Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006290
Gene name
Locationscaffold_1:1529801..1531429
Strand-
Gene length (bp)1628
Transcript length (bp)1404
Coding sequence length (bp)1404
Protein length (aa) 468

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 4.9E-37 204 395
PF16891 STPPase_N Serine-threonine protein phosphatase N-terminal domain 2.1E-17 154 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78968|PPZ_SCHPO Serine/threonine-protein phosphatase PP-Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pzh1 PE=1 SV=1 92 462 0.0E+00
sp|P26570|PPZ1_YEAST Serine/threonine-protein phosphatase PP-Z1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ1 PE=1 SV=5 139 465 0.0E+00
sp|P33329|PPZ2_YEAST Serine/threonine-protein phosphatase PP-Z2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ2 PE=1 SV=4 148 465 0.0E+00
sp|P63088|PP1G_RAT Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1 151 444 9.0E-149
sp|P63087|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1 151 444 9.0E-149
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78968|PPZ_SCHPO Serine/threonine-protein phosphatase PP-Z OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pzh1 PE=1 SV=1 92 462 0.0E+00
sp|P26570|PPZ1_YEAST Serine/threonine-protein phosphatase PP-Z1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ1 PE=1 SV=5 139 465 0.0E+00
sp|P33329|PPZ2_YEAST Serine/threonine-protein phosphatase PP-Z2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPZ2 PE=1 SV=4 148 465 0.0E+00
sp|P63088|PP1G_RAT Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1 151 444 9.0E-149
sp|P63087|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1 151 444 9.0E-149
sp|P61287|PP1G_BOVIN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Bos taurus GN=PPP1CC PE=2 SV=1 151 444 9.0E-149
sp|Q6NVU2|PPIG_XENTR Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis GN=ppp1cc PE=2 SV=1 151 444 9.0E-149
sp|P36874|PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis GN=ppp1cc-a PE=1 SV=2 151 444 9.0E-149
sp|Q7SZ10|PP1GB_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B OS=Xenopus laevis GN=ppp1cc-b PE=2 SV=1 151 444 9.0E-149
sp|P36873|PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens GN=PPP1CC PE=1 SV=1 151 444 9.0E-149
sp|P48485|PP15_ARATH Serine/threonine-protein phosphatase PP1 isozyme 5 OS=Arabidopsis thaliana GN=TOPP5 PE=1 SV=1 154 446 2.0E-147
sp|Q627N3|GLC7B_CAEBR Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis briggsae GN=gsp-2 PE=3 SV=1 151 446 2.0E-147
sp|P48727|GLC7B_CAEEL Serine/threonine-protein phosphatase PP1-beta OS=Caenorhabditis elegans GN=gsp-2 PE=2 SV=1 151 446 2.0E-147
sp|Q8MJ46|PP1G_CANLF Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Canis lupus familiaris GN=PPP1CC PE=2 SV=1 151 444 3.0E-147
sp|P32598|PP12_YEAST Serine/threonine-protein phosphatase PP1-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLC7 PE=1 SV=1 152 459 4.0E-147
sp|P62138|PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1 151 446 3.0E-146
sp|P62139|PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1 151 446 3.0E-146
sp|P62136|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens GN=PPP1CA PE=1 SV=1 151 446 3.0E-146
sp|Q3T0E7|PP1A_BOVIN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Bos taurus GN=PPP1CA PE=2 SV=1 151 446 3.0E-146
sp|P62137|PP1A_MOUSE Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Mus musculus GN=Ppp1ca PE=1 SV=1 151 446 9.0E-146
sp|Q5I085|PP1B_XENTR Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus tropicalis GN=ppp1cb PE=2 SV=1 151 449 2.0E-145
sp|Q6GQL2|PP1B_XENLA Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Xenopus laevis GN=ppp1cb PE=2 SV=1 151 449 2.0E-145
sp|P62142|PP1B_RAT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Rattus norvegicus GN=Ppp1cb PE=1 SV=3 151 449 3.0E-145
sp|P62143|PP1B_RABIT Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CB PE=1 SV=3 151 449 3.0E-145
sp|Q5R740|PP1B_PONAB Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Pongo abelii GN=PPP1CB PE=2 SV=1 151 449 3.0E-145
sp|P61292|PP1B_PIG Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Sus scrofa GN=PPP1CB PE=1 SV=3 151 449 3.0E-145
sp|P62141|PP1B_MOUSE Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Mus musculus GN=Ppp1cb PE=1 SV=3 151 449 3.0E-145
sp|P62140|PP1B_HUMAN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens GN=PPP1CB PE=1 SV=3 151 449 3.0E-145
sp|P62207|PP1B_CHICK Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Gallus gallus GN=PPP1CB PE=1 SV=3 151 449 3.0E-145
sp|Q8MJ47|PP1B_CANLF Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Canis lupus familiaris GN=PPP1CB PE=2 SV=4 151 449 3.0E-145
sp|Q3SWW9|PP1B_BOVIN Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Bos taurus GN=PPP1CB PE=2 SV=1 151 449 3.0E-145
sp|Q9UW86|PP1_NEUCR Serine/threonine-protein phosphatase PP1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-3 PE=2 SV=1 151 444 5.0E-145
sp|Q8WMS6|PP1A_CANLF Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Canis lupus familiaris GN=PPP1CA PE=2 SV=1 151 446 6.0E-145
sp|P48482|PP12_ARATH Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Arabidopsis thaliana GN=TOPP2 PE=1 SV=1 154 446 9.0E-145
sp|P20654|PP1_EMENI Serine/threonine-protein phosphatase PP1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimG PE=2 SV=1 152 444 1.0E-144
sp|Q27497|GLC7A_CAEEL Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis elegans GN=gsp-1 PE=3 SV=2 152 449 1.0E-144
sp|Q61JR3|GLC7A_CAEBR Serine/threonine-protein phosphatase PP1-alpha OS=Caenorhabditis briggsae GN=gsp-1 PE=3 SV=1 152 449 1.0E-144
sp|O04856|PP11_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Nicotiana tabacum GN=NPP1 PE=2 SV=1 154 446 2.0E-144
sp|P23880|PP12_SCHPO Serine/threonine-protein phosphatase PP1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sds21 PE=3 SV=1 150 444 7.0E-144
sp|P48489|PP1_ORYSJ Serine/threonine-protein phosphatase PP1 OS=Oryza sativa subsp. japonica GN=Os03g0268000 PE=2 SV=2 154 444 1.0E-143
sp|O04857|PP12_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Nicotiana tabacum GN=NPP2 PE=2 SV=1 154 446 2.0E-143
sp|P48462|PP1B_DROME Serine/threonine-protein phosphatase beta isoform OS=Drosophila melanogaster GN=flw PE=1 SV=1 152 449 2.0E-143
sp|P13681|PP11_SCHPO Serine/threonine-protein phosphatase PP1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dis2 PE=1 SV=1 152 444 3.0E-143
sp|P48461|PP11_DROME Serine/threonine-protein phosphatase alpha-1 isoform OS=Drosophila melanogaster GN=Pp1alpha-96A PE=1 SV=1 152 446 6.0E-143
sp|P12982|PP12_DROME Serine/threonine-protein phosphatase alpha-2 isoform OS=Drosophila melanogaster GN=Pp1-87B PE=1 SV=1 152 446 1.0E-142
sp|P22198|PP1_MAIZE Serine/threonine-protein phosphatase PP1 OS=Zea mays GN=PP1 PE=2 SV=1 154 444 3.0E-142
sp|P48484|PP14_ARATH Serine/threonine-protein phosphatase PP1 isozyme 4 OS=Arabidopsis thaliana GN=TOPP4 PE=1 SV=1 154 444 1.0E-141
sp|P48480|PP11_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Acetabularia peniculus PE=3 SV=1 154 444 1.0E-140
sp|O15757|PP1_DICDI Serine/threonine-protein phosphatase PP1 OS=Dictyostelium discoideum GN=pppB PE=1 SV=1 150 450 3.0E-140
sp|P48483|PP13_ARATH Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Arabidopsis thaliana GN=TOPP3 PE=2 SV=1 154 443 4.0E-140
sp|Q05547|PP13_DROME Serine/threonine-protein phosphatase alpha-3 isoform OS=Drosophila melanogaster GN=Pp1-13C PE=1 SV=1 152 446 1.0E-139
sp|P48481|PP12_ACEPE Serine/threonine-protein phosphatase PP1 isozyme 2 OS=Acetabularia peniculus PE=3 SV=1 154 444 2.0E-139
sp|P48488|PP1_MEDSV Serine/threonine-protein phosphatase PP1 OS=Medicago sativa subsp. varia GN=PP1 PE=2 SV=1 154 446 8.0E-139
sp|P30366|PP11_ARATH Serine/threonine-protein phosphatase PP1 isozyme 1 OS=Arabidopsis thaliana GN=TOPP1 PE=2 SV=1 154 444 8.0E-139
sp|P48487|PP1_BRAOL Serine/threonine-protein phosphatase PP1 OS=Brassica oleracea GN=PP1 PE=2 SV=1 154 444 1.0E-137
sp|O82733|PP17_ARATH Serine/threonine-protein phosphatase PP1 isozyme 7 OS=Arabidopsis thaliana GN=TOPP7 PE=2 SV=3 154 446 5.0E-136
sp|O04858|PP13_TOBAC Serine/threonine-protein phosphatase PP1 isozyme 3 OS=Nicotiana tabacum GN=NPP3 PE=2 SV=1 154 444 7.0E-136
sp|P48486|PP16_ARATH Serine/threonine-protein phosphatase PP1 isozyme 6 OS=Arabidopsis thaliana GN=TOPP6 PE=1 SV=2 154 443 1.0E-135
sp|P32945|PPQ1_YEAST Serine/threonine-protein phosphatase PPQ OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPQ1 PE=1 SV=1 101 444 1.0E-135
sp|P48490|PP1_PHAVU Serine/threonine-protein phosphatase PP1 OS=Phaseolus vulgaris PE=2 SV=1 154 449 2.0E-132
sp|Q9M9W3|PP19_ARATH Serine/threonine-protein phosphatase PP1 isozyme 9 OS=Arabidopsis thaliana GN=TOPP9 PE=2 SV=1 154 444 3.0E-132
sp|O82734|PP18_ARATH Serine/threonine-protein phosphatase PP1 isozyme 8 OS=Arabidopsis thaliana GN=TOPP8 PE=2 SV=3 154 444 5.0E-129
sp|P23734|PP12_TRYBB Serine/threonine-protein phosphatase PP1(5.9) OS=Trypanosoma brucei brucei PE=3 SV=2 176 444 4.0E-123
sp|P23733|PP11_TRYBB Serine/threonine-protein phosphatase PP1(4.8) OS=Trypanosoma brucei brucei PE=3 SV=2 176 444 3.0E-121
sp|P11612|PPY_DROME Serine/threonine-protein phosphatase PP-Y OS=Drosophila melanogaster GN=PpY-55A PE=2 SV=2 176 444 2.0E-118
sp|P23777|PP1_BRANA Serine/threonine-protein phosphatase PP1 (Fragment) OS=Brassica napus PE=2 SV=1 209 444 9.0E-112
sp|P48458|YT91_CAEEL Putative serine/threonine-protein phosphatase C06A1.3 OS=Caenorhabditis elegans GN=C06A1.3 PE=3 SV=1 148 444 2.0E-87
sp|A0CCD2|PPX4_PARTE Serine/threonine-protein phosphatase PP-X homolog 4 OS=Paramecium tetraurelia GN=Ppx4 PE=3 SV=1 176 443 3.0E-82
sp|A0C1E4|PPX3_PARTE Serine/threonine-protein phosphatase PP-X homolog 3 OS=Paramecium tetraurelia GN=Ppx3 PE=3 SV=1 176 443 4.0E-82
sp|P48459|YSD1_CAEEL Putative serine/threonine-protein phosphatase C23G10.1 OS=Caenorhabditis elegans GN=C23G10.1 PE=3 SV=2 176 465 4.0E-82
sp|P11084|PP4C_RABIT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Oryctolagus cuniculus GN=PPP4C PE=1 SV=2 153 435 2.0E-81
sp|Q5R6K8|PP4C_PONAB Serine/threonine-protein phosphatase 4 catalytic subunit OS=Pongo abelii GN=PPP4C PE=2 SV=1 176 435 5.0E-81
sp|P97470|PP4C_MOUSE Serine/threonine-protein phosphatase 4 catalytic subunit OS=Mus musculus GN=Ppp4c PE=1 SV=2 176 435 5.0E-81
sp|P60510|PP4C_HUMAN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Homo sapiens GN=PPP4C PE=1 SV=1 176 435 5.0E-81
sp|A6H772|PP4C_BOVIN Serine/threonine-protein phosphatase 4 catalytic subunit OS=Bos taurus GN=PPP4C PE=1 SV=1 176 435 5.0E-81
sp|A9JRC7|PP4CB_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit B OS=Danio rerio GN=ppp4cb PE=2 SV=1 176 443 1.0E-80
sp|Q6P861|PP4C_XENTR Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus tropicalis GN=ppp4c PE=2 SV=1 176 443 1.0E-80
sp|Q6IP91|PP4C_XENLA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Xenopus laevis GN=ppp4c PE=2 SV=1 176 443 1.0E-80
sp|Q5BJ92|PP4C_RAT Serine/threonine-protein phosphatase 4 catalytic subunit OS=Rattus norvegicus GN=Ppp4c PE=2 SV=1 176 435 3.0E-80
sp|A8XE00|PP4C1_CAEBR Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis briggsae GN=pph-4.1 PE=3 SV=1 135 443 5.0E-80
sp|Q9XW79|PP4C1_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 1 OS=Caenorhabditis elegans GN=pph-4.1 PE=1 SV=1 135 443 5.0E-80
sp|Q9Y0B7|PP4C_DICDI Serine/threonine-protein phosphatase 4 catalytic subunit OS=Dictyostelium discoideum GN=ppp4c PE=1 SV=1 169 443 6.0E-80
sp|P48463|PP2AA_CHICK Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Gallus gallus GN=PPP2CA PE=2 SV=1 176 444 6.0E-80
sp|Q6BFF6|PP2A3_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 3 OS=Paramecium tetraurelia GN=Ppn3 PE=3 SV=1 169 435 7.0E-80
sp|Q9XGH7|PP2A_TOBAC Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Nicotiana tabacum PE=2 SV=1 176 444 8.0E-80
sp|P48726|PP2A1_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 1 OS=Paramecium tetraurelia GN=Ppn1 PE=3 SV=2 169 435 1.0E-79
sp|A0DJ90|PPX2_PARTE Serine/threonine-protein phosphatase PP-X homolog 2 OS=Paramecium tetraurelia GN=Ppx2 PE=3 SV=1 176 453 1.0E-79
sp|P48577|PP2A_ACEPE Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Acetabularia peniculus PE=2 SV=1 176 444 1.0E-79
sp|P11493|PP2AB_PIG Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform (Fragment) OS=Sus scrofa GN=PPP2CB PE=2 SV=2 176 444 2.0E-79
sp|A0CNL9|PP2A2_PARTE Serine/threonine-protein phosphatase PP2A catalytic subunit 2 OS=Paramecium tetraurelia GN=Ppn2 PE=3 SV=1 169 435 2.0E-79
sp|Q0P594|PP2AB_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Bos taurus GN=PPP2CB PE=1 SV=1 176 444 2.0E-79
sp|P62716|PP2AB_RAT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp2cb PE=2 SV=1 176 444 3.0E-79
sp|P62715|PP2AB_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Mus musculus GN=Ppp2cb PE=1 SV=1 176 444 3.0E-79
sp|P62714|PP2AB_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Homo sapiens GN=PPP2CB PE=1 SV=1 176 444 3.0E-79
sp|P11611|PP2AB_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform OS=Oryctolagus cuniculus GN=PPP2CB PE=1 SV=1 176 444 3.0E-79
sp|Q9HFQ2|PP2A1_EMENI Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pphA PE=3 SV=2 176 444 3.0E-79
sp|P49576|PPX1_PARTE Serine/threonine-protein phosphatase PP-X homolog 1 OS=Paramecium tetraurelia GN=Ppx1 PE=3 SV=2 176 454 4.0E-79
sp|Q10BT5|PP2A2_ORYSJ Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A2 PE=2 SV=1 154 433 5.0E-79
sp|A2XN40|PP2A2_ORYSI Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A2 PE=2 SV=2 154 433 5.0E-79
sp|P48528|PPX2_ARATH Serine/threonine-protein phosphatase PP-X isozyme 2 OS=Arabidopsis thaliana GN=PPX2 PE=2 SV=2 153 442 6.0E-79
sp|Q07100|PP2A4_ARATH Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Arabidopsis thaliana GN=PP2A4 PE=2 SV=2 152 433 6.0E-79
sp|A8WGP3|PP4CA_DANRE Serine/threonine-protein phosphatase 4 catalytic subunit A OS=Danio rerio GN=ppp4ca PE=2 SV=1 176 443 7.0E-79
sp|P63331|PP2AA_RAT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp2ca PE=1 SV=1 176 444 1.0E-78
sp|P63330|PP2AA_MOUSE Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Mus musculus GN=Ppp2ca PE=1 SV=1 176 444 1.0E-78
sp|P67777|PP2AA_RABIT Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Oryctolagus cuniculus GN=PPP2CA PE=2 SV=1 176 444 2.0E-78
sp|P67776|PP2AA_PIG Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Sus scrofa GN=PPP2CA PE=2 SV=1 176 444 2.0E-78
sp|P67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens GN=PPP2CA PE=1 SV=1 176 444 2.0E-78
sp|P67774|PP2AA_BOVIN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Bos taurus GN=PPP2CA PE=1 SV=1 176 444 2.0E-78
sp|O76932|PP4C_DROME Serine/threonine-protein phosphatase 4 catalytic subunit OS=Drosophila melanogaster GN=Pp4-19C PE=2 SV=1 169 435 2.0E-78
sp|P48578|PP2A3_ARATH Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Arabidopsis thaliana GN=PP2A3 PE=2 SV=1 152 433 3.0E-78
sp|P23696|PP2A_DROME Serine/threonine-protein phosphatase PP2A OS=Drosophila melanogaster GN=mts PE=2 SV=1 176 444 3.0E-78
sp|O04860|PP2A5_TOBAC Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Nicotiana tabacum GN=NPP5 PE=2 SV=1 176 459 5.0E-78
sp|P48580|PP2A1_NEUCR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pph-1 PE=3 SV=3 176 444 5.0E-78
sp|P23778|PP2A_BRANA Serine/threonine-protein phosphatase PP2A catalytic subunit (Fragment) OS=Brassica napus PE=2 SV=2 152 433 5.0E-78
sp|Q0DBD3|PP2A1_ORYSJ Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A1 PE=2 SV=1 153 444 2.0E-77
sp|A2YEB4|PP2A1_ORYSI Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A1 PE=2 SV=1 153 444 2.0E-77
sp|Q8X178|PP2A2_BLUGH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Blumeria graminis f. sp. hordei GN=PP2A-2 PE=3 SV=1 176 444 2.0E-77
sp|P48529|PPX1_ARATH Serine/threonine-protein phosphatase PP-X isozyme 1 OS=Arabidopsis thaliana GN=PPX1 PE=2 SV=1 168 442 5.0E-77
sp|O04951|PP2A5_ARATH Serine/threonine-protein phosphatase PP2A-5 catalytic subunit OS=Arabidopsis thaliana GN=PP2A5 PE=1 SV=1 153 435 1.0E-76
sp|Q07098|PP2A2_ARATH Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Arabidopsis thaliana GN=PP2A2 PE=1 SV=1 176 444 1.0E-76
sp|Q0E2S4|PP2A3_ORYSJ Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A3 PE=2 SV=1 176 444 1.0E-76
sp|A2X2G3|PP2A3_ORYSI Serine/threonine-protein phosphatase PP2A-3 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A3 PE=2 SV=2 176 444 1.0E-76
sp|Q06009|PP2A_MEDSA Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Medicago sativa GN=PP2A PE=2 SV=1 176 433 2.0E-76
sp|P23635|PP2A1_SCHPO Minor serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa1 PE=3 SV=1 166 459 3.0E-76
sp|Q07099|PP2A1_ARATH Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Arabidopsis thaliana GN=PP2A1 PE=1 SV=1 150 444 4.0E-76
sp|A3C4N5|PP2A4_ORYSJ Serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. japonica GN=PP2A4 PE=2 SV=2 176 433 5.0E-76
sp|P0C5D7|PP2A4_ORYSI Putative serine/threonine-protein phosphatase PP2A-4 catalytic subunit OS=Oryza sativa subsp. indica GN=PP2A4 PE=3 SV=1 176 433 5.0E-76
sp|Q9XZE5|PP2AA_DICDI Serine/threonine-protein phosphatase 2A catalytic subunit A OS=Dictyostelium discoideum GN=pho2a PE=1 SV=1 176 444 7.0E-76
sp|Q9U9A3|PPP6_DICDI Serine/threonine-protein phosphatase 6 catalytic subunit OS=Dictyostelium discoideum GN=ppp6c PE=2 SV=2 176 445 6.0E-75
sp|Q9XTT8|PP4C2_CAEEL Serine/threonine-protein phosphatase 4 catalytic subunit 2 OS=Caenorhabditis elegans GN=pph-4.2 PE=2 SV=1 178 434 8.0E-75
sp|P23595|PP2A2_YEAST Serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH22 PE=1 SV=1 135 434 8.0E-75
sp|P48579|PP2A_HELAN Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Helianthus annuus PE=2 SV=1 180 444 1.0E-74
sp|Q10298|YD44_SCHPO Putative serine/threonine-protein phosphatase C22H10.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22H10.04 PE=3 SV=1 152 434 2.0E-74
sp|Q54RD6|PP2AB_DICDI Probable serine/threonine-protein phosphatase 2A catalytic subunit B OS=Dictyostelium discoideum GN=DDB_G0283187 PE=3 SV=1 169 435 2.0E-74
sp|P23594|PP2A1_YEAST Serine/threonine-protein phosphatase PP2A-1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH21 PE=1 SV=1 166 434 3.0E-74
sp|Q9ZSE4|PP2A_HEVBR Serine/threonine-protein phosphatase PP2A catalytic subunit OS=Hevea brasiliensis GN=PP2A PE=2 SV=1 176 444 5.0E-74
sp|Q8LSN3|FYPP_PEA Phytochrome-associated serine/threonine-protein phosphatase OS=Pisum sativum GN=FYPP PE=1 SV=1 166 435 5.0E-74
sp|P32345|PP4C_YEAST Serine/threonine-protein phosphatase 4 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPH3 PE=1 SV=2 181 435 7.0E-74
sp|Q6CNT6|PP4C_KLULA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PPH3 PE=3 SV=1 181 435 3.0E-73
sp|P20604|PP11_YEAST Serine/threonine-protein phosphatase PP1-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIT4 PE=1 SV=1 170 452 5.0E-73
sp|Q6FM81|PP4C_CANGA Serine/threonine-protein phosphatase 4 catalytic subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PPH3 PE=3 SV=1 181 449 8.0E-73
sp|Q9LHE7|FYPP3_ARATH Phytochrome-associated serine/threonine-protein phosphatase 3 OS=Arabidopsis thaliana GN=FYPP3 PE=1 SV=1 166 435 8.0E-73
sp|P23636|PP2A2_SCHPO Major serine/threonine-protein phosphatase PP2A-2 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppa2 PE=3 SV=1 153 444 1.0E-72
sp|Q9SX52|FYPP1_ARATH Phytochrome-associated serine/threonine-protein phosphatase 1 OS=Arabidopsis thaliana GN=FYPP1 PE=2 SV=1 166 435 1.0E-72
sp|Q9LR78|BSU1_ARATH Serine/threonine-protein phosphatase BSU1 OS=Arabidopsis thaliana GN=BSU1 PE=1 SV=2 166 444 2.0E-72
sp|Q74ZR2|PP4C_ASHGO Serine/threonine-protein phosphatase 4 catalytic subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PPH3 PE=3 SV=2 181 435 2.0E-72
sp|P36614|PPE1_SCHPO Serine/threonine-protein phosphatase ppe1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppe1 PE=1 SV=1 166 442 7.0E-72
sp|Q60EX6|BSL1_ORYSJ Serine/threonine-protein phosphatase BSL1 homolog OS=Oryza sativa subsp. japonica GN=BSL1 PE=2 SV=1 172 445 2.0E-71
sp|Q09496|PPH6_CAEEL Putative serine/threonine-protein phosphatase pph-6 OS=Caenorhabditis elegans GN=pph-6 PE=3 SV=2 176 431 9.0E-71
sp|Q27884|PPP6_DROME Serine/threonine-protein phosphatase 6 catalytic subunit OS=Drosophila melanogaster GN=PpV PE=2 SV=1 170 430 2.0E-70
sp|Q8L7U5|BSL1_ARATH Serine/threonine-protein phosphatase BSL1 OS=Arabidopsis thaliana GN=BSL1 PE=1 SV=2 171 445 4.0E-70
sp|Q64620|PPP6_RAT Serine/threonine-protein phosphatase 6 catalytic subunit OS=Rattus norvegicus GN=Ppp6c PE=2 SV=2 176 429 5.0E-70
sp|Q9CQR6|PPP6_MOUSE Serine/threonine-protein phosphatase 6 catalytic subunit OS=Mus musculus GN=Ppp6c PE=1 SV=1 176 429 5.0E-70
sp|O00743|PPP6_HUMAN Serine/threonine-protein phosphatase 6 catalytic subunit OS=Homo sapiens GN=PPP6C PE=1 SV=1 176 429 5.0E-70
sp|P32838|PP2A4_YEAST Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPG1 PE=1 SV=2 152 419 8.0E-70
sp|Q2QM47|BSL2_ORYSJ Serine/threonine-protein phosphatase BSL2 homolog OS=Oryza sativa subsp. japonica GN=BSL2 PE=2 SV=2 165 445 1.0E-68
sp|Q9SHS7|BSL3_ARATH Serine/threonine-protein phosphatase BSL3 OS=Arabidopsis thaliana GN=BSL3 PE=1 SV=2 165 445 5.0E-68
sp|Q59KY8|SIT4_CANAL Serine/threonine-protein phosphatase SIT4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SIT4 PE=1 SV=1 166 460 5.0E-68
sp|Q5A6B6|PPG1_CANAL Serine/threonine-protein phosphatase PP2A-like PPG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PPG1 PE=1 SV=1 181 431 1.0E-67
sp|Q9SJF0|BSL2_ARATH Serine/threonine-protein phosphatase BSL2 OS=Arabidopsis thaliana GN=BSL2 PE=1 SV=2 165 445 2.0E-67
sp|O74789|YOU5_SCHPO Putative serine/threonine-protein phosphatase C26H8.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC26H8.05c PE=1 SV=1 178 442 2.0E-64
sp|P48460|YY06_CAEEL Putative serine/threonine-protein phosphatase C27B7.6 OS=Caenorhabditis elegans GN=C27B7.6 PE=3 SV=4 178 447 4.0E-62
sp|Q12705|PP2B_SCHPO Serine/threonine-protein phosphatase 2B catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppb1 PE=3 SV=2 143 436 7.0E-62
sp|Q9VXF1|PP2B3_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 3 OS=Drosophila melanogaster GN=CanA-14F PE=1 SV=4 168 436 1.0E-61
sp|Q27889|PP2B2_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster GN=Pp2B-14D PE=1 SV=2 168 436 6.0E-61
sp|Q05681|PP2B_NEUCR Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cna-1 PE=2 SV=2 176 436 3.0E-60
sp|P16298|PP2BB_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Homo sapiens GN=PPP3CB PE=1 SV=2 129 436 5.0E-60
sp|P20651|PP2BB_RAT Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Rattus norvegicus GN=Ppp3cb PE=1 SV=1 129 436 7.0E-60
sp|Q7YSW8|PP2BA_DICDI Calcineurin subunit A OS=Dictyostelium discoideum GN=canA PE=1 SV=1 176 436 8.0E-60
sp|P48453|PP2BB_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform OS=Mus musculus GN=Ppp3cb PE=1 SV=2 129 436 8.0E-60
sp|P48454|PP2BC_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Homo sapiens GN=PPP3CC PE=1 SV=3 124 436 2.0E-59
sp|P63329|PP2BA_RAT Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus GN=Ppp3ca PE=1 SV=1 168 436 6.0E-59
sp|P63328|PP2BA_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus GN=Ppp3ca PE=1 SV=1 168 436 6.0E-59
sp|O42773|PP2B1_CRYNH Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNA1 PE=3 SV=1 176 436 1.0E-58
sp|Q08209|PP2BA_HUMAN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens GN=PPP3CA PE=1 SV=1 168 436 2.0E-58
sp|P48452|PP2BA_BOVIN Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Bos taurus GN=PPP3CA PE=1 SV=1 168 436 4.0E-58
sp|P48457|PP2B_EMENI Serine/threonine-protein phosphatase 2B catalytic subunit OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cnaA PE=3 SV=3 184 436 6.0E-58
sp|Q4WUR1|PP2B_ASPFU Serine/threonine-protein phosphatase 2B catalytic subunit OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cnaA PE=3 SV=2 176 436 1.0E-57
sp|P48455|PP2BC_MOUSE Serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform OS=Mus musculus GN=Ppp3cc PE=1 SV=1 124 436 1.0E-57
sp|P48456|PP2B1_DROME Serine/threonine-protein phosphatase 2B catalytic subunit 1 OS=Drosophila melanogaster GN=CanA1 PE=2 SV=2 168 436 1.0E-55
sp|P14747|PP2B2_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMP2 PE=1 SV=2 72 436 2.0E-55
sp|Q84K11|PPP5_SOLLC Serine/threonine-protein phosphatase 5 OS=Solanum lycopersicum GN=PP5 PE=1 SV=1 146 429 3.0E-55
sp|Q84XU2|PPP5_ARATH Serine/threonine-protein phosphatase 5 OS=Arabidopsis thaliana GN=PAPP5 PE=1 SV=1 189 429 5.0E-55
sp|P53042|PPP5_RAT Serine/threonine-protein phosphatase 5 OS=Rattus norvegicus GN=Ppp5c PE=1 SV=1 144 424 1.0E-54
sp|Q60676|PPP5_MOUSE Serine/threonine-protein phosphatase 5 OS=Mus musculus GN=Ppp5c PE=1 SV=3 144 424 2.0E-54
sp|P53041|PPP5_HUMAN Serine/threonine-protein phosphatase 5 OS=Homo sapiens GN=PPP5C PE=1 SV=1 144 424 3.0E-54
sp|P23287|PP2B1_YEAST Serine/threonine-protein phosphatase 2B catalytic subunit A1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CNA1 PE=1 SV=2 166 436 2.0E-53
sp|P53043|PPT1_YEAST Serine/threonine-protein phosphatase T OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PPT1 PE=1 SV=1 146 431 4.0E-50
sp|O43049|PPT1_SCHPO Serine/threonine-protein phosphatase T OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=3 SV=2 154 439 1.0E-49
sp|Q8SRZ0|PP1L_ENCCU Probable serine/threonine-protein phosphatase ECU05_0440 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU05_0440 PE=1 SV=1 200 420 3.0E-48
sp|P34350|YK84_CAEEL Uncharacterized protein C30A5.4 OS=Caenorhabditis elegans GN=C30A5.4 PE=4 SV=1 82 435 4.0E-47
sp|P40421|RDGC_DROME Serine/threonine-protein phosphatase rdgC OS=Drosophila melanogaster GN=rdgC PE=2 SV=1 196 466 1.0E-35
sp|Q9FN02|PPP7_ARATH Serine/threonine-protein phosphatase 7 OS=Arabidopsis thaliana GN=PP7 PE=1 SV=1 205 444 2.0E-33
sp|Q3SWT6|PPE1_RAT Serine/threonine-protein phosphatase with EF-hands 1 OS=Rattus norvegicus GN=Ppef1 PE=2 SV=1 188 432 2.0E-31
sp|O35655|PPE1_MOUSE Serine/threonine-protein phosphatase with EF-hands 1 OS=Mus musculus GN=Ppef1 PE=2 SV=2 188 439 4.0E-30
sp|O14829|PPE1_HUMAN Serine/threonine-protein phosphatase with EF-hands 1 OS=Homo sapiens GN=PPEF1 PE=1 SV=1 202 431 1.0E-26
sp|Q9LNG5|PPP7L_ARATH Serine/threonine-protein phosphatase 7 long form homolog OS=Arabidopsis thaliana GN=At1g48120 PE=2 SV=1 181 418 6.0E-24
sp|O35385|PPE2_MOUSE Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus GN=Ppef2 PE=2 SV=1 205 323 6.0E-23
sp|O14830|PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens GN=PPEF2 PE=1 SV=2 202 350 1.0E-22
sp|Q9LEV0|PPP7I_ARATH Serine/threonine-protein phosphatase 7 inactive homolog OS=Arabidopsis thaliana GN=At5g10900 PE=3 SV=1 141 394 2.0E-20
sp|P34430|YL39_CAEEL Uncharacterized protein F44B9.9 OS=Caenorhabditis elegans GN=F44B9.9 PE=4 SV=2 179 257 8.0E-13
sp|P34430|YL39_CAEEL Uncharacterized protein F44B9.9 OS=Caenorhabditis elegans GN=F44B9.9 PE=4 SV=2 363 443 1.0E-11
sp|O14830|PPE2_HUMAN Serine/threonine-protein phosphatase with EF-hands 2 OS=Homo sapiens GN=PPEF2 PE=1 SV=2 335 464 4.0E-08
sp|O35385|PPE2_MOUSE Serine/threonine-protein phosphatase with EF-hands 2 OS=Mus musculus GN=Ppef2 PE=2 SV=1 349 464 2.0E-07
sp|Q478S1|APAH_DECAR Bis(5'-nucleosyl)-tetraphosphatase, symmetrical OS=Dechloromonas aromatica (strain RCB) GN=apaH PE=3 SV=1 208 368 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006290
MAPTLLSVFTSRLSRSRPHSPSPAANSSQSSSKSKRAAKDKDHHDSPLADAAPDDSNDTTSHASASSTRTHVDSQ
PQGNGAIDHQSSSRSKGPASQSSDSAATLASASSPVSPKPIPVPADAPSTPAILANTVPFSPGSAPSSEPSGPKL
KLDVDDMIQRLLDVGYTGKVSKSLCLKNAEITALCQAAREVFLTQPTLVELAPPVKIVGDVHGQYSDLIRLFEMC
GFPPASNYLFLGDYVDRGKQSLETILLLLCYKVKYPENFFLLRGNHECANVTRVYGFYDECKRRCNIKTWKTFID
VFNCLPIAAIVAAKIFCVHGGLSPSLHSMDDIRNIKRPTDVPDLGLLNDLLWSDPSDTALDWEDNERGVSYCFGK
GVINDFLLRYDMDLICRAHMVVEDGYEFWNDRTLVTVFSAPNYCGEFDNYGACMSVSEDLLCAFELLKPLDGAAL
RKEMTKAKRKSVMASAT*
Coding >AgabiH97|006290
ATGGCGCCAACCCTTCTCTCAGTCTTCACCTCCCGTCTCTCGCGTTCGCGGCCGCACTCTCCGTCCCCCGCGGCT
AATTCTTCCCAGTCAAGCTCGAAGAGCAAACGAGCGGCCAAGGACAAGGACCACCACGACTCTCCCCTCGCCGAT
GCCGCCCCGGACGACTCCAACGATACCACATCTCACGCCTCTGCCTCATCGACACGCACTCACGTAGATTCCCAG
CCTCAGGGTAATGGCGCTATCGACCATCAATCCTCCTCCCGCAGCAAAGGCCCCGCATCACAAAGCTCCGACTCG
GCCGCCACACTCGCCTCGGCTTCCTCACCTGTCTCTCCCAAACCCATCCCTGTACCTGCCGATGCACCGTCGACA
CCCGCTATTCTTGCCAATACCGTTCCGTTCTCCCCTGGGTCGGCTCCTAGCAGTGAACCCTCCGGACCGAAGCTC
AAGCTTGACGTTGACGACATGATCCAACGCCTGCTCGACGTCGGCTACACCGGCAAAGTCAGCAAGTCCCTGTGC
CTGAAAAACGCAGAAATCACTGCCCTTTGCCAGGCTGCTCGTGAAGTCTTCCTCACTCAACCCACCCTCGTAGAG
CTAGCGCCGCCAGTCAAGATCGTTGGAGACGTGCATGGTCAATATTCGGATCTCATTCGGCTATTTGAAATGTGT
GGCTTTCCGCCTGCCTCCAATTACCTCTTTTTGGGAGACTATGTCGATCGTGGAAAGCAGAGTCTCGAGACCATT
CTCCTGCTCTTGTGCTACAAGGTCAAATATCCAGAGAATTTCTTCCTCCTGAGGGGCAATCACGAATGTGCCAAT
GTCACACGAGTTTACGGCTTTTACGACGAGTGCAAACGACGATGTAACATTAAGACCTGGAAAACATTCATCGAT
GTCTTCAATTGCCTACCCATCGCTGCCATCGTTGCGGCAAAGATATTTTGTGTCCATGGCGGCCTTTCTCCTTCC
CTGCATTCAATGGATGATATCAGGAACATCAAGCGGCCGACAGACGTTCCCGATCTAGGACTCTTGAATGATCTA
TTGTGGTCCGATCCTTCTGACACTGCGTTGGACTGGGAAGATAATGAGCGAGGAGTCAGTTATTGTTTTGGCAAG
GGAGTCATAAATGATTTTTTATTACGCTACGACATGGACCTCATATGTCGAGCGCACATGGTGGTGGAAGATGGT
TATGAGTTCTGGAATGATCGGACACTTGTCACCGTGTTTAGCGCACCAAACTATTGTGGTGAATTCGACAATTAT
GGTGCCTGCATGAGTGTATCGGAAGACCTTTTGTGCGCCTTTGAACTTCTGAAGCCACTTGATGGTGCAGCTTTA
CGCAAGGAGATGACGAAAGCGAAGCGGAAAAGTGTGATGGCATCTGCCACTTAA
Transcript >AgabiH97|006290
ATGGCGCCAACCCTTCTCTCAGTCTTCACCTCCCGTCTCTCGCGTTCGCGGCCGCACTCTCCGTCCCCCGCGGCT
AATTCTTCCCAGTCAAGCTCGAAGAGCAAACGAGCGGCCAAGGACAAGGACCACCACGACTCTCCCCTCGCCGAT
GCCGCCCCGGACGACTCCAACGATACCACATCTCACGCCTCTGCCTCATCGACACGCACTCACGTAGATTCCCAG
CCTCAGGGTAATGGCGCTATCGACCATCAATCCTCCTCCCGCAGCAAAGGCCCCGCATCACAAAGCTCCGACTCG
GCCGCCACACTCGCCTCGGCTTCCTCACCTGTCTCTCCCAAACCCATCCCTGTACCTGCCGATGCACCGTCGACA
CCCGCTATTCTTGCCAATACCGTTCCGTTCTCCCCTGGGTCGGCTCCTAGCAGTGAACCCTCCGGACCGAAGCTC
AAGCTTGACGTTGACGACATGATCCAACGCCTGCTCGACGTCGGCTACACCGGCAAAGTCAGCAAGTCCCTGTGC
CTGAAAAACGCAGAAATCACTGCCCTTTGCCAGGCTGCTCGTGAAGTCTTCCTCACTCAACCCACCCTCGTAGAG
CTAGCGCCGCCAGTCAAGATCGTTGGAGACGTGCATGGTCAATATTCGGATCTCATTCGGCTATTTGAAATGTGT
GGCTTTCCGCCTGCCTCCAATTACCTCTTTTTGGGAGACTATGTCGATCGTGGAAAGCAGAGTCTCGAGACCATT
CTCCTGCTCTTGTGCTACAAGGTCAAATATCCAGAGAATTTCTTCCTCCTGAGGGGCAATCACGAATGTGCCAAT
GTCACACGAGTTTACGGCTTTTACGACGAGTGCAAACGACGATGTAACATTAAGACCTGGAAAACATTCATCGAT
GTCTTCAATTGCCTACCCATCGCTGCCATCGTTGCGGCAAAGATATTTTGTGTCCATGGCGGCCTTTCTCCTTCC
CTGCATTCAATGGATGATATCAGGAACATCAAGCGGCCGACAGACGTTCCCGATCTAGGACTCTTGAATGATCTA
TTGTGGTCCGATCCTTCTGACACTGCGTTGGACTGGGAAGATAATGAGCGAGGAGTCAGTTATTGTTTTGGCAAG
GGAGTCATAAATGATTTTTTATTACGCTACGACATGGACCTCATATGTCGAGCGCACATGGTGGTGGAAGATGGT
TATGAGTTCTGGAATGATCGGACACTTGTCACCGTGTTTAGCGCACCAAACTATTGTGGTGAATTCGACAATTAT
GGTGCCTGCATGAGTGTATCGGAAGACCTTTTGTGCGCCTTTGAACTTCTGAAGCCACTTGATGGTGCAGCTTTA
CGCAAGGAGATGACGAAAGCGAAGCGGAAAAGTGTGATGGCATCTGCCACTTAA
Gene >AgabiH97|006290
ATGGCGCCAACCCTTCTCTCAGTCTTCACCTCCCGTCTCTCGCGTTCGCGGCCGCACTCTCCGTCCCCCGCGGCT
AATTCTTCCCAGTCAAGCTCGAAGAGCAAACGAGCGGCCAAGGACAAGGACCACCACGACTCTCCCCTCGCCGAT
GCCGCCCCGGACGACTCCAACGATACCACATCTCACGCCTCTGCCTCATCGACACGCACTCACGTAGATTCCCAG
CCTCAGGGTAATGGCGCTATCGACCATCAATCCTCCTCCCGCAGCAAAGGCCCCGCATCACAAAGCTCCGACTCG
GCCGCCACACTCGCCTCGGCTTCCTCACCTGTCTCTCCCAAACCCATCCCTGTACCTGCCGATGCACCGTCGACA
CCCGCTATTCTTGCCAATACCGTTCCGTTCTCCCCTGGGTCGGCTCCTAGCAGTGAACCCTCCGGACCGAAGCTC
AAGCTTGACGTTGACGACATGATCCAACGCCTGCTCGACGTCGGCTACACCGGCAAAGTCAGCAAGTCCCTGTGC
CTGAAAAACGCAGAAATCACTGCCCTTTGCCAGGCTGCTCGTGAAGTCTTCCTCACTCAACCCACCCTCGTAGAG
CTAGCGCCGCCAGTCAAGATCGTTGGAGACGTGCATGGTCAATATTCGGATCTCATTCGGCTATTTGAAATGTGT
GGCTTTCCGCCTGCCTCCAATTACCTCTTTTTGGGAGACTATGTCGATCGTGGAAAGCAGAGTCTCGAGACCATT
CTCCTGCTCTTGTGCTACAAGGTCAAATATCCAGAGAATTTCTTCCTCCTGAGGGGCAATCACGAATGTGCCAAT
GTCACACGAGGTATGGGTGATTTCGACGATACCAACTTATTCTCACACTAGATGTTTATGGCAGTTTACGGCTTT
TACGACGAGTGCAAACGACGATGTAACATTAAGACCTGGAAAACATTCATCGATGTCTTCAATTGCCTACCCATC
GCTGCCATCGTTGCGGCAAAGATATTTTGTGTCCATGGCGGCCTTTCTCCTTCCCTGCATTCAATGGATGATATC
AGGAACATCAAGCGGCCGACAGACGTTCCCGATCTAGGACTCTTGAATGATCTATTGTGGTCCGATCCTTCTGAC
ACTGCGTTGGACTGGGAAGATAATGAGCGAGGAGTCAGTTATTGTTTTGGCAAGGGAGTCATAAATGATTTTTTA
TTACGCTACGACATGGACCTCATATGTCGAGCGCACATGGTGGTGGAAGATGGTTATGAGTTCTGGAATGATCGG
ACACTTGTCACCGTGTTTAGCGCACCAAACTATTGTGGTGGTGAGTCTTTATTAGGCTGCGTAAGCCATGGACTC
ATTGATACCTGCAGAATTCGACAATTATGGTGCCTGCATGAGGTTAGTCTATTATTATTTGCCGTTCGTATTCCT
GAAATGAACCTGCCCACTTTCAGTGTATCGGAAGACCTTTTGTGCGCCTTTGAACTTCTGAAGCCACTTGATGGT
GCAGCTTTACGCAAGGAGATGACGAAAGCGAAGCGGAAAAGGTGATGGCCCCCTTACTATCTATTCCTCTTCCTT
GAGCTAACTTTGAGCTAATCCGTCCTAGCAGTGTGATGGCATCTGCCACTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail