliana GN=SUVH6 PE=2 SV=2 128 291 1.0E-16
sp|Q5QD03|SUVH3_CHLRE Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Chlamydomonas reinhardtii GN=SUVH3 PE=2 SV=1 129 297 2.0E-14
sp|Q9FF80|SUVH1_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Arabidopsis thaliana GN=SUVH1 PE=2 SV=1 115 290 2.0E-12
sp|Q9T0G7|SUVH9_ARATH Histone-lysine N-methyltransferase family member SUVH9 OS=Arabidopsis thaliana GN=SUVH9 PE=1 SV=1 109 288 6.0E-10
sp|Q9C5P4|SUVH3_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH3 OS=Arabidopsis thaliana GN=SUVH3 PE=2 SV=2 119 290 5.0E-09
sp|Q93YF5|SUVH1_TOBAC Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1 OS=Nicotiana tabacum GN=SUVH1 PE=1 SV=1 115 289 2.0E-08
sp|Q9FHI0|YDG1_ARATH YDG domain-containing protein At5g47150 OS=Arabidopsis thaliana GN=At5g47150 PE=2 SV=1 120 291 4.0E-08
sp|O22781|SUVH2_ARATH Histone-lysine N-methyltransferase family member SUVH2 OS=Arabidopsis thaliana GN=SUVH2 PE=1 SV=1 124 291 5.0E-08
sp|Q9C5P1|SUVH7_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH7 OS=Arabidopsis thaliana GN=SUVH7 PE=2 SV=1 104 290 2.0E-07
sp|Q9LVU3|YDG2_ARATH YDG domain-containing protein At5g47160 OS=Arabidopsis thaliana GN=At5g47160 PE=2 SV=1 117 284 5.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2079 0.9491 0.0206 0.0112 0.0731 0.0411 0.0239 0.0158 0.0195 0.007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 19.98 9.83 30.14
Initials Initials knots 21.11 10.92 31.30
Pileal_Stipeal_center Stage I stipe center 49.03 27.51 70.56
Pileal_Stipeal_shell Stage I stipe shell 88.75 52.56 124.94
DIF_stipe_center Stage II stipe center 63.92 37.43 90.40
DIF_stipe_shell Stage II stipe shell 37.02 20.53 53.51
DIF_stipe_skin Stage II stipe skin 33.67 18.67 48.66
DIF_cap_skin Stage II cap skin 69.43 40.45 98.40
DIF_cap_tissue Stage II cap tissue 99.59 59.76 139.42
DIF_gill_tissue Stage II gill tissue 108.23 65.23 151.24
YFB_stipe_center Young fruiting body stipe center 32.27 17.09 47.45
YFB_stipe_shell Young fruiting body stipe shell 24.07 12.51 35.63
YFB_stipe_skin Young fruiting body stipe skin 23.14 11.94 34.33
YFB_cap_skin Young fruiting body cap skin 45.78 26.34 65.23
YFB_cap_tissue Young fruiting body cap tissue 69.60 41.15 98.05
YFB_gill_tissue Young fruiting body gill tissue 50.60 27.94 73.26
YFB_veil Young fruiting body veil 76.93 45.97 107.89

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.175906 no
Casing YFB_stipe_shell 0.707008 no
Casing YFB_stipe_skin 0.781693 no
Casing YFB_cap_skin 0.007439 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.004928 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.934109 no
Casing Pileal_Stipeal_center 0.005302 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.063760 no
Casing DIF_stipe_skin 0.120521 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.000613 yes
DIF_gill_tissue YFB_cap_tissue 0.110389 no
DIF_gill_tissue YFB_gill_tissue 0.004548 yes
DIF_gill_tissue YFB_veil 0.264618 no
YFB_stipe_center YFB_stipe_shell 0.454492 no
YFB_stipe_center YFB_stipe_skin 0.371980 no
YFB_stipe_center YFB_cap_skin 0.307094 no
YFB_stipe_center YFB_cap_tissue 0.004928 yes
YFB_stipe_center YFB_gill_tissue 0.153274 no
YFB_stipe_center YFB_veil 0.001625 yes
YFB_stipe_shell YFB_stipe_skin 0.951918 no
YFB_stipe_shell YFB_cap_skin 0.029408 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.011350 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.016386 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.006387 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.155303 no
YFB_cap_skin YFB_gill_tissue 0.844727 no
YFB_cap_skin YFB_veil 0.065086 no
YFB_cap_tissue YFB_gill_tissue 0.336412 no
YFB_cap_tissue YFB_veil 0.827726 no
YFB_gill_tissue YFB_veil 0.169066 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.224483 no
Initials YFB_stipe_shell 0.806738 no
Initials YFB_stipe_skin 0.877058 no
Initials YFB_cap_skin 0.007439 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.003765 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.003765 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.084017 no
Initials DIF_stipe_skin 0.162495 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.001625 yes
Pileal_Stipeal_center YFB_stipe_center 0.202801 no
Pileal_Stipeal_center YFB_stipe_shell 0.012577 yes
Pileal_Stipeal_center YFB_stipe_skin 0.009773 yes
Pileal_Stipeal_center YFB_cap_skin 0.900315 no
Pileal_Stipeal_center YFB_cap_tissue 0.276041 no
Pileal_Stipeal_center YFB_gill_tissue 0.957899 no
Pileal_Stipeal_center YFB_veil 0.133853 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.032266 yes
Pileal_Stipeal_center DIF_stipe_center 0.468341 no
Pileal_Stipeal_center DIF_stipe_shell 0.455839 no
Pileal_Stipeal_center DIF_stipe_skin 0.262171 no
Pileal_Stipeal_center DIF_cap_skin 0.291240 no
Pileal_Stipeal_center DIF_cap_tissue 0.007439 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.592355 no
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.008791 yes
Pileal_Stipeal_shell YFB_cap_tissue 0.483441 no
Pileal_Stipeal_shell YFB_gill_tissue 0.041164 yes
Pileal_Stipeal_shell YFB_veil 0.731701 no
Pileal_Stipeal_shell DIF_stipe_center 0.303175 no
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.485147 no
Pileal_Stipeal_shell DIF_cap_tissue 0.794355 no
DIF_stipe_center DIF_gill_tissue 0.050908 no
DIF_stipe_center YFB_stipe_center 0.019442 yes
DIF_stipe_center YFB_stipe_shell 0.000613 yes
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.311935 no
DIF_stipe_center YFB_cap_tissue 0.863795 no
DIF_stipe_center YFB_gill_tissue 0.540966 no
DIF_stipe_center YFB_veil 0.639198 no
DIF_stipe_center DIF_stipe_shell 0.065833 no
DIF_stipe_center DIF_stipe_skin 0.022631 yes
DIF_stipe_center DIF_cap_skin 0.868156 no
DIF_stipe_center DIF_cap_tissue 0.113810 no
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.781518 no
DIF_stipe_shell YFB_stipe_shell 0.208910 no
DIF_stipe_shell YFB_stipe_skin 0.152734 no
DIF_stipe_shell YFB_cap_skin 0.606170 no
DIF_stipe_shell YFB_cap_tissue 0.025205 yes
DIF_stipe_shell YFB_gill_tissue 0.386814 no
DIF_stipe_shell YFB_veil 0.009123 yes
DIF_stipe_shell DIF_stipe_skin 0.859476 no
DIF_stipe_shell DIF_cap_skin 0.030610 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.944954 no
DIF_stipe_skin YFB_stipe_shell 0.362895 no
DIF_stipe_skin YFB_stipe_skin 0.288288 no
DIF_stipe_skin YFB_cap_skin 0.389862 no
DIF_stipe_skin YFB_cap_tissue 0.007092 yes
DIF_stipe_skin YFB_gill_tissue 0.207281 no
DIF_stipe_skin YFB_veil 0.002084 yes
DIF_stipe_skin DIF_cap_skin 0.009773 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.119615 no
DIF_cap_skin YFB_stipe_center 0.006387 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.171933 no
DIF_cap_skin YFB_cap_tissue 0.995820 no
DIF_cap_skin YFB_gill_tissue 0.352683 no
DIF_cap_skin YFB_veil 0.827477 no
DIF_cap_skin DIF_cap_tissue 0.236585 no
DIF_cap_tissue DIF_gill_tissue 0.861769 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.001625 yes
DIF_cap_tissue YFB_cap_tissue 0.228475 no
DIF_cap_tissue YFB_gill_tissue 0.010093 yes
DIF_cap_tissue YFB_veil 0.441575 no

Orthologs

Orthofinder run ID1
Orthogroup524
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|006800
Agaricus bisporus var bisporus H39 AgabiH39|024350
Agaricus bisporus var bisporus H97 AgabiH97|006800 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|024350
Rhodonia placenta FPRL280 RhoplFPRL280|159_10
Rhodonia placenta FPRL280 RhoplFPRL280|261_10

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006800
MVSPYERQKELQIAKNKELLKSLGLEKPLFEPKEKPRKKATPQKRKRTDEDTENIEPSARKLQRAEDSSESGTLS
TGLRRSSRNAGKAVDYSGERTLSLPQSVIRNKTSGNDGPMGREDGKRVHNPKTYGHIPGIAVGTWWLSRQDCSQD
AVHAPWVGGISGGRQGAYSVALSGGYDDDVDLGYGFTYTGSGGRDLHGTKDKPKNLRTAPQSSDQSFEHSFNQML
KVSSETRNPVRVVRGFKLQSKYAPSEGYRYDGLYVVEKAFMEKGNNAKGYLVCRYVFKRLPDQPPLPVREDYEDL
DSVEESSAEED*
Coding >AgabiH97|006800
ATGGTGTCCCCCTATGAAAGGCAGAAGGAACTACAAATAGCCAAGAATAAAGAGCTATTGAAAAGTCTCGGTCTC
GAAAAACCTTTATTTGAACCGAAAGAAAAACCCAGGAAAAAAGCTACACCACAAAAGCGCAAGAGAACCGACGAA
GACACGGAAAACATAGAACCCTCAGCACGGAAACTCCAACGCGCTGAAGATTCCAGTGAGAGTGGAACCTTGTCC
ACAGGTCTTCGTCGCAGTTCTCGCAACGCTGGAAAAGCGGTCGATTACTCTGGCGAAAGAACGTTGAGTTTACCT
CAATCTGTCATACGCAACAAAACTTCGGGCAATGATGGGCCTATGGGACGCGAAGATGGAAAGCGCGTACATAAC
CCCAAAACATACGGCCACATCCCCGGTATTGCTGTTGGAACATGGTGGCTTTCAAGACAGGATTGTAGCCAGGAT
GCAGTTCATGCGCCGTGGGTAGGTGGTATATCAGGGGGTCGTCAGGGAGCGTACAGTGTCGCCCTCAGCGGAGGT
TACGATGATGACGTCGACCTTGGATATGGATTCACGTACACTGGTTCTGGTGGTCGTGATCTCCATGGGACAAAG
GACAAACCTAAAAATCTTCGTACAGCTCCACAAAGCTCTGACCAAAGTTTTGAGCACTCGTTCAACCAGATGCTG
AAGGTTTCGTCCGAAACCAGAAACCCAGTTCGCGTTGTGCGTGGTTTCAAGCTTCAATCTAAATATGCTCCAAGT
GAAGGATACCGCTACGATGGATTATATGTAGTGGAAAAGGCCTTCATGGAGAAAGGAAACAATGCGAAAGGATAT
CTTGTTTGCAGATACGTATTTAAGCGTTTACCGGATCAACCCCCTTTGCCAGTTAGAGAGGATTACGAAGACTTG
GATTCAGTAGAGGAATCATCGGCGGAAGAAGATTAG
Transcript >AgabiH97|006800
ATGGTGTCCCCCTATGAAAGGCAGAAGGAACTACAAATAGCCAAGAATAAAGAGCTATTGAAAAGTCTCGGTCTC
GAAAAACCTTTATTTGAACCGAAAGAAAAACCCAGGAAAAAAGCTACACCACAAAAGCGCAAGAGAACCGACGAA
GACACGGAAAACATAGAACCCTCAGCACGGAAACTCCAACGCGCTGAAGATTCCAGTGAGAGTGGAACCTTGTCC
ACAGGTCTTCGTCGCAGTTCTCGCAACGCTGGAAAAGCGGTCGATTACTCTGGCGAAAGAACGTTGAGTTTACCT
CAATCTGTCATACGCAACAAAACTTCGGGCAATGATGGGCCTATGGGACGCGAAGATGGAAAGCGCGTACATAAC
CCCAAAACATACGGCCACATCCCCGGTATTGCTGTTGGAACATGGTGGCTTTCAAGACAGGATTGTAGCCAGGAT
GCAGTTCATGCGCCGTGGGTAGGTGGTATATCAGGGGGTCGTCAGGGAGCGTACAGTGTCGCCCTCAGCGGAGGT
TACGATGATGACGTCGACCTTGGATATGGATTCACGTACACTGGTTCTGGTGGTCGTGATCTCCATGGGACAAAG
GACAAACCTAAAAATCTTCGTACAGCTCCACAAAGCTCTGACCAAAGTTTTGAGCACTCGTTCAACCAGATGCTG
AAGGTTTCGTCCGAAACCAGAAACCCAGTTCGCGTTGTGCGTGGTTTCAAGCTTCAATCTAAATATGCTCCAAGT
GAAGGATACCGCTACGATGGATTATATGTAGTGGAAAAGGCCTTCATGGAGAAAGGAAACAATGCGAAAGGATAT
CTTGTTTGCAGATACGTATTTAAGCGTTTACCGGATCAACCCCCTTTGCCAGTTAGAGAGGATTACGAAGACTTG
GATTCAGTAGAGGAATCATCGGCGGAAGAAGATTAG
Gene >AgabiH97|006800
ATGGTGTCCCCCTATGAAAGGCAGAAGGAACTACAAATAGCCAAGGCTTGTATTTGATTATGCCCTGAAACTTAT
AATCCTGACAAGGGCCTCAGAATAAAGAGCTATTGAAAAGTCTCGGTCTCGAAAAACCTTTATTTGAACCGAAAG
AAAAACCCAGGAAAAAAGCTACACCACAAAAGCGCAAGAGAACCGACGAAGACACGGAAAACATAGAACCCTCAG
CACGGAAACTCCAACGCGCTGAAGATTCCAGTGAGAGTGGAACCTTGTCCACAGGTCTTCGTCGCAGTTCTCGCA
ACGCTGGAAAAGCGGTCGATTACTCTGGCGAAAGAACGTTGAGTTTACCTCAATCTGTCATACGCAACAAAACTT
CGGGCAATGATGGGCCTATGGGACGCGAAGATGGAAAGCGCGTACATAACCCGTGAGTTGGTCGATTGCACCTCC
CCGGGTTGAATTCCTAATTTCACCAAACTAGCAAAACATACGGCCACATCCCCGGTATTGCTGTTGGAACATGGT
GGCTTTCAAGACAGGATTGTAGCCAGGATGCAGTTCATGCGTAAGTTATTTTATTAGACTTTAACCCATTATTCA
GCGTTGTTTTTTCGATAGGCCGTGGGTAGGTGGTATATCAGGGGGTCGTCAGGGAGCGTACAGTGTCGCCCTCAG
CGGAGGTTACGATGATGACGTCGACCTTGGATATGGATTGTAAGTTTTTTTTTTCTATGGCACTGATGTATGCTA
AGTCTCGCTCTATAGCACGTACACTGGTTCTGGTAGGAAGAGCTATGTTGTTTTATGTCCATATTTGACGTGTTT
CAGGTGGTCGTGATCTCCATGGGACAAAGGACAAACCTAAAAATGTGAGAATACCTATGCCCCCTTGTTAAGCAT
ACTGATTCAAACACTTCGTTAAGCTTCGTACAGCTCCACAAAGCTCTGACCAAAGTTTTGAGCACTCGGTATGCA
ACAATGTACTTTAGTGTATTTCTGCTGCTAACAAGTCATTGATCACTAGTTCAACCAGATGCTGAAGGTGATATA
TCCTCGAATGAATGACCAGATACACTGGATGCTAAACTACTTTTAAAGGTTTCGTCCGAAACCAGAAACCCAGTT
CGCGTTGTGCGTGGTTTCAAGCTTCAATCTAAATATGCTCCAAGTGAAGGGTTAGTCGAACATCTTGTCTCCCGA
CCTGCAAACTGATCCCAATCCACTTAGATACCGCTACGATGGATTATATGTAGTGGAAAAGGTGGGCGACTCATT
TTCTTATGACACGTCTTCTGAGAGACTTTAGGCCTTCATGGAGAAAGGAAACAATGCGAAAGGATATCTTGTTTG
CAGATACGTATTTAAGGTTTGTCTCGAAGTGCGTGCGGAAATTGCGTATCTGAGAACCATATTCCAGCGTTTACC
GGATCAACCCCCTTTGCCAGTTAGAGAGGATTACGAAGACTTGGATTCAGTAGAGGAATCATCGGCGGAAGAAGA
TTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail