Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006770
Gene name
Locationscaffold_1:1643191..1643701
Strand-
Gene length (bp)510
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.0965 0.0895 0.8859 0.279 0.0676 0.0037 0.3395 0.1608 0.1733 0.0035

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999733

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup7631
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|006770
Agaricus bisporus var bisporus H97 AgabiH97|006770 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|1_215

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006770
MALFFFLLFYPLLILAQNASQPNQTVVTSTSLSTVVGLGPNRQTTTGTSTFVFVNTLTPAPQPSGNGTNGNNTQS
GNSTVSSNSTSKAPPLPTAPTNIEGGGQNGAPLPGQTGVGGNMGPDDNYIAAATALKHNAFAVGVMGVVLGGAMV
VF*
Coding >AgabiH97|006770
ATGGCCCTTTTCTTTTTCCTCCTCTTCTACCCCCTCCTCATCCTCGCCCAGAATGCCTCGCAGCCAAACCAGACC
GTCGTCACGTCGACCTCTCTCTCCACCGTCGTCGGCCTCGGCCCAAACAGACAAACCACCACTGGCACAAGCACC
TTTGTCTTCGTCAATACCCTCACTCCCGCACCCCAGCCTTCTGGAAACGGCACCAACGGCAACAACACTCAGTCG
GGCAACAGCACCGTATCGAGCAACAGCACATCAAAAGCACCTCCTCTTCCCACCGCTCCAACTAACATCGAGGGC
GGCGGTCAAAATGGTGCACCCTTGCCTGGGCAGACGGGAGTAGGGGGTAATATGGGCCCCGATGACAACTACATC
GCTGCAGCCACAGCCCTCAAACACAACGCCTTTGCCGTGGGCGTGATGGGAGTTGTGCTGGGCGGTGCCATGGTC
GTATTCTAG
Transcript >AgabiH97|006770
ATGGCCCTTTTCTTTTTCCTCCTCTTCTACCCCCTCCTCATCCTCGCCCAGAATGCCTCGCAGCCAAACCAGACC
GTCGTCACGTCGACCTCTCTCTCCACCGTCGTCGGCCTCGGCCCAAACAGACAAACCACCACTGGCACAAGCACC
TTTGTCTTCGTCAATACCCTCACTCCCGCACCCCAGCCTTCTGGAAACGGCACCAACGGCAACAACACTCAGTCG
GGCAACAGCACCGTATCGAGCAACAGCACATCAAAAGCACCTCCTCTTCCCACCGCTCCAACTAACATCGAGGGC
GGCGGTCAAAATGGTGCACCCTTGCCTGGGCAGACGGGAGTAGGGGGTAATATGGGCCCCGATGACAACTACATC
GCTGCAGCCACAGCCCTCAAACACAACGCCTTTGCCGTGGGCGTGATGGGAGTTGTGCTGGGCGGTGCCATGGTC
GTATTCTAG
Gene >AgabiH97|006770
ATGGCCCTTTTCTTTTTCCTCCTCTTCTACCCCCTCCTCATCCTCGCCCAGGTACGCTGACTCCCTCTCCTTCAT
CCCCCAGACGCTCACAGCACACTCCAGAATGCCTCGCAGCCAAACCAGACCGTCGTCACGTCGACCTCTCTCTCC
ACCGTCGTCGGCCTCGGCCCAAACAGACAAACCACCACTGGCACAAGCACCTTTGTCTTCGTCAATACCCTCACT
CCCGCACCCCAGCCTTCTGGAAACGGCACCAACGGCAACAACACTCAGTCGGGCAACAGCACCGTATCGAGCAAC
AGCACATCAAAAGCACCTCCTCTTCCCACCGCTCCAACTAACATCGAGGGCGGCGGTCAAAATGGTGCACCCTTG
CCTGGGCAGACGGGAGTAGGGGGTAATATGGGCCCCGATGACAACTACATCGCTGCAGCCACAGCCCTCAAACAC
AACGCCTTTGCCGTGGGCGTGATGGGAGTTGTGCTGGGCGGTGCCATGGTCGTATTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail