Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006720
Gene name
Locationscaffold_1:1635586..1637338
Strand-
Gene length (bp)1752
Transcript length (bp)1113
Coding sequence length (bp)1113
Protein length (aa) 371

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.6E-06 95 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 1 334 3.0E-75
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 44 334 2.0E-61
sp|B0XTU6|EGLX_ASPFC Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_029980 PE=3 SV=1 44 334 2.0E-61
sp|A2QBQ3|EGLX_ASPNC Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g00850 PE=3 SV=1 44 334 9.0E-61
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 40 335 4.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 1 334 3.0E-75
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 44 334 2.0E-61
sp|B0XTU6|EGLX_ASPFC Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_029980 PE=3 SV=1 44 334 2.0E-61
sp|A2QBQ3|EGLX_ASPNC Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g00850 PE=3 SV=1 44 334 9.0E-61
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 40 335 4.0E-60
sp|A1C7B5|EGLX_ASPCL Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_073210 PE=3 SV=1 44 334 1.0E-58
sp|A1DHY9|EGLX_NEOFI Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089530 PE=3 SV=1 44 334 1.0E-58
sp|Q2UIE6|EGLX_ASPOR Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090023000083 PE=3 SV=1 34 334 2.0E-58
sp|B8N7S7|EGLX_ASPFN Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_105200 PE=3 SV=1 34 334 3.0E-56
sp|Q5BAP5|EGLX_EMENI Endo-1,3(4)-beta-glucanase xgeA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xgeA PE=3 SV=1 43 334 4.0E-56
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006720
MLAALPHCLLILVISHLQCTSARTTLSTRNTDPDGTTFLWLPQDDYSGSSFFDRWDFFTGEDPTHGIVNYTTRDD
AYASGLVYAQEDGTVIMKGDNTTHLDHGVPRKSVRISSWAKYNGGLFVLDLKKAPWGCGVWPAFWTLGSGNWPYT
GEIDIIEGVHDNEHNQVAFHTGPGCLLNPTADFTGTVLMRDGKNNTECNGLINDNSGCGIVEWSRASYGPFFDSQ
GGGVFVMKWDDMGIAIWSFYRQAVPEDLTQGTPDPSKWGPPVAALDPTNCNMEQYFSNHSIIFDITFCGDWAGNS
YASTTCPGTCTERLMDPNNFVNATWIINDLKVYRKQELDGIVGANAGTINPRNWIGILFAISSVLFMQGM*
Coding >AgabiH97|006720
ATGTTAGCGGCGCTTCCTCATTGTTTGCTTATCCTCGTCATTTCACATCTACAATGCACGTCCGCTAGGACTACT
CTGAGCACACGGAACACGGATCCTGATGGTACAACCTTTCTCTGGTTGCCTCAGGATGATTATTCAGGTTCTAGC
TTCTTTGACCGTTGGGATTTCTTCACCGGTGAAGACCCGACGCACGGTATTGTCAACTATACGACAAGAGACGAT
GCATATGCCAGTGGACTTGTCTACGCTCAGGAGGACGGAACTGTCATTATGAAGGGGGATAACACCACGCATCTA
GATCATGGTGTTCCTAGGAAGAGTGTCCGCATATCGAGTTGGGCGAAGTATAATGGTGGACTGTTTGTTCTTGAT
TTGAAGAAGGCACCTTGGGGCTGCGGTGTGTGGCCCGCCTTTTGGACTCTGGGTTCAGGAAATTGGCCATATACA
GGAGAAATAGATATTATTGAGGGTGTTCACGATAATGAACACAATCAAGTGGCCTTCCATACTGGTCCTGGGTGC
CTTTTGAATCCGACGGCGGACTTTACAGGAACGGTACTTATGCGGGATGGTAAAAACAACACGGAATGCAATGGA
CTGATAAATGACAATTCCGGTTGTGGCATCGTGGAGTGGAGCCGAGCCTCCTATGGTCCTTTTTTTGACTCACAG
GGGGGAGGAGTGTTCGTAATGAAATGGGATGATATGGGCATTGCAATATGGTCTTTCTATCGGCAAGCCGTTCCA
GAAGATCTCACTCAAGGAACCCCCGATCCGTCTAAGTGGGGGCCACCGGTAGCGGCGTTGGACCCGACCAATTGT
AATATGGAGCAGTACTTTTCCAATCACTCCATAATTTTTGATATCACATTCTGTGGGGACTGGGCGGGCAACTCC
TATGCTTCAACAACTTGTCCAGGAACTTGTACTGAAAGACTTATGGATCCGAATAATTTCGTGAACGCTACCTGG
ATCATCAACGATTTGAAAGTGTATCGCAAACAGGAACTGGATGGGATTGTAGGAGCAAACGCTGGAACTATTAAC
CCTAGAAACTGGATCGGAATTTTATTTGCAATATCTAGTGTCTTATTCATGCAGGGGATGTGA
Transcript >AgabiH97|006720
ATGTTAGCGGCGCTTCCTCATTGTTTGCTTATCCTCGTCATTTCACATCTACAATGCACGTCCGCTAGGACTACT
CTGAGCACACGGAACACGGATCCTGATGGTACAACCTTTCTCTGGTTGCCTCAGGATGATTATTCAGGTTCTAGC
TTCTTTGACCGTTGGGATTTCTTCACCGGTGAAGACCCGACGCACGGTATTGTCAACTATACGACAAGAGACGAT
GCATATGCCAGTGGACTTGTCTACGCTCAGGAGGACGGAACTGTCATTATGAAGGGGGATAACACCACGCATCTA
GATCATGGTGTTCCTAGGAAGAGTGTCCGCATATCGAGTTGGGCGAAGTATAATGGTGGACTGTTTGTTCTTGAT
TTGAAGAAGGCACCTTGGGGCTGCGGTGTGTGGCCCGCCTTTTGGACTCTGGGTTCAGGAAATTGGCCATATACA
GGAGAAATAGATATTATTGAGGGTGTTCACGATAATGAACACAATCAAGTGGCCTTCCATACTGGTCCTGGGTGC
CTTTTGAATCCGACGGCGGACTTTACAGGAACGGTACTTATGCGGGATGGTAAAAACAACACGGAATGCAATGGA
CTGATAAATGACAATTCCGGTTGTGGCATCGTGGAGTGGAGCCGAGCCTCCTATGGTCCTTTTTTTGACTCACAG
GGGGGAGGAGTGTTCGTAATGAAATGGGATGATATGGGCATTGCAATATGGTCTTTCTATCGGCAAGCCGTTCCA
GAAGATCTCACTCAAGGAACCCCCGATCCGTCTAAGTGGGGGCCACCGGTAGCGGCGTTGGACCCGACCAATTGT
AATATGGAGCAGTACTTTTCCAATCACTCCATAATTTTTGATATCACATTCTGTGGGGACTGGGCGGGCAACTCC
TATGCTTCAACAACTTGTCCAGGAACTTGTACTGAAAGACTTATGGATCCGAATAATTTCGTGAACGCTACCTGG
ATCATCAACGATTTGAAAGTGTATCGCAAACAGGAACTGGATGGGATTGTAGGAGCAAACGCTGGAACTATTAAC
CCTAGAAACTGGATCGGAATTTTATTTGCAATATCTAGTGTCTTATTCATGCAGGGGATGTGA
Gene >AgabiH97|006720
ATGTTAGCGGCGCTTCCTCATTGTTTGCTTATCCTCGTCATTTCACATCTACAATGCACGTCCGCTAGGACTACT
CTGAGCACACGGAACACGGATCCTGATGGTACAACCTTTCTCTGGTTGCCTCAGGATGATTATTCAGGTTCTAGC
TTCTTTGAGTACGTGGGTTGATTTTGTTGACACGGGAGACGTCTGATAGGCCTCGGACAGCCGTTGGGATTTCTT
CACCGGTGAAGACCCGACGCAGTAAGTGATGAAGTAGCTTTACTGGTGCCTTACTAATGCTGTTATGCACGCAGC
GGTATTGTCAAGTCAGTGTGATCGACCAACCAATTGATTGTACCCTCTTAACGCTTTCCTATTTCAGCTATACGA
CAAGAGACGATGCATATGCCAGTGGACTTGTCTACGCTCAGGAGGACGGAACTGTCATTATGAAGGGGGATAACA
CCACGCATCTAGATCATGGTGTTCCTAGGAAGAGGTTTGTACTGTTTGAACTACAGTGATGACGTATGGGGTTGA
CCACTTTCACAGTGTCCGCATATCGAGTTGGGCGAAGTATAATGGTGGACTGTTTGTTCTTGATTTGAAGAAGGC
ACCTTGGGGCTGCGGTTAGTGGGATTGGCACCATTGACTGATGCATATTCATATTCATATCTTTAGGTGTGTGGC
CCGCCTTTTGGACTCTGGGTTCAGGAAATTGGCCATATGTGAGTACTGTATTGGTTCTTTTGAAGCGTTTTCTTA
GAGCCCATGTTTCATAGACAGGAGAAATAGATATTATTGAGGGTGTTCACGATAATGAACACAATCAAGTGGCCT
TCCATACTGGTCCTGGTGAGTAATAACAGACGGAGTCATCGCTTACCCGGAATTTATACTCTTTGATAGGGTGCC
TTTTGAATCCGACGGCGGACTTTACAGGAACGGTACTTGTAAGTGTCAAAGAATAAAAGCAGTGTCCAGAATTCA
ATGTTCTTACATTCAGATGCGGGATGGTAAAAACAACACGGAATGCAATGGACTGATAAATGACAATTCCGGTTG
TGGCATCGTGGAGTGGAGCCGAGCCTCCTATGGTCCTTTTTTTGACTCACAGGGGGGAGGAGTGTTCGTAATGAA
ATGGGATGATATGGGCATTGCAATATGTATGTTGACGTTTTTTTCATTTCAGCACTTGATCGCTAAGGTTGCTAT
AGGGTCTTTCTATCGGCAAGCCGTTCCAGAAGATCTCACTCAAGGAACCCCCGATCCGTCTAAGTGGGGGCCACC
GGTAGCGGCGTTGGACCCGACCAATTGTAATATGGAGCAGTACTTTTCCAATCACTCCATAATTTTTGGTGAGTT
CAAGGTCTTGCTCGCATTGTTCTCTTTCTGATTCAATTGTTGCAGATATCACATTCTGTGGTGTGTTTTTGGTCC
CCCCGTTCTTCTGCATGCAATGAAAGACTGATGATCTCTTAGGGGACTGGGCGGGCAACTCCTATGCTTCAACAA
CTTGTCCAGGAACTTGTACTGAAAGACTTATGGATCCGAATAATTTCGTGGTAAGCTTTCGATCATTTGAGTGTG
AATTTTGTTGTGTATTGAGATTGTCAGAACGCTACCTGGATCATCAACGATTTGAAAGTGTATCGCAAACAGGAA
CTGGATGGGATTGTAGGAGCAAACGCTGGAACTATTAACCCTAGAAACTGGATCGGAATTTTATTTGCAATATCT
AGTGTCTTATTCATGCAGGGGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail