Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006400
Gene name
Locationscaffold_1:1549268..1551654
Strand+
Gene length (bp)2386
Transcript length (bp)2082
Coding sequence length (bp)2082
Protein length (aa) 694

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05026 DCP2 Dcp2, box A domain 2.8E-30 30 112
PF00293 NUDIX NUDIX domain 3.5E-13 117 228

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13828|DCP2_SCHPO mRNA decapping complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcp2 PE=1 SV=1 21 251 2.0E-92
sp|Q8GW31|DCP2_ARATH mRNA-decapping enzyme subunit 2 OS=Arabidopsis thaliana GN=DCP2 PE=1 SV=1 29 324 2.0E-66
sp|Q9CYC6|DCP2_MOUSE m7GpppN-mRNA hydrolase OS=Mus musculus GN=Dcp2 PE=1 SV=2 31 251 4.0E-58
sp|Q8IU60|DCP2_HUMAN m7GpppN-mRNA hydrolase OS=Homo sapiens GN=DCP2 PE=1 SV=2 31 251 1.0E-57
sp|Q5REQ8|DCP2_PONAB m7GpppN-mRNA hydrolase OS=Pongo abelii GN=DCP2 PE=2 SV=1 31 251 7.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13828|DCP2_SCHPO mRNA decapping complex subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dcp2 PE=1 SV=1 21 251 2.0E-92
sp|Q8GW31|DCP2_ARATH mRNA-decapping enzyme subunit 2 OS=Arabidopsis thaliana GN=DCP2 PE=1 SV=1 29 324 2.0E-66
sp|Q9CYC6|DCP2_MOUSE m7GpppN-mRNA hydrolase OS=Mus musculus GN=Dcp2 PE=1 SV=2 31 251 4.0E-58
sp|Q8IU60|DCP2_HUMAN m7GpppN-mRNA hydrolase OS=Homo sapiens GN=DCP2 PE=1 SV=2 31 251 1.0E-57
sp|Q5REQ8|DCP2_PONAB m7GpppN-mRNA hydrolase OS=Pongo abelii GN=DCP2 PE=2 SV=1 31 251 7.0E-57
sp|Q75BK1|DCP2_ASHGO mRNA-decapping enzyme subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCP2 PE=3 SV=1 26 256 2.0E-51
sp|A6ZRW5|DCP2_YEAS7 mRNA-decapping enzyme subunit 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DCP2 PE=3 SV=1 26 251 9.0E-50
sp|P53550|DCP2_YEAST mRNA-decapping enzyme subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCP2 PE=1 SV=1 26 251 1.0E-49
sp|O62255|DCP2_CAEEL mRNA-decapping enzyme 2 OS=Caenorhabditis elegans GN=dcap-2 PE=2 SV=4 30 261 7.0E-43
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006400
MASSSPEFVPSANSTEPQPRFSYKDASHEEVLEDLSSRFILNLPDEELASLERICFQVEQAHWFYEDFIREQNPV
FPSLPLKKFSAMLFHACPLLHQWSNDHENAFNLFMQYKTRVPVCGAIMLNSTWDKCVLVKGWKSSSGWGFPKGKI
NEDEPKHTCAIREVLEETGYNLAGKLKPEDVIELSIKEQRISLFIVPGVEEDFPFETKTRKEISRIEWFQLSDLP
TWKRNKQVPGKFYLISPFIGPLKAFINLHKHRPPRKGGRHKKGQKQAQVGTHCSDTDPILESDSQTSDNQTEKNA
NKSRTPPLADGVLESENIDPHFARLLSSLTLSASSNLVAPTNEIQSAMDPATPVPSAVHRSLDPEPLLDSSAHTI
LQPPPHQSIASPSSSSQRDLSSTPVATPQRTQPISSHHSHNLRNDVLYSPSTTQAPDDSAVARSPYAHRPRTDIS
PYLTKATVDTTSTRRLQQLALLEKVADESARMVPQSSAGGPVSIPVSPMSIPPTASVDPDFTRGVYYHTPSSSLG
SRPDSSNHESLDYLDSNPHTKARQAFHRGFPQSQDSQGNLSMDHSQLLALMNNAAPVAPHPHSFQQPFGFPSGHF
QPHSPLYGPTSFPSISNIPNNSPYVVPMSARSMASAGLPVSNPNRFASATPAVDSFSLRMAPTNTAHTLLSILNG
RPTLPGNPAGPASVNQPI*
Coding >AgabiH97|006400
ATGGCTTCGTCGTCACCCGAATTCGTCCCGTCTGCCAATTCTACTGAACCGCAACCCCGCTTCTCTTACAAGGAT
GCCTCGCACGAAGAGGTTTTGGAGGACCTGTCAAGTCGATTTATTCTCAACCTTCCAGATGAAGAGTTAGCTTCT
CTTGAACGTATCTGTTTTCAAGTGGAGCAGGCACATTGGTTTTATGAAGATTTCATTCGCGAACAAAATCCAGTG
TTCCCTTCGCTGCCGCTCAAGAAGTTTTCTGCCATGCTTTTCCATGCTTGCCCTCTTCTCCACCAGTGGAGCAAT
GATCACGAAAATGCTTTCAATCTCTTCATGCAGTACAAGACTCGTGTACCTGTATGCGGAGCCATCATGCTGAAT
AGTACTTGGGATAAATGCGTGCTAGTGAAGGGCTGGAAATCATCCTCTGGGTGGGGTTTTCCTAAGGGGAAAATT
AATGAAGACGAACCAAAGCATACTTGTGCTATTCGAGAGGTTCTAGAAGAGACAGGATACAATCTTGCTGGAAAG
TTGAAACCCGAAGATGTCATTGAGTTGTCTATAAAAGAGCAAAGAATATCTTTATTTATTGTGCCAGGAGTGGAG
GAAGATTTTCCTTTCGAAACGAAGACCCGTAAAGAAATCAGCCGTATAGAGTGGTTCCAACTCTCCGATCTGCCG
ACATGGAAGCGAAACAAACAAGTGCCTGGAAAATTCTATCTAATTTCTCCGTTCATCGGCCCTCTCAAAGCATTC
ATAAATTTACATAAACACCGACCGCCACGAAAGGGTGGCCGGCACAAAAAAGGCCAAAAACAGGCTCAAGTCGGC
ACTCATTGTTCAGACACCGATCCTATACTCGAGTCGGATTCACAGACTTCAGATAACCAGACAGAGAAAAATGCA
AACAAGTCCCGAACTCCGCCTTTGGCAGATGGTGTTCTCGAATCCGAGAATATTGACCCCCATTTCGCTCGTCTT
TTAAGTTCACTGACACTTTCAGCTTCTAGCAATCTTGTGGCCCCGACCAATGAAATCCAATCCGCAATGGATCCC
GCCACGCCTGTTCCTAGTGCAGTGCATCGCAGCCTTGACCCTGAACCACTCTTGGACTCAAGCGCTCATACTATC
CTGCAACCACCACCGCACCAATCGATTGCCTCACCTTCAAGCAGTTCTCAGCGTGATCTATCTTCTACGCCCGTA
GCTACACCACAACGAACTCAGCCCATCAGTTCTCACCATAGCCACAATCTCCGCAATGACGTGTTGTATTCACCG
TCCACAACACAAGCACCTGATGATTCGGCAGTAGCTAGAAGTCCGTACGCACACCGTCCTAGGACGGATATATCG
CCATACTTGACAAAGGCCACCGTTGACACGACATCAACACGACGACTGCAACAGCTTGCTCTACTGGAGAAAGTT
GCGGATGAGTCGGCGAGAATGGTTCCCCAATCTTCGGCGGGTGGTCCAGTTTCAATCCCTGTGTCACCCATGTCT
ATACCCCCAACGGCATCTGTGGATCCAGATTTTACTCGCGGGGTGTACTATCACACTCCGTCGTCGTCGCTAGGG
TCCCGGCCGGATTCTTCTAATCATGAAAGTTTGGATTATTTGGATTCTAATCCTCATACAAAAGCTAGGCAGGCT
TTTCATCGAGGATTTCCCCAATCCCAGGATAGTCAGGGTAACCTTAGCATGGACCACAGTCAACTGTTAGCCTTG
ATGAATAACGCAGCGCCAGTGGCTCCGCACCCACACTCTTTTCAACAACCTTTCGGCTTTCCTTCAGGGCACTTT
CAACCTCATTCGCCGTTATACGGTCCCACGTCTTTCCCCTCAATTTCCAATATCCCGAATAATTCACCATACGTG
GTACCTATGAGTGCTAGAAGCATGGCTTCAGCAGGCCTCCCTGTTTCTAATCCAAATCGGTTTGCATCAGCCACA
CCAGCAGTCGACAGTTTTTCGTTGAGGATGGCGCCAACTAATACTGCCCACACGCTCCTCTCTATCCTCAACGGG
AGGCCTACATTGCCGGGCAATCCAGCCGGGCCTGCATCAGTCAACCAACCGATATGA
Transcript >AgabiH97|006400
ATGGCTTCGTCGTCACCCGAATTCGTCCCGTCTGCCAATTCTACTGAACCGCAACCCCGCTTCTCTTACAAGGAT
GCCTCGCACGAAGAGGTTTTGGAGGACCTGTCAAGTCGATTTATTCTCAACCTTCCAGATGAAGAGTTAGCTTCT
CTTGAACGTATCTGTTTTCAAGTGGAGCAGGCACATTGGTTTTATGAAGATTTCATTCGCGAACAAAATCCAGTG
TTCCCTTCGCTGCCGCTCAAGAAGTTTTCTGCCATGCTTTTCCATGCTTGCCCTCTTCTCCACCAGTGGAGCAAT
GATCACGAAAATGCTTTCAATCTCTTCATGCAGTACAAGACTCGTGTACCTGTATGCGGAGCCATCATGCTGAAT
AGTACTTGGGATAAATGCGTGCTAGTGAAGGGCTGGAAATCATCCTCTGGGTGGGGTTTTCCTAAGGGGAAAATT
AATGAAGACGAACCAAAGCATACTTGTGCTATTCGAGAGGTTCTAGAAGAGACAGGATACAATCTTGCTGGAAAG
TTGAAACCCGAAGATGTCATTGAGTTGTCTATAAAAGAGCAAAGAATATCTTTATTTATTGTGCCAGGAGTGGAG
GAAGATTTTCCTTTCGAAACGAAGACCCGTAAAGAAATCAGCCGTATAGAGTGGTTCCAACTCTCCGATCTGCCG
ACATGGAAGCGAAACAAACAAGTGCCTGGAAAATTCTATCTAATTTCTCCGTTCATCGGCCCTCTCAAAGCATTC
ATAAATTTACATAAACACCGACCGCCACGAAAGGGTGGCCGGCACAAAAAAGGCCAAAAACAGGCTCAAGTCGGC
ACTCATTGTTCAGACACCGATCCTATACTCGAGTCGGATTCACAGACTTCAGATAACCAGACAGAGAAAAATGCA
AACAAGTCCCGAACTCCGCCTTTGGCAGATGGTGTTCTCGAATCCGAGAATATTGACCCCCATTTCGCTCGTCTT
TTAAGTTCACTGACACTTTCAGCTTCTAGCAATCTTGTGGCCCCGACCAATGAAATCCAATCCGCAATGGATCCC
GCCACGCCTGTTCCTAGTGCAGTGCATCGCAGCCTTGACCCTGAACCACTCTTGGACTCAAGCGCTCATACTATC
CTGCAACCACCACCGCACCAATCGATTGCCTCACCTTCAAGCAGTTCTCAGCGTGATCTATCTTCTACGCCCGTA
GCTACACCACAACGAACTCAGCCCATCAGTTCTCACCATAGCCACAATCTCCGCAATGACGTGTTGTATTCACCG
TCCACAACACAAGCACCTGATGATTCGGCAGTAGCTAGAAGTCCGTACGCACACCGTCCTAGGACGGATATATCG
CCATACTTGACAAAGGCCACCGTTGACACGACATCAACACGACGACTGCAACAGCTTGCTCTACTGGAGAAAGTT
GCGGATGAGTCGGCGAGAATGGTTCCCCAATCTTCGGCGGGTGGTCCAGTTTCAATCCCTGTGTCACCCATGTCT
ATACCCCCAACGGCATCTGTGGATCCAGATTTTACTCGCGGGGTGTACTATCACACTCCGTCGTCGTCGCTAGGG
TCCCGGCCGGATTCTTCTAATCATGAAAGTTTGGATTATTTGGATTCTAATCCTCATACAAAAGCTAGGCAGGCT
TTTCATCGAGGATTTCCCCAATCCCAGGATAGTCAGGGTAACCTTAGCATGGACCACAGTCAACTGTTAGCCTTG
ATGAATAACGCAGCGCCAGTGGCTCCGCACCCACACTCTTTTCAACAACCTTTCGGCTTTCCTTCAGGGCACTTT
CAACCTCATTCGCCGTTATACGGTCCCACGTCTTTCCCCTCAATTTCCAATATCCCGAATAATTCACCATACGTG
GTACCTATGAGTGCTAGAAGCATGGCTTCAGCAGGCCTCCCTGTTTCTAATCCAAATCGGTTTGCATCAGCCACA
CCAGCAGTCGACAGTTTTTCGTTGAGGATGGCGCCAACTAATACTGCCCACACGCTCCTCTCTATCCTCAACGGG
AGGCCTACATTGCCGGGCAATCCAGCCGGGCCTGCATCAGTCAACCAACCGATATGA
Gene >AgabiH97|006400
ATGGCTTCGTCGTCACCCGAATTCGTCCCGTCTGCCAATTCTACTGAACCGCAACCCCGCTTCTCTTACAAGGAT
GCCTCGCACGAAGAGGTTTTGGAGGACCTGTCAAGGTATTTGTTTCCAAAGAAGAAGCCTCAAACTTGCATAACG
TTGTTTGCAGTCGATTTATTCTCAACCTTCCAGATGAAGAGTTAGCTTCTCTTGAACGTATCTGTTTTCAAGTGG
AGCAGGCGTCCGTTTTTCCAGCCACCAGAAACTTCCATCGCCCTGACCCGTTTTTGCTTTCAGACATTGGTTTTA
TGAAGATTTCATTCGCGAACAAAATCCAGTGTTCCCTTCGCTGCCGCTCAAGAAGTTTTCTGCCATGCTTTTCCA
TGCTTGCCCTCTTCTCCACCAGTGGAGCAATGATCACGAAAATGCTTTCAATCTCTTCATGCAGTACAAGACTCG
TGTACCTGTATGCGGAGCCATCATGCTGAATAGTACTTGGGATAAAGTGAGTAGTCTAATGCTCCCTAGTGGCAA
CAATCTCAGTGGCTTTGATGTAGTGCGTGCTAGTGAAGGGCTGGAAATCATCCTCTGGGTGGGGTTTTCCTAAGG
GGAAAATTAATGAAGACGAACCAAAGCATACTTGTGCTATTCGAGAGGTATGTTTTGATGCACAACTTCGCCACG
TCGTTGCTGAATAATCACCGTAGGTTCTAGAAGAGACAGGATACAATCTTGCTGGAAAGTTGAAACCCGAAGATG
TCATTGAGTTGTCTATAAAAGAGCAAAGAATATCTTTATTTATTGTGCCAGGAGTGGAGGAAGATTTTCCTTTCG
AAACGAAGACCCGTAAAGAAATCAGCGTAAGTAATGTTTTGCTAAACTAGGGACATAAATTCATCCTCGACCAGC
GTATAGAGTGGTTCCAACTCTCCGATCTGCCGACATGGAAGCGAAACAAACAAGTGCCTGGAAAATTCTATCTAA
TTTCTCCGTTCATCGGGTGAGCATTATTAACCTATTTTTTGCCTGAGTCTGATTATTTCTCAGCCCTCTCAAAGC
ATTCATAAATTTACATAAACACCGACCGCCACGAAAGGGTGGCCGGCACAAAAAAGGCCAAAAACAGGCTCAAGT
CGGCACTCATTGTTCAGACACCGATCCTATACTCGAGTCGGATTCACAGACTTCAGATAACCAGACAGAGAAAAA
TGCAAACAAGTCCCGAACTCCGCCTTTGGCAGATGGTGTTCTCGAATCCGAGAATATTGACCCCCATTTCGCTCG
TCTTTTAAGTTCACTGACACTTTCAGCTTCTAGCAATCTTGTGGCCCCGACCAATGAAATCCAATCCGCAATGGA
TCCCGCCACGCCTGTTCCTAGTGCAGTGCATCGCAGCCTTGACCCTGAACCACTCTTGGACTCAAGCGCTCATAC
TATCCTGCAACCACCACCGCACCAATCGATTGCCTCACCTTCAAGCAGTTCTCAGCGTGATCTATCTTCTACGCC
CGTAGCTACACCACAACGAACTCAGCCCATCAGTTCTCACCATAGCCACAATCTCCGCAATGACGTGTTGTATTC
ACCGTCCACAACACAAGCACCTGATGATTCGGCAGTAGCTAGAAGTCCGTACGCACACCGTCCTAGGACGGATAT
ATCGCCATACTTGACAAAGGCCACCGTTGACACGACATCAACACGACGACTGCAACAGCTTGCTCTACTGGAGAA
AGTTGCGGATGAGTCGGCGAGAATGGTTCCCCAATCTTCGGCGGGTGGTCCAGTTTCAATCCCTGTGTCACCCAT
GTCTATACCCCCAACGGCATCTGTGGATCCAGATTTTACTCGCGGGGTGTACTATCACACTCCGTCGTCGTCGCT
AGGGTCCCGGCCGGATTCTTCTAATCATGAAAGTTTGGATTATTTGGATTCTAATCCTCATACAAAAGCTAGGCA
GGCTTTTCATCGAGGATTTCCCCAATCCCAGGATAGTCAGGGTAACCTTAGCATGGACCACAGTCAACTGTTAGC
CTTGATGAATAACGCAGCGCCAGTGGCTCCGCACCCACACTCTTTTCAACAACCTTTCGGCTTTCCTTCAGGGCA
CTTTCAACCTCATTCGCCGTTATACGGTCCCACGTCTTTCCCCTCAATTTCCAATATCCCGAATAATTCACCATA
CGTGGTACCTATGAGTGCTAGAAGCATGGCTTCAGCAGGCCTCCCTGTTTCTAATCCAAATCGGTTTGCATCAGC
CACACCAGCAGTCGACAGTTTTTCGTTGAGGATGGCGCCAACTAATACTGCCCACACGCTCCTCTCTATCCTCAA
CGGGAGGCCTACATTGCCGGGCAATCCAGCCGGGCCTGCATCAGTCAACCAACCGATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail