Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006360
Gene name
Locationscaffold_1:1538589..1539516
Strand-
Gene length (bp)927
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00293 NUDIX NUDIX domain 7.4E-25 64 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42641|IDI1_PHARH Isopentenyl-diphosphate Delta-isomerase OS=Phaffia rhodozyma GN=IDI PE=3 SV=1 11 252 6.0E-108
sp|Q10132|IDI1_SCHPO Isopentenyl-diphosphate Delta-isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idi1 PE=2 SV=2 23 225 1.0E-83
sp|P15496|IDI1_YEAST Isopentenyl-diphosphate Delta-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDI1 PE=1 SV=2 20 225 1.0E-83
sp|O35760|IDI1_RAT Isopentenyl-diphosphate Delta-isomerase 1 OS=Rattus norvegicus GN=Idi1 PE=2 SV=2 15 252 4.0E-78
sp|O35586|IDI1_MESAU Isopentenyl-diphosphate Delta-isomerase 1 OS=Mesocricetus auratus GN=IDI1 PE=2 SV=1 15 252 9.0E-78
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42641|IDI1_PHARH Isopentenyl-diphosphate Delta-isomerase OS=Phaffia rhodozyma GN=IDI PE=3 SV=1 11 252 6.0E-108
sp|Q10132|IDI1_SCHPO Isopentenyl-diphosphate Delta-isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=idi1 PE=2 SV=2 23 225 1.0E-83
sp|P15496|IDI1_YEAST Isopentenyl-diphosphate Delta-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IDI1 PE=1 SV=2 20 225 1.0E-83
sp|O35760|IDI1_RAT Isopentenyl-diphosphate Delta-isomerase 1 OS=Rattus norvegicus GN=Idi1 PE=2 SV=2 15 252 4.0E-78
sp|O35586|IDI1_MESAU Isopentenyl-diphosphate Delta-isomerase 1 OS=Mesocricetus auratus GN=IDI1 PE=2 SV=1 15 252 9.0E-78
sp|P58044|IDI1_MOUSE Isopentenyl-diphosphate Delta-isomerase 1 OS=Mus musculus GN=Idi1 PE=1 SV=1 15 225 6.0E-77
sp|Q1LZ95|IDI1_BOVIN Isopentenyl-diphosphate Delta-isomerase 1 OS=Bos taurus GN=IDI1 PE=2 SV=2 24 252 1.0E-76
sp|Q13907|IDI1_HUMAN Isopentenyl-diphosphate Delta-isomerase 1 OS=Homo sapiens GN=IDI1 PE=1 SV=2 15 252 6.0E-76
sp|Q4R4W5|IDI1_MACFA Isopentenyl-diphosphate Delta-isomerase 1 OS=Macaca fascicularis GN=IDI1 PE=2 SV=2 15 252 7.0E-76
sp|Q5R8R6|IDI1_PONAB Isopentenyl-diphosphate Delta-isomerase 1 OS=Pongo abelii GN=IDI1 PE=2 SV=2 15 225 2.0E-74
sp|O48964|IDI1_CAMAC Isopentenyl-diphosphate Delta-isomerase I OS=Camptotheca acuminata GN=IPI1 PE=2 SV=1 21 227 6.0E-68
sp|Q9NH02|IDI_DICDI Isopentenyl-diphosphate Delta-isomerase OS=Dictyostelium discoideum GN=ipi PE=2 SV=1 10 229 1.0E-67
sp|Q38929|IDI1_ARATH Isopentenyl-diphosphate Delta-isomerase I, chloroplastic OS=Arabidopsis thaliana GN=IPP1 PE=2 SV=3 21 227 8.0E-66
sp|Q39472|IDI1_CLABR Isopentenyl-diphosphate Delta-isomerase I OS=Clarkia breweri GN=IPI1 PE=2 SV=2 1 227 9.0E-66
sp|Q42553|IDI2_ARATH Isopentenyl-diphosphate Delta-isomerase II, chloroplastic OS=Arabidopsis thaliana GN=IPP2 PE=1 SV=1 21 227 2.0E-65
sp|O48965|IDI2_CAMAC Isopentenyl-diphosphate Delta-isomerase II OS=Camptotheca acuminata GN=IPI2 PE=2 SV=1 7 227 4.0E-65
sp|Q39471|IDI2_CLABR Isopentenyl-diphosphate Delta-isomerase II OS=Clarkia breweri GN=IPI2 PE=3 SV=2 1 227 1.0E-63
sp|Q39664|IDI2_CLAXA Isopentenyl-diphosphate Delta-isomerase II OS=Clarkia xantiana GN=IPI2 PE=3 SV=1 21 233 1.0E-62
sp|Q8BFZ6|IDI2_MOUSE Isopentenyl-diphosphate delta-isomerase 2 OS=Mus musculus GN=Idi2 PE=2 SV=1 24 225 4.0E-56
sp|Q9BXS1|IDI2_HUMAN Isopentenyl-diphosphate delta-isomerase 2 OS=Homo sapiens GN=IDI2 PE=1 SV=1 15 225 1.0E-52
sp|Q7N0A6|IDI2_PHOLL Isopentenyl-diphosphate Delta-isomerase 2 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=idi2 PE=3 SV=1 31 213 1.0E-24
sp|Q5YYB6|IDI_NOCFA Isopentenyl-diphosphate Delta-isomerase OS=Nocardia farcinica (strain IFM 10152) GN=idi PE=3 SV=1 37 210 6.0E-23
sp|A9AST0|IDI_BURM1 Isopentenyl-diphosphate Delta-isomerase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=idi PE=3 SV=1 31 213 1.0E-22
sp|Q7N1V4|IDI1_PHOLL Isopentenyl-diphosphate Delta-isomerase 1 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=idi1 PE=3 SV=1 33 225 1.0E-22
sp|Q6D3F5|IDI_PECAS Isopentenyl-diphosphate Delta-isomerase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=idi PE=3 SV=1 36 212 3.0E-22
sp|Q5E7U8|IDI_VIBF1 Isopentenyl-diphosphate Delta-isomerase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=idi PE=3 SV=1 31 218 4.0E-22
sp|B5F9P6|IDI_VIBFM Isopentenyl-diphosphate Delta-isomerase OS=Vibrio fischeri (strain MJ11) GN=idi PE=3 SV=1 31 218 1.0E-21
sp|Q6LUX5|IDI_PHOPR Isopentenyl-diphosphate Delta-isomerase OS=Photobacterium profundum GN=idi PE=3 SV=1 30 210 1.0E-20
sp|A8GDW2|IDI_SERP5 Isopentenyl-diphosphate Delta-isomerase OS=Serratia proteamaculans (strain 568) GN=idi PE=3 SV=1 31 217 2.0E-20
sp|Q5NWG5|IDI2_AROAE Isopentenyl-diphosphate Delta-isomerase 2 OS=Aromatoleum aromaticum (strain EbN1) GN=idi2 PE=3 SV=1 31 210 7.0E-20
sp|A1WXH5|IDI_HALHL Isopentenyl-diphosphate Delta-isomerase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=idi PE=3 SV=1 33 216 4.0E-18
sp|A4FK76|IDI_SACEN Isopentenyl-diphosphate Delta-isomerase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=idi PE=3 SV=1 33 218 3.0E-17
sp|Q82MJ7|IDI_STRAW Isopentenyl-diphosphate Delta-isomerase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=idi PE=3 SV=1 37 213 5.0E-17
sp|Q8KP37|IDI_AGRME Isopentenyl-diphosphate Delta-isomerase OS=Agromyces mediolanus GN=idi PE=3 SV=1 25 219 6.0E-17
sp|A8LQ20|IDI_DINSH Isopentenyl-diphosphate Delta-isomerase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=idi PE=3 SV=1 42 220 1.0E-16
sp|Q16DR2|IDI_ROSDO Isopentenyl-diphosphate Delta-isomerase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=idi PE=3 SV=1 42 220 5.0E-16
sp|B0RIB7|IDI_CLAMS Isopentenyl-diphosphate Delta-isomerase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=idi PE=3 SV=1 33 212 7.0E-16
sp|Q5P011|IDI1_AROAE Isopentenyl-diphosphate Delta-isomerase 1 OS=Aromatoleum aromaticum (strain EbN1) GN=idi1 PE=3 SV=1 31 211 7.0E-16
sp|B1VTW2|IDI_STRGG Isopentenyl-diphosphate Delta-isomerase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=idi PE=3 SV=1 37 213 9.0E-16
sp|Q28W27|IDI_JANSC Isopentenyl-diphosphate Delta-isomerase OS=Jannaschia sp. (strain CCS1) GN=idi PE=3 SV=1 42 217 1.0E-15
sp|A5CV36|IDI_CLAM3 Isopentenyl-diphosphate Delta-isomerase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=idi PE=3 SV=1 33 212 1.0E-15
sp|P26173|IDI_RHOCB Isopentenyl-diphosphate Delta-isomerase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=idi PE=1 SV=1 56 212 2.0E-15
sp|Q5LWT6|IDI_RUEPO Isopentenyl-diphosphate Delta-isomerase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=idi PE=3 SV=1 42 212 2.0E-15
sp|Q9X7Q6|IDI_STRCO Isopentenyl-diphosphate Delta-isomerase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=idi PE=3 SV=1 37 213 2.0E-15
sp|B5XUF5|IDI_KLEP3 Isopentenyl-diphosphate Delta-isomerase OS=Klebsiella pneumoniae (strain 342) GN=idi PE=3 SV=1 33 214 4.0E-14
sp|A6TDP3|IDI_KLEP7 Isopentenyl-diphosphate Delta-isomerase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=idi PE=3 SV=1 33 214 1.0E-13
sp|C1AP18|IDI_MYCBT Isopentenyl-diphosphate Delta-isomerase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=idi PE=3 SV=1 33 195 2.0E-13
sp|A1KJG2|IDI_MYCBP Isopentenyl-diphosphate Delta-isomerase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=idi PE=3 SV=1 33 195 2.0E-13
sp|P9WKK5|IDI_MYCTU Isopentenyl-diphosphate Delta-isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=idi PE=1 SV=1 33 195 3.0E-13
sp|P9WKK4|IDI_MYCTO Isopentenyl-diphosphate Delta-isomerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=idi PE=3 SV=1 33 195 3.0E-13
sp|A5U3A5|IDI_MYCTA Isopentenyl-diphosphate Delta-isomerase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=idi PE=3 SV=1 33 195 3.0E-13
sp|Q9Z5D3|IDI_RHOS4 Isopentenyl-diphosphate Delta-isomerase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=idi PE=3 SV=1 56 218 3.0E-13
sp|A3PL07|IDI_RHOS1 Isopentenyl-diphosphate Delta-isomerase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=idi PE=3 SV=2 56 218 3.0E-13
sp|A1T5G2|IDI_MYCVP Isopentenyl-diphosphate Delta-isomerase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=idi PE=3 SV=1 33 197 4.0E-13
sp|B9KK15|IDI_RHOSK Isopentenyl-diphosphate Delta-isomerase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=idi PE=3 SV=1 56 218 5.0E-13
sp|B4T534|IDI_SALNS Isopentenyl-diphosphate Delta-isomerase OS=Salmonella newport (strain SL254) GN=idi PE=3 SV=1 30 214 6.0E-13
sp|A9N3L5|IDI_SALPB Isopentenyl-diphosphate Delta-isomerase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=idi PE=3 SV=1 30 214 7.0E-13
sp|A1R1M6|IDI_ARTAT Isopentenyl-diphosphate Delta-isomerase OS=Arthrobacter aurescens (strain TC1) GN=idi PE=3 SV=1 33 212 8.0E-13
sp|Q9KK75|IDI_BRELN Isopentenyl-diphosphate Delta-isomerase OS=Brevibacterium linens GN=idi PE=3 SV=1 33 210 9.0E-13
sp|Q8Z3X9|IDI_SALTI Isopentenyl-diphosphate Delta-isomerase OS=Salmonella typhi GN=idi PE=3 SV=1 30 214 2.0E-12
sp|A4WRA6|IDI_RHOS5 Isopentenyl-diphosphate Delta-isomerase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=idi PE=3 SV=2 56 212 2.0E-12
sp|Q7VEU0|IDI_MYCBO Isopentenyl-diphosphate Delta-isomerase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=idi PE=3 SV=1 33 195 2.0E-12
sp|Q8ZM82|IDI_SALTY Isopentenyl-diphosphate Delta-isomerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=idi PE=1 SV=1 30 214 4.0E-12
sp|B4TUQ7|IDI_SALSV Isopentenyl-diphosphate Delta-isomerase OS=Salmonella schwarzengrund (strain CVM19633) GN=idi PE=3 SV=1 30 214 4.0E-12
sp|B5BFK4|IDI_SALPK Isopentenyl-diphosphate Delta-isomerase OS=Salmonella paratyphi A (strain AKU_12601) GN=idi PE=3 SV=1 30 214 4.0E-12
sp|C0PY11|IDI_SALPC Isopentenyl-diphosphate Delta-isomerase OS=Salmonella paratyphi C (strain RKS4594) GN=idi PE=3 SV=1 30 214 4.0E-12
sp|Q5PL31|IDI_SALPA Isopentenyl-diphosphate Delta-isomerase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=idi PE=3 SV=1 30 214 4.0E-12
sp|B4TGV9|IDI_SALHS Isopentenyl-diphosphate Delta-isomerase OS=Salmonella heidelberg (strain SL476) GN=idi PE=3 SV=1 30 214 4.0E-12
sp|B5QXG6|IDI_SALEP Isopentenyl-diphosphate Delta-isomerase OS=Salmonella enteritidis PT4 (strain P125109) GN=idi PE=3 SV=1 30 214 4.0E-12
sp|B5FUF2|IDI_SALDC Isopentenyl-diphosphate Delta-isomerase OS=Salmonella dublin (strain CT_02021853) GN=idi PE=3 SV=1 30 214 4.0E-12
sp|Q57K77|IDI_SALCH Isopentenyl-diphosphate Delta-isomerase OS=Salmonella choleraesuis (strain SC-B67) GN=idi PE=3 SV=1 30 214 4.0E-12
sp|B5F5G3|IDI_SALA4 Isopentenyl-diphosphate Delta-isomerase OS=Salmonella agona (strain SL483) GN=idi PE=3 SV=1 30 214 4.0E-12
sp|A9MRI5|IDI_SALAR Isopentenyl-diphosphate Delta-isomerase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=idi PE=3 SV=1 30 216 5.0E-12
sp|B5RE00|IDI_SALG2 Isopentenyl-diphosphate Delta-isomerase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=idi PE=3 SV=1 30 214 5.0E-12
sp|A8AP95|IDI_CITK8 Isopentenyl-diphosphate Delta-isomerase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=idi PE=3 SV=1 33 216 6.0E-12
sp|B2GFH1|IDI_KOCRD Isopentenyl-diphosphate Delta-isomerase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=idi PE=3 SV=1 33 216 9.0E-12
sp|Q6AC73|IDI_LEIXX Isopentenyl-diphosphate Delta-isomerase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=idi PE=3 SV=1 32 212 2.0E-11
sp|B2U0Q6|IDI_SHIB3 Isopentenyl-diphosphate Delta-isomerase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=idi PE=3 SV=1 30 214 3.0E-11
sp|Q8FND7|IDI_COREF Isopentenyl-diphosphate Delta-isomerase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=idi PE=3 SV=1 32 146 3.0E-11
sp|A4WE41|IDI_ENT38 Isopentenyl-diphosphate Delta-isomerase OS=Enterobacter sp. (strain 638) GN=idi PE=3 SV=1 31 210 6.0E-11
sp|Q0TDW3|IDI_ECOL5 Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=idi PE=3 SV=1 30 214 7.0E-11
sp|Q31WF1|IDI_SHIBS Isopentenyl-diphosphate Delta-isomerase OS=Shigella boydii serotype 4 (strain Sb227) GN=idi PE=3 SV=1 30 214 1.0E-10
sp|B6I722|IDI_ECOSE Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli (strain SE11) GN=idi PE=3 SV=1 30 214 1.0E-10
sp|Q7X5H2|IDI_CITFR Isopentenyl-diphosphate Delta-isomerase OS=Citrobacter freundii GN=idi PE=3 SV=1 30 234 2.0E-10
sp|A4QG13|IDI_CORGB Isopentenyl-diphosphate Delta-isomerase OS=Corynebacterium glutamicum (strain R) GN=idi PE=3 SV=2 33 210 2.0E-10
sp|Q8FE75|IDI_ECOL6 Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idi PE=3 SV=1 30 214 2.0E-10
sp|P60923|IDI_CORDI Isopentenyl-diphosphate Delta-isomerase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=idi PE=3 SV=1 33 210 3.0E-10
sp|Q1R7E2|IDI_ECOUT Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli (strain UTI89 / UPEC) GN=idi PE=3 SV=1 30 214 3.0E-10
sp|A1AF79|IDI_ECOK1 Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O1:K1 / APEC GN=idi PE=3 SV=1 30 214 3.0E-10
sp|B7MZ42|IDI_ECO81 Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O81 (strain ED1a) GN=idi PE=3 SV=1 30 214 3.0E-10
sp|B7MM76|IDI_ECO45 Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=idi PE=3 SV=1 30 214 3.0E-10
sp|B7UHT8|IDI_ECO27 Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=idi PE=3 SV=1 30 214 3.0E-10
sp|B1ITB3|IDI_ECOLC Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=idi PE=3 SV=1 30 214 6.0E-10
sp|Q6A5Z1|IDI_PROAC Isopentenyl-diphosphate Delta-isomerase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=idi PE=3 SV=1 36 209 9.0E-10
sp|Q8NN99|IDI_CORGL Isopentenyl-diphosphate Delta-isomerase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=idi PE=3 SV=1 33 210 9.0E-10
sp|B1LR71|IDI_ECOSM Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=idi PE=3 SV=1 30 214 1.0E-09
sp|Q83MJ9|IDI_SHIFL Isopentenyl-diphosphate Delta-isomerase OS=Shigella flexneri GN=idi PE=3 SV=1 30 214 2.0E-09
sp|Q0T107|IDI_SHIF8 Isopentenyl-diphosphate Delta-isomerase OS=Shigella flexneri serotype 5b (strain 8401) GN=idi PE=3 SV=1 30 214 2.0E-09
sp|Q46822|IDI_ECOLI Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli (strain K12) GN=idi PE=1 SV=1 30 214 4.0E-09
sp|B1XEH6|IDI_ECODH Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli (strain K12 / DH10B) GN=idi PE=3 SV=1 30 214 4.0E-09
sp|C5A0G1|IDI_ECOBW Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=idi PE=3 SV=1 30 214 4.0E-09
sp|Q32BV2|IDI_SHIDS Isopentenyl-diphosphate Delta-isomerase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=idi PE=3 SV=1 30 214 5.0E-09
sp|Q0RBQ7|IDI_FRAAA Isopentenyl-diphosphate Delta-isomerase OS=Frankia alni (strain ACN14a) GN=idi PE=3 SV=1 20 209 7.0E-09
sp|Q3YXY0|IDI_SHISS Isopentenyl-diphosphate Delta-isomerase OS=Shigella sonnei (strain Ss046) GN=idi PE=3 SV=1 30 214 7.0E-09
sp|B7LYF3|IDI_ECO8A Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O8 (strain IAI1) GN=idi PE=3 SV=1 30 214 7.0E-09
sp|B5YQ81|IDI_ECO5E Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=idi PE=3 SV=1 30 214 7.0E-09
sp|Q8XD58|IDI_ECO57 Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O157:H7 GN=idi PE=3 SV=1 30 214 7.0E-09
sp|A7ZQZ8|IDI_ECO24 Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=idi PE=3 SV=1 30 214 7.0E-09
sp|B7NW30|IDI_ECO7I Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=idi PE=3 SV=1 30 214 1.0E-08
sp|B7N7D3|IDI_ECOLU Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=idi PE=3 SV=1 30 214 2.0E-08
sp|Q9KWD1|IDI_AGRRH Isopentenyl-diphosphate Delta-isomerase OS=Agrobacterium rhizogenes GN=idi PE=3 SV=1 33 190 2.0E-08
sp|A8A430|IDI_ECOHS Isopentenyl-diphosphate Delta-isomerase OS=Escherichia coli O9:H4 (strain HS) GN=idi PE=3 SV=1 30 214 5.0E-08
sp|Q8Y9Z9|Y368_LISMO Uncharacterized Nudix hydrolase lmo0368 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0368 PE=3 SV=1 37 212 1.0E-06
sp|Q5UX45|IDI_HALMA Isopentenyl-diphosphate Delta-isomerase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=idi PE=3 SV=1 32 106 2.0E-06
sp|Q9HP40|IDI_HALSA Isopentenyl-diphosphate Delta-isomerase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=idi PE=3 SV=1 36 220 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006360
MTMTSPATAAAKAYLANIDLSAYDPEQSRLMQERCILVDENDNAIGAVDKKTCHLMENINKGLLHRAFSAFVFRP
SDGKLLLQQRASEKITFPDMWTNTCCSHPLDDFEEEKVEKDQLGVRIAASRKLEHELGIPRDQTPVDEFQYLTRI
HYLAPSNGMWGEHEVDYILFLTANVTVTPNTNEIRDHKYVSKEELEAMFHDPSNSFTPWFKLIAREFLFGWWDEL
YKRKDSQGNIAAKTLAGVVDGSKVIRMT*
Coding >AgabiH97|006360
ATGACAATGACTTCACCCGCAACAGCTGCTGCAAAGGCCTATCTCGCCAATATAGACCTTTCCGCTTATGATCCT
GAACAATCGCGTCTGATGCAGGAGCGGTGTATCTTGGTCGATGAGAACGATAACGCAATCGGAGCTGTCGACAAA
AAGACCTGTCATCTTATGGAAAATATCAACAAAGGTCTTTTACATCGCGCTTTTTCGGCTTTTGTCTTCCGTCCA
TCGGATGGCAAACTCCTCCTTCAACAACGTGCCTCTGAAAAAATCACATTTCCTGATATGTGGACCAACACCTGT
TGCTCACATCCTCTTGATGACTTTGAAGAGGAAAAGGTGGAAAAGGATCAGTTGGGTGTTCGAATTGCTGCATCG
CGAAAGTTAGAACACGAGTTGGGCATTCCCAGAGACCAAACCCCTGTTGATGAATTTCAGTATCTGACTCGCATC
CACTATCTAGCGCCTTCTAATGGCATGTGGGGCGAACATGAAGTGGACTACATTCTATTCCTCACTGCAAACGTT
ACCGTAACGCCTAATACGAATGAAATCAGGGATCACAAATATGTGAGCAAGGAGGAGCTTGAAGCAATGTTCCAT
GATCCCTCAAACTCATTCACTCCTTGGTTCAAGTTGATTGCTCGCGAGTTTCTCTTTGGTTGGTGGGATGAGCTC
TACAAACGCAAGGACAGCCAGGGTAACATCGCTGCCAAAACTTTGGCAGGTGTGGTGGACGGATCCAAGGTCATC
CGGATGACTTAG
Transcript >AgabiH97|006360
ATGACAATGACTTCACCCGCAACAGCTGCTGCAAAGGCCTATCTCGCCAATATAGACCTTTCCGCTTATGATCCT
GAACAATCGCGTCTGATGCAGGAGCGGTGTATCTTGGTCGATGAGAACGATAACGCAATCGGAGCTGTCGACAAA
AAGACCTGTCATCTTATGGAAAATATCAACAAAGGTCTTTTACATCGCGCTTTTTCGGCTTTTGTCTTCCGTCCA
TCGGATGGCAAACTCCTCCTTCAACAACGTGCCTCTGAAAAAATCACATTTCCTGATATGTGGACCAACACCTGT
TGCTCACATCCTCTTGATGACTTTGAAGAGGAAAAGGTGGAAAAGGATCAGTTGGGTGTTCGAATTGCTGCATCG
CGAAAGTTAGAACACGAGTTGGGCATTCCCAGAGACCAAACCCCTGTTGATGAATTTCAGTATCTGACTCGCATC
CACTATCTAGCGCCTTCTAATGGCATGTGGGGCGAACATGAAGTGGACTACATTCTATTCCTCACTGCAAACGTT
ACCGTAACGCCTAATACGAATGAAATCAGGGATCACAAATATGTGAGCAAGGAGGAGCTTGAAGCAATGTTCCAT
GATCCCTCAAACTCATTCACTCCTTGGTTCAAGTTGATTGCTCGCGAGTTTCTCTTTGGTTGGTGGGATGAGCTC
TACAAACGCAAGGACAGCCAGGGTAACATCGCTGCCAAAACTTTGGCAGGTGTGGTGGACGGATCCAAGGTCATC
CGGATGACTTAG
Gene >AgabiH97|006360
ATGACAATGACTTCACCCGCAACAGCTGCTGCAAAGGCCTATCTCGCCAATATAGACCTTTCCGCTTATGATCCT
GAACAATCGCGTCTGATGCAGGAGCGGTGTATCTTGGTCGATGAGAACGATAACGCAATCGGAGCTGTCGACAAA
AAGACCTGTGTGTTTGTTATTACTTATGCGCTTGTGGACAGTTGACCCATTGAAGTTGTATAGGTCATCTTATGG
AAAATATCAACAAAGGTCTTTTACATCGCGCTTTTTCGGCTTTTGTCTTCCGTCCATCGGATGGCAAACTCCTCC
TTCAACAACGTGCCTCTGAAAAAATCACATTTCCTGATATGTGGACCAACACCTGTTGCTCACATCCTCTTGATG
ACTTTGAAGAGGAAAAGGTGGAAAAGGATCAGTTGGGTGTTCGAATTGCTGCATCGCGAAAGTTAGAACACGAGT
TGGGCATTCCCAGAGACCAAACCCCTGTTGATGAATTTCAGTATCTGACTCGCATCCACTATCTAGCGCCTTCTA
ATGGCATGTGGGGCGAACATGAAGGTATGAAGTGTCCTTTTGCTGTACTTGTGGAGAAGTCATTGACGTTGTAAT
CATCAGTGGACTACATTCTATTCCTCACTGCAAACGTTACCGTAACGCCTAATACGAATGAAATCAGGGATCACA
AATATGTGAGCAAGGAGGAGCTTGAAGCAATGTTCCATGATCCCTGTGCGTATCTTATATCTTAACCGTTTACAT
CGTACTCAGAAGAAATTGTTAGCAAACTCATTCACTCCTTGGTTCAAGTTGATTGCTCGCGAGTTTCTCTTTGGT
TGGTGGGATGAGCTCTACAAACGCAAGGACAGCCAGGGTAACATCGCTGCCAAAACTTTGGCAGGTGTGGTGGAC
GGATCCAAGGTCATCCGGATGACTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail