Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006580
Gene name
Locationscaffold_1:1602996..1608693
Strand-
Gene length (bp)5697
Transcript length (bp)4521
Coding sequence length (bp)4521
Protein length (aa) 1507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00136 DNA_pol_B DNA polymerase family B 7.2E-101 887 1334
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 8.8E-06 41 139
PF03104 DNA_pol_B_exo1 DNA polymerase family B, exonuclease domain 5.4E-13 655 821
PF14260 zf-C4pol C4-type zinc-finger of DNA polymerase delta 2.4E-12 1394 1463

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 626 1483 0.0E+00
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 501 1470 0.0E+00
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 626 1483 0.0E+00
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 489 1468 0.0E+00
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 609 1470 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 626 1483 0.0E+00
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 501 1470 0.0E+00
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 626 1483 0.0E+00
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 489 1468 0.0E+00
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 609 1470 0.0E+00
sp|Q54N97|DPOD1_DICDI DNA polymerase delta catalytic subunit OS=Dictyostelium discoideum GN=pold1 PE=3 SV=1 659 1479 2.0E-83
sp|P30316|DPOD_SCHPO DNA polymerase delta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol3 PE=1 SV=2 657 1479 7.0E-82
sp|P30315|DPOD1_PLAFK DNA polymerase delta catalytic subunit OS=Plasmodium falciparum (isolate K1 / Thailand) GN=POLD1 PE=3 SV=1 657 1472 2.0E-81
sp|Q9LRE6|DPOD1_ORYSJ DNA polymerase delta catalytic subunit OS=Oryza sativa subsp. japonica GN=POLD1 PE=2 SV=1 623 1475 2.0E-79
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 722 1471 2.0E-79
sp|P46588|DPOD_CANAX DNA polymerase delta catalytic subunit OS=Candida albicans GN=POL3 PE=3 SV=2 724 1467 2.0E-79
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 657 1471 9.0E-79
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 657 1471 2.0E-78
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 657 1471 5.0E-78
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 657 1471 9.0E-78
sp|Q9LVN7|DPOD1_ARATH DNA polymerase delta catalytic subunit OS=Arabidopsis thaliana GN=POLD1 PE=2 SV=2 633 1470 1.0E-77
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 657 1471 6.0E-77
sp|P90829|DPOD1_CAEEL DNA polymerase delta catalytic subunit OS=Caenorhabditis elegans GN=F10C2.4 PE=3 SV=1 727 1492 4.0E-72
sp|O48901|DPOD1_SOYBN DNA polymerase delta catalytic subunit OS=Glycine max GN=POLD1 PE=2 SV=1 644 1333 2.0E-70
sp|P15436|DPOD_YEAST DNA polymerase delta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL3 PE=1 SV=4 657 1329 3.0E-67
sp|P03198|DPOL_EBVB9 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain B95-8) GN=BALF5 PE=1 SV=1 723 1304 4.0E-53
sp|Q3KSP1|DPOL_EBVG DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain GD1) GN=BALF5 PE=3 SV=1 723 1304 6.0E-53
sp|Q1HVC1|DPOL_EBVA8 DNA polymerase catalytic subunit OS=Epstein-Barr virus (strain AG876) GN=BALF5 PE=3 SV=1 723 1304 6.0E-53
sp|P24907|DPOL_SHV21 DNA polymerase catalytic subunit OS=Saimiriine herpesvirus 2 (strain 11) GN=9 PE=3 SV=1 723 1304 4.0E-50
sp|P52367|DPOL_EHV2 DNA polymerase catalytic subunit OS=Equine herpesvirus 2 (strain 86/87) GN=9 PE=3 SV=1 723 1304 4.0E-49
sp|Q2HRD0|DPOL_HHV8P DNA polymerase catalytic subunit OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF9 PE=3 SV=1 723 1304 2.0E-47
sp|O36363|DPOL_ALHV1 DNA polymerase catalytic subunit OS=Alcelaphine herpesvirus 1 (strain C500) GN=9 PE=3 SV=1 723 1304 9.0E-47
sp|P52342|DPOL_HHV7J DNA polymerase catalytic subunit OS=Human herpesvirus 7 (strain JI) GN=U38 PE=3 SV=1 723 1288 7.0E-46
sp|P28857|DPOL_HHV6U DNA polymerase catalytic subunit OS=Human herpesvirus 6A (strain Uganda-1102) GN=U38 PE=3 SV=1 712 1304 8.0E-46
sp|Q9QJ32|DPOL_HHV6Z DNA polymerase catalytic subunit OS=Human herpesvirus 6B (strain Z29) GN=U38 PE=3 SV=1 712 1304 1.0E-45
sp|Q69025|DPOL_GPCMV DNA polymerase OS=Guinea pig cytomegalovirus (strain 22122) GN=UL54 PE=3 SV=3 717 1295 1.0E-40
sp|P09252|DPOL_VZVD DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Dumas) GN=ORF28 PE=3 SV=1 722 1288 3.0E-39
sp|P04292|DPOL_HHV1K DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain KOS) GN=UL30 PE=1 SV=1 722 1219 6.0E-39
sp|Q4JQU7|DPOL_VZVO DNA polymerase catalytic subunit OS=Varicella-zoster virus (strain Oka vaccine) GN=ORF28 PE=3 SV=1 722 1288 7.0E-39
sp|Q9DKT8|DPOL_ELHVK DNA polymerase catalytic subunit OS=Elephantid herpesvirus 1 (isolate Asian elephant/Berlin/Kiba/1998) PE=3 SV=1 723 1325 1.0E-38
sp|P04293|DPOL_HHV11 DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain 17) GN=UL30 PE=1 SV=2 722 1219 1.0E-38
sp|P07917|DPOL_HHV1A DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain Angelotti) GN=UL30 PE=1 SV=1 722 1219 2.0E-38
sp|P09854|DPOL_HHV1S DNA polymerase catalytic subunit OS=Human herpesvirus 1 (strain SC16) GN=UL30 PE=3 SV=1 722 1219 2.0E-38
sp|P30321|DPOL_PBCV1 DNA polymerase OS=Paramecium bursaria Chlorella virus 1 GN=DPO PE=3 SV=2 724 1333 2.0E-36
sp|P56689|DPOL_THEGO DNA polymerase OS=Thermococcus gorgonarius GN=pol PE=1 SV=1 700 1337 5.0E-36
sp|P07918|DPOL_HHV21 DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain 186) GN=UL30 PE=3 SV=1 722 1219 1.0E-35
sp|Q6UDK1|DPOL_PSHV1 DNA polymerase catalytic subunit OS=Psittacid herpesvirus 1 (isolate Amazon parrot/-/97-0001/1997) GN=UL30 PE=3 SV=1 697 1341 1.0E-35
sp|P89453|DPOL_HHV2H DNA polymerase catalytic subunit OS=Human herpesvirus 2 (strain HG52) GN=UL30 PE=3 SV=1 722 1219 5.0E-35
sp|Q56366|DPOL_THES9 DNA polymerase OS=Thermococcus sp. (strain 9oN-7) GN=pol PE=1 SV=1 717 1337 6.0E-34
sp|O71121|DPOL_RHCM6 DNA polymerase catalytic subunit OS=Rhesus cytomegalovirus (strain 68-1) GN=UL54 PE=3 SV=1 723 1220 2.0E-33
sp|P30320|DPOL_PBCVN DNA polymerase OS=Paramecium bursaria Chlorella virus NY2A GN=DPO PE=3 SV=1 793 1357 2.0E-33
sp|A7U6F2|DPOL_POV01 DNA polymerase OS=Pyramimonas orientalis virus GN=dpo PE=3 SV=1 723 1335 5.0E-33
sp|P27172|DPOL_MUHVS DNA polymerase catalytic subunit OS=Murid herpesvirus 1 (strain Smith) GN=UL54 PE=3 SV=1 713 1336 1.0E-32
sp|Q9E6N9|DPOL_GAHVM DNA polymerase catalytic subunit OS=Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) GN=MDV043 PE=3 SV=1 722 1293 3.0E-32
sp|P28040|DPOA_SCHPO DNA polymerase alpha catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pol1 PE=1 SV=1 723 1346 3.0E-31
sp|Q7SIG7|DPOL_DESST DNA polymerase OS=Desulfurococcus sp. (strain Tok) GN=pol PE=1 SV=1 700 1337 4.0E-31
sp|Q85428|DPOL_RCMVM DNA polymerase catalytic subunit OS=Rat cytomegalovirus (strain Maastricht) GN=UL54 PE=3 SV=2 919 1289 7.0E-31
sp|Q6S6P1|DPOL_EHV1V DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain V592) GN=30 PE=3 SV=1 722 1288 4.0E-30
sp|P28858|DPOL_EHV1B DNA polymerase catalytic subunit OS=Equine herpesvirus 1 (strain Ab4p) GN=30 PE=3 SV=1 722 1288 5.0E-30
sp|P08546|DPOL_HCMVA DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain AD169) GN=UL54 PE=1 SV=2 935 1298 1.0E-29
sp|Q6SW77|DPOL_HCMVM DNA polymerase catalytic subunit OS=Human cytomegalovirus (strain Merlin) GN=UL54 PE=3 SV=1 935 1298 1.0E-29
sp|Q94636|DPOLA_STENO DNA polymerase alpha catalytic subunit OS=Sterkiella nova PE=3 SV=1 695 1333 2.0E-29
sp|Q54SV8|DPOLA_DICDI DNA polymerase alpha catalytic subunit OS=Dictyostelium discoideum GN=pola1 PE=3 SV=1 717 1345 3.0E-28
sp|P27727|DPOLA_TRYBB DNA polymerase alpha catalytic subunit OS=Trypanosoma brucei brucei PE=3 SV=1 647 1352 4.0E-28
sp|O89042|DPOLA_RAT DNA polymerase alpha catalytic subunit (Fragment) OS=Rattus norvegicus GN=Pola1 PE=2 SV=1 714 1332 2.0E-27
sp|Q9HH06|DPOL_PYRGL DNA polymerase OS=Pyrococcus glycovorans GN=pol PE=3 SV=1 717 1337 2.0E-27
sp|Q196U0|DPOL_IIV3 DNA polymerase 120R OS=Invertebrate iridescent virus 3 GN=IIV3-120R PE=3 SV=1 723 1258 1.0E-26
sp|P26019|DPOLA_DROME DNA polymerase alpha catalytic subunit OS=Drosophila melanogaster GN=DNApol-alpha180 PE=1 SV=2 797 1397 5.0E-26
sp|P61876|DPOL_PYRWO DNA polymerase OS=Pyrococcus woesei GN=pol PE=1 SV=1 700 1337 5.0E-26
sp|P61875|DPOL_PYRFU DNA polymerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pol PE=1 SV=1 700 1337 5.0E-26
sp|P0CL77|DPOL_PYRAB DNA polymerase 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=polI PE=1 SV=1 717 1337 5.0E-25
sp|P33609|DPOLA_MOUSE DNA polymerase alpha catalytic subunit OS=Mus musculus GN=Pola1 PE=1 SV=2 714 1332 7.0E-25
sp|P14284|DPOZ_YEAST DNA polymerase zeta catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REV3 PE=1 SV=1 2 266 1.0E-24
sp|O00874|DPOLA_LEIDO DNA polymerase alpha catalytic subunit OS=Leishmania donovani PE=3 SV=1 934 1332 1.0E-24
sp|P09884|DPOLA_HUMAN DNA polymerase alpha catalytic subunit OS=Homo sapiens GN=POLA1 PE=1 SV=2 714 1332 2.0E-24
sp|P0CL76|DPOL_PYRAY DNA polymerase 1 OS=Pyrococcus abyssi GN=polI PE=1 SV=1 717 1337 4.0E-24
sp|Q27152|DPOLA_OXYTR DNA polymerase alpha catalytic subunit OS=Oxytricha trifallax PE=3 SV=1 928 1340 7.0E-24
sp|O48653|DPOLA_ORYSJ DNA polymerase alpha catalytic subunit OS=Oryza sativa subsp. japonica GN=Os01g0868300 PE=2 SV=2 718 1332 1.0E-23
sp|Q9DE46|DPOLA_XENLA DNA polymerase alpha catalytic subunit OS=Xenopus laevis GN=pola1 PE=1 SV=1 714 1332 2.0E-22
sp|Q9FHA3|DPOLA_ARATH DNA polymerase alpha catalytic subunit OS=Arabidopsis thaliana GN=POLA PE=3 SV=2 718 1332 2.0E-22
sp|O27276|DPOL1_METTH DNA polymerase PolB subunit 1 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=polB1 PE=1 SV=1 645 1126 5.0E-22
sp|O29753|DPOL_ARCFU DNA polymerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pol PE=3 SV=1 657 1337 6.0E-22
sp|Q61493|DPOLZ_MOUSE DNA polymerase zeta catalytic subunit OS=Mus musculus GN=Rev3l PE=1 SV=3 1 243 2.0E-21
sp|O60673|DPOLZ_HUMAN DNA polymerase zeta catalytic subunit OS=Homo sapiens GN=REV3L PE=1 SV=2 1 243 3.0E-21
sp|O70736|DPOL_RSIV DNA polymerase OS=Red sea bream iridovirus PE=3 SV=1 793 1325 4.0E-21
sp|Q9P6L6|DPOZ_SCHPO DNA polymerase zeta catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev3 PE=3 SV=1 2 242 9.0E-21
sp|O93746|DPOL2_AERPE DNA polymerase 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=polB PE=3 SV=3 674 1338 9.0E-21
sp|P52025|DPOL_METVO DNA polymerase OS=Methanococcus voltae GN=pol PE=3 SV=1 718 1337 7.0E-19
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 1011 1325 1.0E-18
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 1011 1325 2.0E-18
sp|A7U6F1|DPOL_CEV01 DNA polymerase OS=Chrysochromulina ericina virus GN=dpo PE=3 SV=1 1059 1356 4.0E-18
sp|P21189|DPO2_ECOLI DNA polymerase II OS=Escherichia coli (strain K12) GN=polB PE=1 SV=2 715 1336 5.0E-17
sp|Q766Z3|REV3_ARATH DNA polymerase zeta catalytic subunit OS=Arabidopsis thaliana GN=REV3 PE=2 SV=1 1 162 3.0E-16
sp|Q4U3V0|DPOL_TNAVC DNA polymerase OS=Trichoplusia ni ascovirus 2c GN=ORF1 PE=3 SV=2 1012 1249 2.0E-15
sp|A4KX57|DPOL_HVAVE DNA polymerase OS=Heliothis virescens ascovirus 3e GN=ORF1 PE=3 SV=1 1017 1249 7.0E-15
sp|P13382|DPOA_YEAST DNA polymerase alpha catalytic subunit A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=POL1 PE=1 SV=2 934 1344 1.0E-14
sp|P77933|DPOL_THEKO DNA polymerase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pol PE=1 SV=3 1082 1337 3.0E-13
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 1009 1337 7.0E-13
sp|Q9YUS2|DPOL_TUHV2 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus (strain 2) GN=DPOL PE=3 SV=1 723 971 1.0E-12
sp|Q5UQR0|DPOL_MIMIV DNA polymerase OS=Acanthamoeba polyphaga mimivirus GN=POLB PE=3 SV=1 1110 1344 1.0E-12
sp|Q9YUS3|DPOL_TUHV1 DNA polymerase catalytic subunit OS=Tupaiid herpesvirus 1 (strain 1) GN=DPOL PE=3 SV=1 723 971 3.0E-12
sp|Q58295|DPOL_METJA DNA polymerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pol PE=3 SV=2 1061 1338 4.0E-11
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 717 1064 4.0E-11
sp|Q779J8|DPOL_SFAVA DNA polymerase OS=Spodoptera frugiperda ascovirus 1a GN=ORF1 PE=3 SV=1 1017 1249 6.0E-10
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 1082 1337 1.0E-09
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 717 1064 1.0E-09
sp|P28339|DPOD1_BOVIN DNA polymerase delta catalytic subunit OS=Bos taurus GN=POLD1 PE=1 SV=1 5 249 2.0E-09
sp|O54747|DPOD1_RAT DNA polymerase delta catalytic subunit OS=Rattus norvegicus GN=Pold1 PE=2 SV=1 27 249 4.0E-09
sp|O59610|DPOL_PYRHO DNA polymerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pol PE=3 SV=1 1082 1337 5.0E-09
sp|P52431|DPOD1_MOUSE DNA polymerase delta catalytic subunit OS=Mus musculus GN=Pold1 PE=1 SV=2 5 249 7.0E-09
sp|Q51334|DPOL_PYRSD DNA polymerase OS=Pyrococcus sp. (strain GB-D) GN=pol PE=1 SV=1 717 1064 7.0E-09
sp|P21402|DPOL_FOWPN DNA polymerase OS=Fowlpox virus (strain NVSL) GN=POL PE=3 SV=2 1018 1287 6.0E-08
sp|P28340|DPOD1_HUMAN DNA polymerase delta catalytic subunit OS=Homo sapiens GN=POLD1 PE=1 SV=2 5 249 1.0E-07
sp|Q6GZR5|DPOL_FRG3G Putative DNA polymerase 060R OS=Frog virus 3 (isolate Goorha) GN=FV3-060R PE=3 SV=1 714 976 1.0E-07
sp|Q9QSK2|DPOL_IIV6 DNA polymerase 037L OS=Invertebrate iridescent virus 6 GN=DPOL PE=3 SV=1 1018 1221 1.0E-07
sp|Q9HH05|DPOL_THEHY DNA polymerase (Fragment) OS=Thermococcus hydrothermalis GN=pol PE=1 SV=1 1102 1337 2.0E-07
sp|P30317|DPOL_THELI DNA polymerase OS=Thermococcus litoralis GN=pol PE=1 SV=1 700 1064 2.0E-07
sp|Q9HH84|DPOL_THEG8 DNA polymerase OS=Thermococcus sp. (strain GE8) GN=pol PE=3 SV=1 1102 1337 4.0E-07
sp|P74918|DPOL_THEFM DNA polymerase OS=Thermococcus fumicolans GN=pol PE=1 SV=1 1102 1337 8.0E-07
sp|P97283|DPOD1_MESAU DNA polymerase delta catalytic subunit OS=Mesocricetus auratus GN=POLD1 PE=2 SV=1 27 249 3.0E-06
sp|P30319|DPOL_CBEPV DNA polymerase OS=Choristoneura biennis entomopoxvirus GN=POL PE=3 SV=1 1112 1287 4.0E-06
sp|P54358|DPOD1_DROME DNA polymerase delta catalytic subunit OS=Drosophila melanogaster GN=DNApol-delta PE=2 SV=2 27 150 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0003677 DNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006580
MFSVQIYQIDYVLSPPGPLDRSHYPRVPILRIFGQSSVGLRTCLHVHQVYPYCYIEYQGDLDLRHVKQYVRKFKK
SLNHAIALSLKRDPNSTKSQYVCAVVLVKGVKFYGFHSQYSPFLKIILLDPRLMNRVATILQSGSFMCDFGLYGC
GSVGISKAYRRAVLGSETDILPEQVTSFEPSPYPPQSHMPIELDVISPEITNRTQIKERCLHHRLVIPGPERPSE
PIVTSIRELWEEERVRRRALGMEPSPELPQDPSEGSRETGGGWIAEARWWDEIHSRLERERPVNQSHSSSTPPWE
SQVMSIFESTEALWESSYRRWKPDKQTMYETSKRDEAVLNESDLSAIEEVVEGGEVDVNEDLLAYRTIDDLGDME
EDEVYNEDRDPTDGDLDEDNAEVKEIEEESDDEDTSGNRGASRSSSPNPFLDDGTTKCSRLFSSSQAQSAEIQEN
DKQKKAQLQEQRSTPTFLSSDDKESLQSIPLASTIRISCSQLTKAYNLCRRGSQNSYAYYKQAPGAAEITTSFES
LGLPSKIYKPPFYSNEDDAPEQPKEFSGLVYHLRGEGTSLLEGFAFPFTGMAGEHDKDKLLFHACTGWEYASLPP
SRKVIKNWLQHQGHLKQEMSTKMPHSQIDGPTQFNIYGFKGSPIAHVYATSRSKQSMTILSVEVMAPTHGKNVPN
PESDPICIAVYGFQVAGTEDVHTGVIAIQNIQLNPRRIRDFHLEIVDTELDLLNRLSDIVAELDPDILTGWEVQQ
ASWGYLWLRAKHYDFDFQDFLSRAPPLKAGSNDRWDGQTTSNIKVAGRHVLNVWRIMRSELALTSYTLSNVAFHV
MRQRVPFYSFATLSRWYDSTGPSHMVALMHYLIQRNCATLQILEATELVTKTAEFARIFGVDFHSVISRGSQFKV
ESFMFRIAKSENFVLLSPSKSDVGLQNAAECMPLIMEPMSAFYTSPLVVLDFQSLYPSVMIAYNYCYSTCLGRIK
PFQGNYKFGVTNLDLGPGILDALQEHITVAPNGIMYVKSNVRKGLLGRMLVELLNTRVMVKQALKSAKSDKALAR
VLHARQLALKYIANVTYGYTSATYSGRMPAVEIADSIVQTGRETLEKAIDFINGSEKWGARVVYGDTDSLFVYLP
GKTREQAFRIGNEMADAVTRQNPVPIKLKFEKVYLPCVLMAKKRYVGFKYENPDETEPEFDAKGIETVRRDGVLA
QRKLVENSLKILFRTQDLSQVKDYCCRSWYQIMENKVPIQDFIFAKEVRMGTYSEKGPPPPGAVVAARRMVLDPN
DEPQYGDRIPYIISRGEPGALLAERALDPLEMINDPRLQLDALYYITRVLIPPLERVFNLVGADVRQWFAEMPKI
SNTVSELALASPGRRRKVEDSDREESPSSPGRRDLEEHLENNQCLVCGEVSFTELCEECIFLPQTSLTILGAKTG
RREERMLTTHKVCVTCTSIAPSEPVECECLDCPWFYARKRAEHKLDMIETMDILIDEFDSKLSRSPTASPNSASD
SNLTRM*
Coding >AgabiH97|006580
ATGTTCTCTGTGCAGATATATCAGATTGACTACGTTCTATCTCCTCCTGGCCCGCTTGACCGCTCTCACTACCCC
AGGGTGCCTATTCTGCGAATATTTGGCCAGTCTTCTGTTGGATTGCGAACCTGCCTTCATGTGCACCAAGTTTAT
CCTTACTGCTATATTGAATATCAAGGAGATCTCGATCTCCGACATGTGAAACAATACGTCCGAAAATTCAAAAAG
TCGTTAAATCATGCCATTGCTTTATCTTTAAAACGAGACCCTAACTCCACCAAATCTCAATATGTCTGTGCCGTT
GTGCTGGTTAAAGGCGTCAAATTCTATGGATTCCACTCGCAATATTCGCCATTCCTGAAAATAATACTGTTAGAC
CCACGGCTCATGAATCGTGTGGCCACCATTTTACAGTCTGGCTCGTTCATGTGCGATTTCGGTCTATACGGATGT
GGGTCCGTTGGAATCAGCAAGGCTTATCGACGAGCTGTATTGGGGTCCGAGACAGATATACTACCGGAGCAAGTC
ACGTCTTTTGAACCGTCACCCTACCCTCCACAGTCGCACATGCCCATAGAACTGGACGTAATCTCGCCAGAAATA
ACTAATCGAACACAAATCAAGGAGCGCTGCCTTCACCATCGCCTTGTGATACCTGGTCCTGAGCGACCATCCGAA
CCGATCGTTACGAGTATTCGCGAGTTATGGGAAGAAGAACGCGTGCGTCGTCGTGCTCTTGGTATGGAACCTTCA
CCCGAGCTGCCCCAAGATCCAAGCGAGGGGTCCAGGGAGACCGGCGGCGGTTGGATAGCAGAAGCTCGCTGGTGG
GATGAGATCCATTCTCGACTCGAACGCGAGCGCCCAGTGAATCAATCTCATTCTTCGAGTACCCCGCCGTGGGAG
AGCCAAGTAATGTCTATCTTCGAGAGCACAGAGGCACTTTGGGAATCAAGTTACAGAAGATGGAAACCTGACAAG
CAGACAATGTATGAGACTTCAAAACGTGATGAGGCAGTTCTTAACGAGTCGGATTTGTCGGCTATTGAGGAAGTT
GTAGAAGGTGGCGAAGTGGATGTGAACGAGGATTTACTGGCCTACAGGACGATCGATGACCTTGGGGACATGGAA
GAAGATGAGGTTTATAACGAAGACCGCGACCCCACGGACGGAGACCTGGACGAAGATAATGCGGAGGTCAAAGAA
ATAGAGGAAGAAAGCGACGACGAAGACACATCGGGAAACAGAGGAGCTTCCAGATCTTCGTCCCCCAACCCTTTC
TTAGATGATGGGACAACTAAGTGCTCTCGTCTCTTTTCTTCAAGCCAAGCCCAGAGTGCAGAAATACAGGAAAAT
GATAAGCAAAAGAAGGCCCAATTACAAGAACAACGCAGCACACCTACCTTTCTATCATCTGATGACAAAGAAAGT
CTTCAAAGCATACCCTTAGCGTCGACAATTCGAATTTCGTGTTCGCAGCTGACGAAGGCATATAACTTATGTCGA
AGAGGTAGTCAAAACAGTTATGCATATTATAAGCAGGCCCCCGGAGCAGCTGAAATTACGACCAGCTTTGAATCA
CTGGGCCTGCCGTCGAAAATCTATAAACCGCCATTTTATTCCAATGAGGATGACGCGCCAGAACAGCCTAAAGAG
TTCTCAGGATTAGTATATCATCTGAGAGGAGAAGGTACTTCGCTGCTCGAAGGCTTTGCATTTCCTTTTACAGGC
ATGGCAGGCGAACATGACAAGGACAAGTTATTGTTCCATGCTTGTACCGGGTGGGAATACGCCAGTTTGCCCCCT
AGTAGAAAGGTCATCAAGAACTGGCTACAGCATCAAGGACATTTAAAGCAGGAAATGTCCACAAAAATGCCCCAC
TCACAGATCGATGGCCCCACGCAATTCAATATATATGGTTTTAAAGGCTCGCCGATAGCGCACGTTTATGCTACC
TCGAGGAGTAAACAAAGTATGACTATCTTGTCTGTCGAAGTCATGGCTCCTACTCATGGAAAAAACGTTCCGAAC
CCTGAGAGTGATCCAATATGCATCGCTGTCTATGGATTTCAAGTCGCTGGAACTGAAGATGTTCACACCGGGGTC
ATTGCGATTCAAAACATCCAGCTTAATCCAAGACGAATACGAGACTTCCACCTGGAAATTGTCGATACAGAGCTC
GATCTCCTGAATAGATTATCAGATATTGTTGCTGAGCTCGATCCTGATATTCTTACTGGGTGGGAGGTACAACAG
GCATCCTGGGGATACCTCTGGTTGCGTGCAAAACATTACGATTTTGATTTTCAGGATTTCCTATCTCGAGCCCCT
CCTTTAAAAGCCGGTAGCAATGACCGTTGGGACGGGCAAACAACATCGAACATCAAGGTCGCGGGTAGGCACGTT
TTGAACGTCTGGCGTATTATGAGGTCCGAATTGGCCTTGACGTCCTATACGCTGTCCAACGTAGCCTTTCATGTC
ATGCGGCAAAGGGTACCGTTCTACAGCTTTGCAACGTTATCAAGATGGTATGATAGTACGGGACCAAGCCACATG
GTGGCATTAATGCATTACCTGATACAACGGAACTGCGCAACTCTTCAAATACTAGAAGCAACTGAACTTGTTACC
AAGACAGCGGAATTTGCTCGTATCTTCGGCGTGGATTTCCACTCTGTCATCAGCCGCGGGTCACAGTTCAAGGTA
GAATCTTTCATGTTCCGTATTGCCAAATCCGAGAATTTTGTTTTGCTCTCCCCGAGTAAAAGTGATGTAGGGTTG
CAAAATGCAGCCGAATGCATGCCGCTCATCATGGAACCCATGTCGGCCTTTTACACAAGTCCTCTTGTCGTTTTG
GATTTTCAATCTCTTTATCCCTCTGTCATGATCGCTTATAATTACTGCTACTCAACTTGTCTTGGTCGTATCAAA
CCATTCCAAGGAAATTATAAATTCGGGGTCACCAATCTTGATTTAGGTCCTGGTATTCTGGACGCGCTGCAGGAA
CATATCACTGTCGCACCGAACGGTATCATGTACGTCAAATCGAACGTCCGAAAGGGTCTGTTAGGTCGTATGCTT
GTTGAACTTTTGAACACACGTGTGATGGTGAAGCAAGCTTTGAAATCTGCGAAGTCTGACAAGGCCTTAGCTCGT
GTTCTTCATGCACGCCAACTCGCATTGAAGTATATCGCGAATGTTACTTATGGATACACTAGCGCAACTTATTCT
GGTCGTATGCCCGCCGTAGAAATTGCCGACAGTATTGTCCAAACAGGCAGGGAAACACTTGAAAAAGCTATCGAC
TTTATCAACGGCAGTGAAAAATGGGGAGCGAGGGTCGTTTATGGTGACACTGATAGCTTGTTTGTCTACCTTCCT
GGAAAAACGAGAGAGCAAGCTTTTCGAATTGGCAATGAGATGGCGGACGCGGTCACAAGACAAAATCCGGTTCCT
ATTAAACTGAAGTTCGAGAAGGTCTACCTTCCCTGCGTCCTGATGGCTAAAAAACGTTATGTCGGATTCAAATAC
GAGAACCCTGATGAAACGGAACCAGAGTTTGACGCAAAAGGCATAGAAACCGTTCGAAGAGACGGTGTTTTAGCC
CAAAGAAAACTCGTCGAAAACTCCTTAAAGATTTTGTTTCGTACTCAGGATCTTAGCCAGGTCAAAGACTACTGC
TGCCGCTCTTGGTACCAGATCATGGAGAATAAAGTTCCTATTCAGGACTTTATATTTGCCAAAGAAGTGAGAATG
GGAACGTATAGCGAGAAAGGACCGCCACCACCTGGGGCTGTGGTAGCTGCTCGTAGAATGGTGCTTGACCCGAAC
GACGAACCTCAATATGGAGATCGAATCCCGTATATAATCAGTCGGGGAGAACCAGGGGCATTACTTGCAGAACGG
GCGCTGGATCCGCTTGAGATGATCAATGACCCCCGCCTTCAATTGGACGCGTTATATTATATCACACGCGTTTTG
ATTCCACCCCTGGAACGAGTGTTCAACCTGGTAGGGGCTGACGTACGGCAATGGTTTGCAGAAATGCCAAAGATT
AGCAATACTGTCTCAGAGCTAGCATTAGCCTCGCCAGGCAGACGTAGAAAAGTGGAAGATAGTGATAGAGAAGAG
TCACCTTCCTCACCCGGTCGGCGAGACCTCGAAGAGCACCTCGAAAACAATCAATGTCTTGTTTGTGGTGAAGTT
TCTTTTACCGAATTATGCGAGGAGTGTATCTTCTTACCTCAAACCAGTCTGACCATTCTTGGAGCGAAAACCGGC
AGACGAGAAGAGCGGATGCTGACCACACACAAGGTCTGCGTGACTTGCACAAGTATTGCTCCCAGCGAACCAGTC
GAATGCGAGTGTTTGGATTGTCCATGGTTTTACGCTCGAAAGAGGGCAGAGCATAAATTAGACATGATCGAAACC
ATGGATATCCTGATAGACGAGTTTGATTCAAAACTTTCAAGATCCCCTACAGCGAGTCCAAATAGCGCTTCAGAT
TCCAACCTCACTAGAATGTAA
Transcript >AgabiH97|006580
ATGTTCTCTGTGCAGATATATCAGATTGACTACGTTCTATCTCCTCCTGGCCCGCTTGACCGCTCTCACTACCCC
AGGGTGCCTATTCTGCGAATATTTGGCCAGTCTTCTGTTGGATTGCGAACCTGCCTTCATGTGCACCAAGTTTAT
CCTTACTGCTATATTGAATATCAAGGAGATCTCGATCTCCGACATGTGAAACAATACGTCCGAAAATTCAAAAAG
TCGTTAAATCATGCCATTGCTTTATCTTTAAAACGAGACCCTAACTCCACCAAATCTCAATATGTCTGTGCCGTT
GTGCTGGTTAAAGGCGTCAAATTCTATGGATTCCACTCGCAATATTCGCCATTCCTGAAAATAATACTGTTAGAC
CCACGGCTCATGAATCGTGTGGCCACCATTTTACAGTCTGGCTCGTTCATGTGCGATTTCGGTCTATACGGATGT
GGGTCCGTTGGAATCAGCAAGGCTTATCGACGAGCTGTATTGGGGTCCGAGACAGATATACTACCGGAGCAAGTC
ACGTCTTTTGAACCGTCACCCTACCCTCCACAGTCGCACATGCCCATAGAACTGGACGTAATCTCGCCAGAAATA
ACTAATCGAACACAAATCAAGGAGCGCTGCCTTCACCATCGCCTTGTGATACCTGGTCCTGAGCGACCATCCGAA
CCGATCGTTACGAGTATTCGCGAGTTATGGGAAGAAGAACGCGTGCGTCGTCGTGCTCTTGGTATGGAACCTTCA
CCCGAGCTGCCCCAAGATCCAAGCGAGGGGTCCAGGGAGACCGGCGGCGGTTGGATAGCAGAAGCTCGCTGGTGG
GATGAGATCCATTCTCGACTCGAACGCGAGCGCCCAGTGAATCAATCTCATTCTTCGAGTACCCCGCCGTGGGAG
AGCCAAGTAATGTCTATCTTCGAGAGCACAGAGGCACTTTGGGAATCAAGTTACAGAAGATGGAAACCTGACAAG
CAGACAATGTATGAGACTTCAAAACGTGATGAGGCAGTTCTTAACGAGTCGGATTTGTCGGCTATTGAGGAAGTT
GTAGAAGGTGGCGAAGTGGATGTGAACGAGGATTTACTGGCCTACAGGACGATCGATGACCTTGGGGACATGGAA
GAAGATGAGGTTTATAACGAAGACCGCGACCCCACGGACGGAGACCTGGACGAAGATAATGCGGAGGTCAAAGAA
ATAGAGGAAGAAAGCGACGACGAAGACACATCGGGAAACAGAGGAGCTTCCAGATCTTCGTCCCCCAACCCTTTC
TTAGATGATGGGACAACTAAGTGCTCTCGTCTCTTTTCTTCAAGCCAAGCCCAGAGTGCAGAAATACAGGAAAAT
GATAAGCAAAAGAAGGCCCAATTACAAGAACAACGCAGCACACCTACCTTTCTATCATCTGATGACAAAGAAAGT
CTTCAAAGCATACCCTTAGCGTCGACAATTCGAATTTCGTGTTCGCAGCTGACGAAGGCATATAACTTATGTCGA
AGAGGTAGTCAAAACAGTTATGCATATTATAAGCAGGCCCCCGGAGCAGCTGAAATTACGACCAGCTTTGAATCA
CTGGGCCTGCCGTCGAAAATCTATAAACCGCCATTTTATTCCAATGAGGATGACGCGCCAGAACAGCCTAAAGAG
TTCTCAGGATTAGTATATCATCTGAGAGGAGAAGGTACTTCGCTGCTCGAAGGCTTTGCATTTCCTTTTACAGGC
ATGGCAGGCGAACATGACAAGGACAAGTTATTGTTCCATGCTTGTACCGGGTGGGAATACGCCAGTTTGCCCCCT
AGTAGAAAGGTCATCAAGAACTGGCTACAGCATCAAGGACATTTAAAGCAGGAAATGTCCACAAAAATGCCCCAC
TCACAGATCGATGGCCCCACGCAATTCAATATATATGGTTTTAAAGGCTCGCCGATAGCGCACGTTTATGCTACC
TCGAGGAGTAAACAAAGTATGACTATCTTGTCTGTCGAAGTCATGGCTCCTACTCATGGAAAAAACGTTCCGAAC
CCTGAGAGTGATCCAATATGCATCGCTGTCTATGGATTTCAAGTCGCTGGAACTGAAGATGTTCACACCGGGGTC
ATTGCGATTCAAAACATCCAGCTTAATCCAAGACGAATACGAGACTTCCACCTGGAAATTGTCGATACAGAGCTC
GATCTCCTGAATAGATTATCAGATATTGTTGCTGAGCTCGATCCTGATATTCTTACTGGGTGGGAGGTACAACAG
GCATCCTGGGGATACCTCTGGTTGCGTGCAAAACATTACGATTTTGATTTTCAGGATTTCCTATCTCGAGCCCCT
CCTTTAAAAGCCGGTAGCAATGACCGTTGGGACGGGCAAACAACATCGAACATCAAGGTCGCGGGTAGGCACGTT
TTGAACGTCTGGCGTATTATGAGGTCCGAATTGGCCTTGACGTCCTATACGCTGTCCAACGTAGCCTTTCATGTC
ATGCGGCAAAGGGTACCGTTCTACAGCTTTGCAACGTTATCAAGATGGTATGATAGTACGGGACCAAGCCACATG
GTGGCATTAATGCATTACCTGATACAACGGAACTGCGCAACTCTTCAAATACTAGAAGCAACTGAACTTGTTACC
AAGACAGCGGAATTTGCTCGTATCTTCGGCGTGGATTTCCACTCTGTCATCAGCCGCGGGTCACAGTTCAAGGTA
GAATCTTTCATGTTCCGTATTGCCAAATCCGAGAATTTTGTTTTGCTCTCCCCGAGTAAAAGTGATGTAGGGTTG
CAAAATGCAGCCGAATGCATGCCGCTCATCATGGAACCCATGTCGGCCTTTTACACAAGTCCTCTTGTCGTTTTG
GATTTTCAATCTCTTTATCCCTCTGTCATGATCGCTTATAATTACTGCTACTCAACTTGTCTTGGTCGTATCAAA
CCATTCCAAGGAAATTATAAATTCGGGGTCACCAATCTTGATTTAGGTCCTGGTATTCTGGACGCGCTGCAGGAA
CATATCACTGTCGCACCGAACGGTATCATGTACGTCAAATCGAACGTCCGAAAGGGTCTGTTAGGTCGTATGCTT
GTTGAACTTTTGAACACACGTGTGATGGTGAAGCAAGCTTTGAAATCTGCGAAGTCTGACAAGGCCTTAGCTCGT
GTTCTTCATGCACGCCAACTCGCATTGAAGTATATCGCGAATGTTACTTATGGATACACTAGCGCAACTTATTCT
GGTCGTATGCCCGCCGTAGAAATTGCCGACAGTATTGTCCAAACAGGCAGGGAAACACTTGAAAAAGCTATCGAC
TTTATCAACGGCAGTGAAAAATGGGGAGCGAGGGTCGTTTATGGTGACACTGATAGCTTGTTTGTCTACCTTCCT
GGAAAAACGAGAGAGCAAGCTTTTCGAATTGGCAATGAGATGGCGGACGCGGTCACAAGACAAAATCCGGTTCCT
ATTAAACTGAAGTTCGAGAAGGTCTACCTTCCCTGCGTCCTGATGGCTAAAAAACGTTATGTCGGATTCAAATAC
GAGAACCCTGATGAAACGGAACCAGAGTTTGACGCAAAAGGCATAGAAACCGTTCGAAGAGACGGTGTTTTAGCC
CAAAGAAAACTCGTCGAAAACTCCTTAAAGATTTTGTTTCGTACTCAGGATCTTAGCCAGGTCAAAGACTACTGC
TGCCGCTCTTGGTACCAGATCATGGAGAATAAAGTTCCTATTCAGGACTTTATATTTGCCAAAGAAGTGAGAATG
GGAACGTATAGCGAGAAAGGACCGCCACCACCTGGGGCTGTGGTAGCTGCTCGTAGAATGGTGCTTGACCCGAAC
GACGAACCTCAATATGGAGATCGAATCCCGTATATAATCAGTCGGGGAGAACCAGGGGCATTACTTGCAGAACGG
GCGCTGGATCCGCTTGAGATGATCAATGACCCCCGCCTTCAATTGGACGCGTTATATTATATCACACGCGTTTTG
ATTCCACCCCTGGAACGAGTGTTCAACCTGGTAGGGGCTGACGTACGGCAATGGTTTGCAGAAATGCCAAAGATT
AGCAATACTGTCTCAGAGCTAGCATTAGCCTCGCCAGGCAGACGTAGAAAAGTGGAAGATAGTGATAGAGAAGAG
TCACCTTCCTCACCCGGTCGGCGAGACCTCGAAGAGCACCTCGAAAACAATCAATGTCTTGTTTGTGGTGAAGTT
TCTTTTACCGAATTATGCGAGGAGTGTATCTTCTTACCTCAAACCAGTCTGACCATTCTTGGAGCGAAAACCGGC
AGACGAGAAGAGCGGATGCTGACCACACACAAGGTCTGCGTGACTTGCACAAGTATTGCTCCCAGCGAACCAGTC
GAATGCGAGTGTTTGGATTGTCCATGGTTTTACGCTCGAAAGAGGGCAGAGCATAAATTAGACATGATCGAAACC
ATGGATATCCTGATAGACGAGTTTGATTCAAAACTTTCAAGATCCCCTACAGCGAGTCCAAATAGCGCTTCAGAT
TCCAACCTCACTAGAATGTAA
Gene >AgabiH97|006580
ATGTTCTCTGTGCAGATATATCAGATTGACTACGTTCTATCTCCTCCTGGCCCGCTTGACCGCTCTCACTACCCC
AGGGTGCCTATTCTGCGAATATTTGGCCAGTCTTCTGTTGGATTGCGAACCTGCCTTCATGTGCACCAAGTTTAT
CCTTACTGCTATATTGAATATCAAGGAGATCTCGATCTCCGACATGGTACGTTTATGAGCTGTCCAGTATTTATC
AACCTGAGGCCCCGCACAGTGAAACAATACGTCCGAAAATTCAAAAAGTCGTTAAATCATGCCATTGCTTTATCT
TTAAAACGAGACCCTAACTCCACCAAATCTCAATATGTCTGTGCCGTTGTGCTGGTTAAAGGCGTCAAATTCTAT
GGATTCCACTCGCAATATTCGCCATTCCTGAAAATAATACTGTTAGACCCACGGCTCATGAATCGTGTGGCCACC
ATTTTACAGTCTGGCTCGGTAATGAGTCAGCGCTTTCCAGTGTATGAAAGTCACCTCAGTTTCACTCTGCAGTTC
ATGTGCGATTTCGGTCTATACGGATGTGGGTCCGTTGGAATCAGCAAGGCTTATCGACGAGCTGTATTGGGGTCC
GAGACAGATATACTACCGGAGCAAGTCACGTCTTTTGAACCGTCACCCTACCCTCCACAGTCGCACATGCCCATA
GAACTGGACGTAATCTCGCCAGAAATAACTAATCGAACACAAATCAAGGAGCGCTGCCTTCACCATCGCCTTGTG
ATACCTGGTCCTGAGCGACCATCCGAACCGATCGTTACGAGTATTCGCGAGTTATGGGAAGAAGAACGCGTGCGT
CGTCGTGCTCTTGGTATGGAACCTTCACCCGAGCTGCCCCAAGATCCAAGCGAGGGGTCCAGGGAGACCGGCGGC
GGTTGGATAGCAGAAGCTCGCTGGTGGGATGAGATCCATTCTCGACTCGAACGCGAGCGCCCAGTGAATCAATCT
CATTCTTCGAGTACCCCGCCGTGGGAGAGCCAAGTAATGTCTATCTTCGAGAGCACAGAGGCACTTTGGGAATCA
AGTTACAGAAGATGGAAACCTGACAAGCAGACAATGTATGAGACTTCAAAACGTGATGAGGCAGTTCTTAACGAG
TCGGATTTGTCGGCTATTGAGGAAGTTGTAGAAGGTGGCGAAGTGGATGTGAACGAGGATTTACTGGCCTACAGG
ACGATCGATGACCTTGGGGACATGGAAGAAGATGAGGTTTATAACGAAGACCGCGACCCCACGGACGGAGACCTG
GACGAAGATAATGCGGAGGTCAAAGAAATAGAGGAAGAAAGCGACGACGAAGACACATCGGGAAACAGAGGAGCT
TCCAGGTTGGTGTGTGAAATACTAGAACTTGATCCGCTCGCTTACTCTACACCAGATCTTCGTCCCCCAACCCTT
TCTTAGATGATGGGACAACTAAGTGCTCTCGTCTCTTTTCTTCAAGGTTGGACTCGGCTATCATCATCTGAGCGT
ATTGATTGAGCCATTTCGATAGCCAAGCCCAGAGGTAAGTGGATTGAAAACGCGTCTCGGAAACGCGAAATCAGA
ATGGCAACACCGGATATTCACTTAAAAGAAAGTGCAGAAATACAGGAAAATGATAAGCAAAAGTGAGCCTCCGAT
AATCTGTACTGATGCCGCGTTTTCTGTATGGAGACCTCACCTACGGCTAGGAAGGCCCAATTACAAGAACAACGC
AGCACACCTACCTTTCTATCATCTGATGACAAAGAAAGTCTTCAAAGCATACCCTTAGCGTCGACAATTCGAATT
TCGTGTTCGCAGCTGACGAAGGCATATAACTTATGTCGAAGAGGTAGTCAAAACAGTTATGCATATTATAAGCAG
GCCCCCGGAGCAGCTGAAATTACGACCAGCTTTGAATCACTGGGCCTGCCGTCGAAAATCTATAAACCGCCATTT
TATTCCAATGAGGATGACGCGCCAGAACAGCCTAAAGAGTTCTCAGGATTAGTATATCATCTGAGAGGAGAAGGT
ACTTCGCTGCTCGAAGGCTTTGCATTTCCTTTTACAGGCATGGCAGGCGAACATGACAAGGACAAGTTATTGTTC
CATGCTTGTACCGGGTGGGAATACGCCAGTTTGCCCCCTAGTAGAAAGGTCATCAAGAACTGGCTACAGCATCAA
GGACATTTAAAGCAGGAAATGTCCACAAAAATGCCCCACTCACAGGTTTGACTCCTTCCGTTCTACGACGACAGA
TTTATTCATTTAATTTTCGCTTTAACTAAGATCGATGGCCCCACGCAATTCAATATATATGGTTTTAAAGGCTCG
CCGATAGCGCACGTTTATGCTACCTCGAGGAGTAAACAAAGTATGACTATCTTGTCTGTCGAAGTCATGGGTACA
ATTTCTACGTTTCATCAAAGACGAGAATCTTACGACTAATTTCCGAAGCTCCTACTCATGGAAAAAACGTTCCGA
ACCCTGAGAGTGATCCAATATGCATCGCTGTCTATGGATTTCAAGTCGCTGGAACTGAAGATGTTCACACCGGGG
TCATTGCGATTCAAAACATCCAGCTTAATCCAAGACGAATACGAGACTTCCACCTGGAAATTGTCGATACAGAGC
TCGATCTCCTGAATAGATTATCAGATATTGTTGCTGAGCTCGATCCTGATATTCTTACTGGGTGGGAGGTACAAC
AGGCATCCTGGGGATACCTCTGGTTGCGTGCAAAACATTACGGTCGATGTTTTATTATCTCATGCGTCCTTTCAG
GTGCTTACGGCTGCTTCACAGATTTTGATTTTCAGGATTTCCTATCTCGAGCCCCTCCTTTAAAAGCCGGTAGCA
ATGACCGTTGGGACGGGCAAACAACATCGAACATCAAGGTCGCGGGTAGGCACGTTTTGAACGTCTGGCGTATTA
TGAGGTCCGAATTGGCCTTGACGTCCTATACGCTGTCCAACGTAGCCTTTCATGTCATGCGGCAAAGGTACTACT
TGAGTCAAACAATACCTCTCCGCAAACGGTCTTACTGATATCGCTGTCCAGGGTACCGTTCTACAGCTTTGCAAC
GTTATCAAGATGGTATGATAGTACGGGACCAAGCCACATGGTGGCATTAATGCATTACCTGATACAACGGAACTG
CGCAACTCTTCAAATACTAGAAGCAACTGAACTTGTTACCAAGACAGCGTACGTCTGTTGTTTATCTACAATATC
TCGTAACTTATTCAATGTCTAGGGAATTTGCTCGTATCTTCGGCGTGGATTTCCACTCTGTCATCAGCCGCGGGT
CACAGTTCAAGGTAGAATCTTTCATGTTCCGTATTGCCAAATCCGAGAATTTTGTTTTGCTCTCCCCGAGTAAAA
GTGATGTCTGTATTTTTTTCTCTTCCAAGGCCGTAGATCTCAAGGCATACATCACAGGTAGGGTTGCAAAATGCA
GCCGAATGCATGCCGCTCATCATGGAACCCATGTCGGCCTTTTACACAAGTCCTCTTGTCGTTTTGGATTTTCAA
TCTCTTTATCCCTCTGTCATGATCGCTTATAATTACTGCTACTCAACTTGTCTTGGTCGTATCAAACCATTCCAA
GGAAATTATAAATTCGGGGTCACCAATCTTGATTTAGGTCCTGGTATTCTGGACGCGCTGCAGGAACATATCACT
GGTAGTGATGATGGTTCGTCCCTCATGCAATTGCCTGACTCCTGTACTTTACAGTCGCACCGAACGGTATCATGT
ACGTCAAATCGAACGTCCGAAAGGGTCTGTTAGGTCGTATGCTTGTTGAACTTTTGAACACACGTGTGATGGTGA
AGCAAGCTTTGAAATCTGCGAAGTCTGACAAGGCGGGTTTTATCCTTTCATCAATGAAGGGTTCCAATATGCTTA
TCCTTTGTCGGCAGGCCTTAGCTCGTGTTCTTCATGCACGCCAACTCGCATTGAAGTATATCGCGAATGTTACTT
ATGGATACACTAGCGCAACTTATTCTGGTCGTATGCCCGCCGTAGAAATTGCCGACAGTATTGTCCAAACAGGCA
GGGAAACACTTGAAAAAGTGGGGGGCGTTTCGTTCGGATTGAACGAAGTCGTCTCTGATTATACTTTTCTAGGCT
ATCGACTTTATCAACGGCAGTGAAAAATGGGGAGCGAGGGTAAGATATCCAAGCAAATTAAAAGAATATGACCCT
GTGATGCTCTGCTAGGTCGTTTATGGTGACACTGATAGCTTGTTTGTGTGAGTCGGGAGAAAACTACTCGGCGTA
TCCTTACTTTTGATGTCAGCTACCTTCCTGGAAAAACGAGAGAGCAAGCTTTTCGAATTGGCAATGAGATGGCGG
ACGCGGTCACAAGACAAAATCCGGTTCCTATTAAACTGAAGTTCGAGAAGGTGGGCTTTCCTCACCAGTCTTGGT
TTCCTACTAGAGCAGAAGTAGGTCTACCTTCCCTGCGTCCTGATGGCTAAAAAACGTTATGTCGGATTCAAATAC
GAGAACCCTGATGAAACGGAACCAGAGTTTGACGCAAAAGGCATAGAAACCGTTCGAAGAGACGGTGTTTTAGCC
CAAAGAAAACTCGTCGAAAACTCCTTAAAGTGCACCTCTATCCTTGTTGATATCCACTTCATATTAACCGCATGT
TAGGATTTTGTTTCGTACTCAGGATCTTAGCCAGGTCAAAGACTACTGCTGCCGCTCTTGGTACCAGATCATGGA
GAATAAAGTTCCTATTCAGGACTTTATATTTGCCAAAGAAGTGAGAATGGGAACGTATAGGTGGGCTGGCTTCTT
TGAATCTAGCATATCTCTCTTTCTGAGGCTGTCGCATAGCGAGAAAGGACCGCCACCACCTGGGGCTGTGGTAGC
TGCTCGTAGAATGGTGCTTGACCCGAACGACGAACCTCAATATGGAGATCGAATCCCGTATATAATCAGTCGGGG
AGAACCAGGGGCATTACTTGCAGAACGGGCGCTGGATCCGCTTGAGATGATCAATGACCCGTGAGTTCTCATCGC
CGAAACAAGGATCCTGTCTGACACTCGAAGCAGCCGCCTTCAATTGGACGCGTTATATTATATCACACGCGTTTT
GATTCCACCCCTGGAACGAGTGTTCAACCTGGTAGGGGCTGACGTACGGCAATGGTTTGCAGAAATGCCAAAGAT
TAGCAATACTGTCTCAGAGCTAGCATTAGCCTCGCCAGGCAGACGTAGAAAAGTGGAAGATAGTGATAGAGAAGA
GTCACCTTCCTCACCCGGTCGGCGAGACCTCGAAGAGCACCTCGAAAACAATCAATGTCTTGTTTGTGGTGAAGT
TTCTTTTACCGGTATGTCTGGTTAAATTTTGTGCGCCGAGTTTTTCAAACAGAGAGAACAGAATTATGCGAGGAG
TGTATCTTCTTACCTCAAACCAGTCTGACCATTCTTGGAGCGAAAACCGGCAGACGAGAAGAGCGGATGCTGACC
ACACACAAGGTCTGCGTGACTTGCACAAGTATTGCTCCCAGCGAACCAGTCGAATGCGAGTGTTTGGATTGTCCA
TGGTTTTACGCTCGAAAGAGGGCAGAGCATAAATTAGACATGATCGAAACCATGGATATCCTGATAGACGAGTTT
GATTCAAAACTTTCAAGATCCCCTACAGCGAGTCCAAATAGCGCTTCAGATTCCAACCTCACTAGAATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail