Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006600
Gene name
Locationscaffold_1:1611312..1613513
Strand+
Gene length (bp)2201
Transcript length (bp)1728
Coding sequence length (bp)1728
Protein length (aa) 576

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02985 HEAT HEAT repeat 3.0E-03 401 427
PF13646 HEAT_2 HEAT repeats 3.9E-11 363 464

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q38950|2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana GN=PP2AA2 PE=1 SV=2 4 542 0.0E+00
sp|P30154|2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens GN=PPP2R1B PE=1 SV=3 12 542 0.0E+00
sp|Q9UT08|2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=paa1 PE=3 SV=1 7 575 0.0E+00
sp|Q54QR9|2AAA_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit pppA OS=Dictyostelium discoideum GN=pppA PE=2 SV=1 12 574 0.0E+00
sp|P54613|2AAB_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (Fragment) OS=Sus scrofa GN=PPP2R1B PE=2 SV=1 6 542 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q38950|2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana GN=PP2AA2 PE=1 SV=2 4 542 0.0E+00
sp|P30154|2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens GN=PPP2R1B PE=1 SV=3 12 542 0.0E+00
sp|Q9UT08|2AAA_SCHPO Protein phosphatase PP2A regulatory subunit A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=paa1 PE=3 SV=1 7 575 0.0E+00
sp|Q54QR9|2AAA_DICDI Serine/threonine-protein phosphatase 2A regulatory subunit pppA OS=Dictyostelium discoideum GN=pppA PE=2 SV=1 12 574 0.0E+00
sp|P54613|2AAB_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (Fragment) OS=Sus scrofa GN=PPP2R1B PE=2 SV=1 6 542 0.0E+00
sp|Q4QQT4|2AAB_RAT Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Rattus norvegicus GN=Ppp2r1b PE=2 SV=1 6 542 0.0E+00
sp|Q38951|2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana GN=PP2AA3 PE=1 SV=2 4 542 0.0E+00
sp|Q7TNP2|2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus GN=Ppp2r1b PE=1 SV=2 12 542 0.0E+00
sp|Q32PI5|2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus GN=PPP2R1A PE=1 SV=1 6 542 0.0E+00
sp|Q76MZ3|2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus GN=Ppp2r1a PE=1 SV=3 6 542 0.0E+00
sp|P54612|2AAA_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Sus scrofa GN=PPP2R1A PE=2 SV=2 6 542 0.0E+00
sp|Q38845|2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana GN=PP2AA1 PE=1 SV=1 4 542 0.0E+00
sp|P30153|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens GN=PPP2R1A PE=1 SV=4 6 542 0.0E+00
sp|P36179|2AAA_DROME Serine/threonine-protein phosphatase PP2A 65 kDa regulatory subunit OS=Drosophila melanogaster GN=Pp2A-29B PE=2 SV=4 8 542 1.0E-168
sp|Q09543|2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans GN=paa-1 PE=3 SV=2 12 553 8.0E-163
sp|P31383|2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPD3 PE=1 SV=3 8 544 1.0E-153
sp|P36875|2AAA_PEA Protein phosphatase PP2A regulatory subunit A (Fragment) OS=Pisum sativum PE=2 SV=1 201 542 8.0E-115
sp|Q38951|2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana GN=PP2AA3 PE=1 SV=2 182 567 1.0E-26
sp|Q38845|2AAA_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Arabidopsis thaliana GN=PP2AA1 PE=1 SV=1 89 562 3.0E-26
sp|P30154|2AAB_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens GN=PPP2R1B PE=1 SV=3 181 567 8.0E-22
sp|P54613|2AAB_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (Fragment) OS=Sus scrofa GN=PPP2R1B PE=2 SV=1 181 567 1.0E-21
sp|P36875|2AAA_PEA Protein phosphatase PP2A regulatory subunit A (Fragment) OS=Pisum sativum PE=2 SV=1 280 546 2.0E-21
sp|Q7TNP2|2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus GN=Ppp2r1b PE=1 SV=2 173 567 1.0E-19
sp|Q4QQT4|2AAB_RAT Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Rattus norvegicus GN=Ppp2r1b PE=2 SV=1 181 567 2.0E-19
sp|Q32PI5|2AAA_BOVIN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Bos taurus GN=PPP2R1A PE=1 SV=1 173 568 2.0E-19
sp|Q76MZ3|2AAA_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Mus musculus GN=Ppp2r1a PE=1 SV=3 173 568 2.0E-19
sp|P54612|2AAA_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Sus scrofa GN=PPP2R1A PE=2 SV=2 173 568 2.0E-19
sp|P30153|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens GN=PPP2R1A PE=1 SV=4 173 568 2.0E-19
sp|P36875|2AAA_PEA Protein phosphatase PP2A regulatory subunit A (Fragment) OS=Pisum sativum PE=2 SV=1 85 417 2.0E-12
sp|Q7TNP2|2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus GN=Ppp2r1b PE=1 SV=2 96 506 2.0E-12
sp|Q09543|2AAA_CAEEL Probable serine/threonine-protein phosphatase PP2A regulatory subunit OS=Caenorhabditis elegans GN=paa-1 PE=3 SV=2 105 417 5.0E-12
sp|P54613|2AAB_PIG Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform (Fragment) OS=Sus scrofa GN=PPP2R1B PE=2 SV=1 60 428 7.0E-12
sp|Q7TNP2|2AAB_MOUSE Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Mus musculus GN=Ppp2r1b PE=1 SV=2 60 428 6.0E-11
sp|P31383|2AAA_YEAST Protein phosphatase PP2A regulatory subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPD3 PE=1 SV=3 35 417 4.0E-10
sp|Q38950|2AAB_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Arabidopsis thaliana GN=PP2AA2 PE=1 SV=2 102 392 1.0E-09
sp|Q38951|2AAG_ARATH Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A gamma isoform OS=Arabidopsis thaliana GN=PP2AA3 PE=1 SV=2 102 392 2.0E-09
sp|Q8VI02|PP4R1_RAT Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Rattus norvegicus GN=Ppp4r1 PE=1 SV=1 278 541 5.0E-09
sp|Q8K2V1|PP4R1_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Mus musculus GN=Ppp4r1 PE=1 SV=2 278 541 2.0E-08
sp|Q8TF05|PP4R1_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens GN=PPP4R1 PE=1 SV=1 278 541 2.0E-08
sp|P36875|2AAA_PEA Protein phosphatase PP2A regulatory subunit A (Fragment) OS=Pisum sativum PE=2 SV=1 105 391 8.0E-08
sp|Q6NUP7|PP4R4_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Homo sapiens GN=PPP4R4 PE=1 SV=1 273 449 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006600
MDPSMGIEQIAPIAMLMDELRSEDVQLRLNAIHSLPTIALALGADRARDELMSFLQDSIDDEDEVLLALAEELGK
SFEEYVGGKEYAHVLLGPLENLSAVEETLVRDKAAESITKVAEVLAQSQVEQYYIPLLKRLSGGEWFTSRTSAAA
LYAPVYSKVSSGIQDELRKAYAALGADDTPMVRRAAAKSFGPLLKQYSQQHIISEGLQVYRRLQADDQDSVRLLT
VEDLIAIAQKLSPTEVKDLLLKQTKQSIGDKSWRVRYMAASHFNELAEAVGTELVREELLGQYIQLLKDNEAEVR
TAAATQIPGFSKLLDKEVILARIIPCVRDLSQDTSQHVRAALANQIHGLAPLLNREPTIEHLLPLFLHLLKDDFS
EVRLNIISKLETVNNVIGIELLSESLLPAIMELAEDKSWRVRQAIIQYIPLLATQFGKPFFDEELGNLCMSWLGD
SVYSIREAAIVNLKKLIEVFGVEWARAAIVPKVVGMGSHPSFLFRMTTVQAITTISPSLTLEILRADIINPLLEL
SKDHIPNIRFNVAKCLEVMAASFNSTPGGRQFVQELILPAKLSQQIRKDR*
Coding >AgabiH97|006600
ATGGATCCATCGATGGGCATAGAACAGATTGCGCCGATCGCCATGCTCATGGATGAGTTACGTTCGGAAGACGTT
CAGCTTCGTCTGAACGCAATTCATAGTCTACCCACGATAGCACTGGCGTTAGGTGCAGATCGCGCGCGGGATGAA
TTGATGTCTTTTCTTCAAGATTCTATTGATGATGAAGATGAAGTTCTTCTTGCTCTTGCGGAAGAGTTAGGTAAA
AGCTTTGAGGAATACGTAGGGGGTAAAGAGTATGCCCATGTTCTTCTTGGCCCGCTAGAGAATCTCTCTGCGGTG
GAAGAAACACTCGTTCGGGATAAGGCCGCCGAATCAATAACGAAAGTAGCGGAAGTGTTAGCTCAAAGCCAAGTA
GAGCAATACTATATCCCACTTTTGAAACGACTCTCTGGTGGCGAGTGGTTCACGTCACGGACTTCTGCTGCTGCA
CTCTACGCACCGGTTTACTCTAAAGTTTCCTCTGGCATTCAAGATGAATTGCGCAAAGCATATGCAGCTCTTGGG
GCAGACGATACACCCATGGTTCGCAGAGCCGCTGCAAAATCTTTCGGGCCCCTCCTTAAACAGTATTCCCAGCAG
CATATCATCTCCGAAGGCTTGCAAGTTTATAGGCGGTTGCAAGCTGACGATCAGGACTCCGTCCGACTGCTGACT
GTCGAGGATCTCATTGCCATCGCGCAGAAACTCTCCCCGACTGAAGTTAAGGATCTCTTGCTGAAGCAGACTAAG
CAAAGTATCGGTGACAAGAGCTGGCGAGTGCGATACATGGCTGCAAGCCATTTCAATGAGCTTGCGGAGGCTGTT
GGGACAGAGTTGGTGCGAGAAGAGCTGCTCGGTCAGTACATCCAGCTTCTGAAAGATAATGAAGCAGAGGTACGA
ACAGCTGCGGCCACACAAATACCGGGCTTCTCCAAGCTACTCGACAAAGAAGTCATCTTGGCCAGAATCATTCCC
TGTGTTAGAGACTTGTCACAAGACACGTCTCAGCATGTTCGTGCGGCCCTAGCGAACCAGATTCATGGTCTCGCG
CCTTTGTTGAACCGAGAGCCAACTATCGAACATCTTCTTCCGCTTTTTTTGCATCTCTTGAAAGATGATTTCTCT
GAAGTACGATTGAATATCATCAGTAAACTCGAAACAGTCAATAATGTAATTGGTATTGAGCTTCTTTCTGAAAGC
TTGCTTCCGGCTATCATGGAGCTAGCTGAAGACAAATCGTGGCGAGTGCGACAGGCGATTATTCAGTACATTCCC
CTCCTTGCTACTCAATTCGGTAAACCCTTTTTTGATGAAGAACTGGGCAACCTGTGTATGTCATGGTTGGGAGAT
TCGGTTTACAGCATCCGGGAAGCTGCGATCGTCAATCTCAAAAAACTGATTGAAGTCTTCGGCGTTGAGTGGGCT
CGAGCAGCTATTGTACCAAAGGTGGTTGGAATGGGGTCTCATCCGAGCTTCCTCTTCAGGATGACGACTGTTCAG
GCAATCACAACGATTTCACCTTCTTTGACGCTTGAGATCTTGCGAGCGGACATAATCAATCCACTTCTGGAATTA
TCGAAGGATCACATTCCTAATATTCGTTTCAACGTAGCGAAATGCCTGGAAGTGATGGCAGCATCTTTTAACTCT
ACGCCCGGGGGCCGTCAATTCGTCCAGGAATTGATCCTCCCTGCAAAGCTCTCCCAGCAGATTCGTAAAGACAGG
TAG
Transcript >AgabiH97|006600
ATGGATCCATCGATGGGCATAGAACAGATTGCGCCGATCGCCATGCTCATGGATGAGTTACGTTCGGAAGACGTT
CAGCTTCGTCTGAACGCAATTCATAGTCTACCCACGATAGCACTGGCGTTAGGTGCAGATCGCGCGCGGGATGAA
TTGATGTCTTTTCTTCAAGATTCTATTGATGATGAAGATGAAGTTCTTCTTGCTCTTGCGGAAGAGTTAGGTAAA
AGCTTTGAGGAATACGTAGGGGGTAAAGAGTATGCCCATGTTCTTCTTGGCCCGCTAGAGAATCTCTCTGCGGTG
GAAGAAACACTCGTTCGGGATAAGGCCGCCGAATCAATAACGAAAGTAGCGGAAGTGTTAGCTCAAAGCCAAGTA
GAGCAATACTATATCCCACTTTTGAAACGACTCTCTGGTGGCGAGTGGTTCACGTCACGGACTTCTGCTGCTGCA
CTCTACGCACCGGTTTACTCTAAAGTTTCCTCTGGCATTCAAGATGAATTGCGCAAAGCATATGCAGCTCTTGGG
GCAGACGATACACCCATGGTTCGCAGAGCCGCTGCAAAATCTTTCGGGCCCCTCCTTAAACAGTATTCCCAGCAG
CATATCATCTCCGAAGGCTTGCAAGTTTATAGGCGGTTGCAAGCTGACGATCAGGACTCCGTCCGACTGCTGACT
GTCGAGGATCTCATTGCCATCGCGCAGAAACTCTCCCCGACTGAAGTTAAGGATCTCTTGCTGAAGCAGACTAAG
CAAAGTATCGGTGACAAGAGCTGGCGAGTGCGATACATGGCTGCAAGCCATTTCAATGAGCTTGCGGAGGCTGTT
GGGACAGAGTTGGTGCGAGAAGAGCTGCTCGGTCAGTACATCCAGCTTCTGAAAGATAATGAAGCAGAGGTACGA
ACAGCTGCGGCCACACAAATACCGGGCTTCTCCAAGCTACTCGACAAAGAAGTCATCTTGGCCAGAATCATTCCC
TGTGTTAGAGACTTGTCACAAGACACGTCTCAGCATGTTCGTGCGGCCCTAGCGAACCAGATTCATGGTCTCGCG
CCTTTGTTGAACCGAGAGCCAACTATCGAACATCTTCTTCCGCTTTTTTTGCATCTCTTGAAAGATGATTTCTCT
GAAGTACGATTGAATATCATCAGTAAACTCGAAACAGTCAATAATGTAATTGGTATTGAGCTTCTTTCTGAAAGC
TTGCTTCCGGCTATCATGGAGCTAGCTGAAGACAAATCGTGGCGAGTGCGACAGGCGATTATTCAGTACATTCCC
CTCCTTGCTACTCAATTCGGTAAACCCTTTTTTGATGAAGAACTGGGCAACCTGTGTATGTCATGGTTGGGAGAT
TCGGTTTACAGCATCCGGGAAGCTGCGATCGTCAATCTCAAAAAACTGATTGAAGTCTTCGGCGTTGAGTGGGCT
CGAGCAGCTATTGTACCAAAGGTGGTTGGAATGGGGTCTCATCCGAGCTTCCTCTTCAGGATGACGACTGTTCAG
GCAATCACAACGATTTCACCTTCTTTGACGCTTGAGATCTTGCGAGCGGACATAATCAATCCACTTCTGGAATTA
TCGAAGGATCACATTCCTAATATTCGTTTCAACGTAGCGAAATGCCTGGAAGTGATGGCAGCATCTTTTAACTCT
ACGCCCGGGGGCCGTCAATTCGTCCAGGAATTGATCCTCCCTGCAAAGCTCTCCCAGCAGATTCGTAAAGACAGG
TAG
Gene >AgabiH97|006600
ATGGATCCATCGATGGGCATAGAACAGGTGTGCTTTCGACCACCCGCGAGATCTCTCGAATTCAACTCACGGCCT
ATCTAAGATTGCGCCGATCGCCATGCTCATGGATGAGTTACGTTCGGAAGACGTTCAGCTTCGTCTGAACGCAAT
TCATAGTCTACCCACGATAGCACTGGCGTTAGGTGCAGATCGCGCGCGGGATGAATTGATGTCTTTTCTTCAAGA
TTCTATTGATGATGAAGATGAAGTTCTTCTTGCTCTTGCGGAAGAGTTAGGTAAAAGCTTTGAGGAATACGTAGG
GGGTAAAGAGTATGCCCATGTTCTTCTTGGCCCGCTAGAGAATCTCTCTGCGGTGGAAGAAACACTCGTTCGGGA
TAAGGTACGCGGTTTCTTTGCATCTATCATGCATTATATTCAAGCCGTGACAGGCCGCCGAATCAATAACGAAAG
TAGCGGAAGTGTTAGCTCAAAGCCAAGTAGAGCAATACTATATCCCACTTTTGAAACGACTCTCTGGTGGCGAGT
GGTTCACGTCACGGACTTCTGCTGCTGCACTCTACGCACCGGTTTACTCTAAAGTTTCCTCTGGCATTCAAGATG
AATTGCGCAAAGCATATGCAGCTCTTGGGGCAGACGATACACCCATGGTTCGCAGAGCCGCTGCAAAATCTTTCG
GGGTCAGCAGTCGTTCACTGGATCGAGTTTCCAAGCTGACAGGCACTGTAGCCCCTCCTTAAACAGTATTCCCAG
CAGCATATCATCTCCGAAGGCTTGCAAGTTTATAGGCGGTTGCAAGCTGACGATCAGGACTCCGTCCGACTGCTG
ACTGTCGAGGATCTCATTGCCATCGCGCAGAAACTCTCCCCGACTGAAGTTAAGGATCTCTTGCTGAAGCAGACT
AAGCAAAGTATCGGTGACAAGAGCTGGCGAGTGCGATACATGGCTGCAAGCCATTTCAATGAGGCAAGTTTTTTT
TACTGATCCTATAAATGCCTCATATTCAATACATTTCAAAGCTTGCGGAGGCTGTTGGGACAGAGTTGGTGCGAG
AAGAGCTGCTCGGTCAGTACATCCAGCTTCTGAAAGATAATGAAGCAGAGGTACGAACAGCTGCGGCCACACAAA
TACCGGGTGAGTTTAGCTGAGGAAAATGATCACATAACTTAACCAAAAGAGTTATAGGCTTCTCCAAGCTACTCG
ACAAAGAAGTCATCTTGGCCAGAATCATTCCCTGTGTTAGAGACTTGTCACAAGACACGTCTCAGCATGTTCGTG
CGGCCCTAGCGAACCAGATTCATGGTCTCGCGCCTTTGTTGAACCGAGAGCCAACTATCGAACATCTTCTTCCGC
TTTTTTTGCATCTCTTGAAAGATGATTTCTCTGAAGTACGATTGAATATCATCAGTAAACTCGAAACAGTCAATA
ATGGTATGCCTTGCCGCTCATTTTCGGGTTGGACATCAATGTACTAATCACCCACAGTAATTGGTATTGAGCTTC
TTTCTGAAAGCTTGCTTCCGGCTATCATGGAGCTAGCTGAAGACAAATCGTGGCGAGTGCGACAGGCGATTATTC
AGTACATTCCCCTCCTTGCTACTCAATTCGGTAAACCCTTTTTTGATGAAGAACTGGGCAACCTGTGTATGTCAT
GGTTGGGAGATTCGGTTTACAGCATCCGGGAAGCTGCGATCGTCAATCTCAAAAAACTGATTGAAGTCTTCGGCG
TTGAGTGGGCTCGAGCAGCTATTGTACCAAAGGTGGTTGGAATGGGGTCTCATCCGAGCTTCCTCTTCAGGATGA
CGACTGTTCAGGCAATCACAGTATGTTAGTTCATCATCTCTTCTGATTCAGACTTAGTTCTTGCCCAGACGATTT
CACCTTCTTTGACGCTTGAGATCTTGCGAGCGGACATAATCAATCCACTTCTGGAATTATCGAAGGATCACATTC
CTAATATTCGTTTCAACGTAGCGAAATGCCTGGAAGTGATGGCAGCATCTTTTAACTCTACGCCCGGGGGCCGTC
AATTCGTCCAGGAATTGATCCTCCCTGCGTTAGAACGACAGAAAGATGATGTTGATGCCGATGTCCGGTACTTTG
CCTCCCGCGCACTACAGAAAGCTCTCCCAGCAGATTCGTAAAGGTATGATACCACAACAATCACGATACTACGTA
TATTCAGTCGAAATTTAGACAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail