Protein ID | AgabiH97|006260 |
Gene name | |
Location | scaffold_1:1524433..1525082 |
Strand | + |
Gene length (bp) | 649 |
Transcript length (bp) | 594 |
Coding sequence length (bp) | 594 |
Protein length (aa) | 198 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00186 | DHFR_1 | Dihydrofolate reductase | 8.1E-31 | 4 | 168 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P16184|DYR_PNECA | Dihydrofolate reductase OS=Pneumocystis carinii PE=1 SV=1 | 4 | 197 | 3.0E-42 |
sp|Q07801|DYR_CRYNJ | Dihydrofolate reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DFR1 PE=1 SV=1 | 4 | 197 | 1.0E-39 |
sp|P51820|DRTS_SOYBN | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Glycine max PE=1 SV=1 | 6 | 196 | 1.0E-36 |
sp|P45350|DRTS_DAUCA | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Daucus carota PE=2 SV=1 | 6 | 196 | 1.0E-35 |
sp|P22906|DYR_CANAX | Dihydrofolate reductase OS=Candida albicans GN=DFR1 PE=1 SV=4 | 4 | 196 | 2.0E-35 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P16184|DYR_PNECA | Dihydrofolate reductase OS=Pneumocystis carinii PE=1 SV=1 | 4 | 197 | 3.0E-42 |
sp|Q07801|DYR_CRYNJ | Dihydrofolate reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DFR1 PE=1 SV=1 | 4 | 197 | 1.0E-39 |
sp|P51820|DRTS_SOYBN | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Glycine max PE=1 SV=1 | 6 | 196 | 1.0E-36 |
sp|P45350|DRTS_DAUCA | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Daucus carota PE=2 SV=1 | 6 | 196 | 1.0E-35 |
sp|P22906|DYR_CANAX | Dihydrofolate reductase OS=Candida albicans GN=DFR1 PE=1 SV=4 | 4 | 196 | 2.0E-35 |
sp|O81395|DRTS_MAIZE | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Zea mays GN=DRTS PE=2 SV=1 | 6 | 196 | 8.0E-34 |
sp|Q05762|DRTS1_ARATH | Bifunctional dihydrofolate reductase-thymidylate synthase 1 OS=Arabidopsis thaliana GN=THY-1 PE=1 SV=2 | 6 | 153 | 1.0E-33 |
sp|Q2QRX6|DRTS_ORYSJ | Putative bifunctional dihydrofolate reductase-thymidylate synthase OS=Oryza sativa subsp. japonica GN=Os12g0446900 PE=3 SV=2 | 15 | 153 | 2.0E-33 |
sp|Q05763|DRTS2_ARATH | Bifunctional dihydrofolate reductase-thymidylate synthase 2 OS=Arabidopsis thaliana GN=THY-2 PE=2 SV=2 | 2 | 153 | 4.0E-33 |
sp|P28019|DYR_AEDAL | Dihydrofolate reductase OS=Aedes albopictus GN=DHFR PE=3 SV=1 | 1 | 196 | 2.0E-32 |
sp|P00377|DYR_PIG | Dihydrofolate reductase OS=Sus scrofa GN=DHFR PE=1 SV=1 | 4 | 197 | 6.0E-31 |
sp|P27421|DYR_SHV24 | Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 484-77) GN=DHFR PE=3 SV=1 | 4 | 197 | 1.0E-30 |
sp|P00378|DYR_CHICK | Dihydrofolate reductase OS=Gallus gallus GN=DHFR PE=1 SV=1 | 4 | 197 | 2.0E-30 |
sp|P00376|DYR_BOVIN | Dihydrofolate reductase OS=Bos taurus GN=DHFR PE=1 SV=3 | 4 | 197 | 3.0E-30 |
sp|P00375|DYR_MOUSE | Dihydrofolate reductase OS=Mus musculus GN=Dhfr PE=1 SV=3 | 4 | 197 | 5.0E-30 |
sp|P36591|DYR_SCHPO | Dihydrofolate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dfr1 PE=2 SV=2 | 4 | 197 | 5.0E-30 |
sp|Q920D2|DYR_RAT | Dihydrofolate reductase OS=Rattus norvegicus GN=Dhfr PE=2 SV=3 | 4 | 197 | 1.0E-29 |
sp|P09503|DYR_SHV21 | Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 11) GN=DHFR PE=3 SV=1 | 4 | 197 | 1.0E-29 |
sp|Q93341|DYR_CAEEL | Putative dihydrofolate reductase OS=Caenorhabditis elegans GN=dhfr-1 PE=3 SV=1 | 1 | 194 | 1.0E-29 |
sp|P04753|DYR_MESAU | Dihydrofolate reductase OS=Mesocricetus auratus GN=DHFR PE=2 SV=4 | 4 | 197 | 3.0E-29 |
sp|P22573|DYR_SHV2C | Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 488) GN=DHFR PE=3 SV=1 | 4 | 196 | 7.0E-29 |
sp|P00374|DYR_HUMAN | Dihydrofolate reductase OS=Homo sapiens GN=DHFR PE=1 SV=2 | 4 | 197 | 1.0E-28 |
sp|P17719|DYR_DROME | Dihydrofolate reductase OS=Drosophila melanogaster GN=Dhfr PE=1 SV=3 | 1 | 197 | 9.0E-27 |
sp|Q9U8B8|DYR_HELVI | Dihydrofolate reductase OS=Heliothis virescens GN=DHFR PE=1 SV=1 | 3 | 196 | 1.0E-25 |
sp|Q86XF0|DYRL1_HUMAN | Dihydrofolate reductase, mitochondrial OS=Homo sapiens GN=DHFRL1 PE=1 SV=1 | 4 | 197 | 2.0E-23 |
sp|Q2HRC6|DYR_HHV8P | Putative Dihydrofolate reductase OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF2 PE=3 SV=1 | 4 | 152 | 2.0E-22 |
sp|P07807|DYR_YEAST | Dihydrofolate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFR1 PE=1 SV=2 | 6 | 197 | 4.0E-21 |
sp|P12833|DYR3_SALTM | Dihydrofolate reductase type 3 OS=Salmonella typhimurium GN=dhfrIII PE=1 SV=1 | 4 | 159 | 3.0E-20 |
sp|P16126|DRTS_LEIAM | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Leishmania amazonensis PE=3 SV=1 | 4 | 153 | 5.0E-20 |
sp|P04174|DYR_NEIGO | Dihydrofolate reductase OS=Neisseria gonorrhoeae GN=folA PE=1 SV=1 | 1 | 170 | 3.0E-19 |
sp|Q27783|DRTS_TRYBB | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma brucei brucei PE=1 SV=1 | 4 | 134 | 3.0E-19 |
sp|P07382|DRTS_LEIMA | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Leishmania major GN=LmjF06.0860 PE=1 SV=1 | 4 | 153 | 3.0E-19 |
sp|Q23695|DRTS_CRIFA | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Crithidia fasciculata PE=3 SV=1 | 4 | 141 | 6.0E-19 |
sp|Q07422|DRTS_TOXGO | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Toxoplasma gondii PE=1 SV=1 | 4 | 155 | 4.0E-18 |
sp|P11045|DYR_BACSU | Dihydrofolate reductase OS=Bacillus subtilis (strain 168) GN=dfrA PE=1 SV=2 | 4 | 196 | 5.0E-18 |
sp|P43791|DYR_HAEIN | Dihydrofolate reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folA PE=3 SV=1 | 4 | 171 | 6.0E-17 |
sp|P9WNX1|DYR_MYCTU | Dihydrofolate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=folA PE=1 SV=2 | 1 | 170 | 7.0E-17 |
sp|P9WNX0|DYR_MYCTO | Dihydrofolate reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=folA PE=3 SV=2 | 1 | 170 | 7.0E-17 |
sp|P0A547|DYR_MYCBO | Dihydrofolate reductase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=folA PE=3 SV=2 | 1 | 170 | 7.0E-17 |
sp|Q27793|DRTS_TRYCR | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma cruzi PE=1 SV=2 | 4 | 133 | 7.0E-17 |
sp|Q27713|DRTS_PLABA | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium berghei (strain Anka) PE=3 SV=1 | 15 | 158 | 8.0E-16 |
sp|Q9K168|DYR_NEIMB | Dihydrofolate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=folA PE=3 SV=1 | 1 | 170 | 2.0E-15 |
sp|P46103|DRTS_PLAVN | Bifunctional dihydrofolate reductase-thymidylate synthase (Fragment) OS=Plasmodium vinckei PE=3 SV=1 | 15 | 141 | 2.0E-15 |
sp|Q9JSQ9|DYR_NEIMA | Dihydrofolate reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=folA PE=3 SV=1 | 1 | 170 | 2.0E-15 |
sp|P20712|DRTS_PLACH | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium chabaudi PE=3 SV=1 | 15 | 158 | 3.0E-15 |
sp|P13922|DRTS_PLAFK | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium falciparum (isolate K1 / Thailand) PE=1 SV=2 | 15 | 158 | 5.0E-15 |
sp|Q9CBW1|DYR_MYCLE | Dihydrofolate reductase OS=Mycobacterium leprae (strain TN) GN=folA PE=3 SV=1 | 1 | 141 | 2.0E-14 |
sp|Q59397|DYR9_ECOLX | Dihydrofolate reductase type 9 OS=Escherichia coli GN=dhfrIX PE=3 SV=1 | 1 | 194 | 7.0E-14 |
sp|O02604|DRTS_PLAVI | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium vivax PE=1 SV=2 | 15 | 158 | 1.0E-13 |
sp|P0A017|DYR_STAAU | Dihydrofolate reductase OS=Staphylococcus aureus GN=folA PE=1 SV=2 | 4 | 155 | 2.0E-13 |
sp|Q5HFZ7|DYR_STAAC | Dihydrofolate reductase OS=Staphylococcus aureus (strain COL) GN=folA PE=3 SV=3 | 4 | 155 | 2.0E-13 |
sp|P0A016|DYR_STAAM | Dihydrofolate reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=folA PE=3 SV=2 | 4 | 155 | 2.0E-13 |
sp|P99079|DYR_STAAN | Dihydrofolate reductase OS=Staphylococcus aureus (strain N315) GN=folA PE=1 SV=2 | 4 | 155 | 2.0E-13 |
sp|Q6GGY1|DYR_STAAR | Dihydrofolate reductase OS=Staphylococcus aureus (strain MRSA252) GN=folA PE=3 SV=3 | 4 | 155 | 2.0E-13 |
sp|P0C0P0|DYR_STAEP | Dihydrofolate reductase OS=Staphylococcus epidermidis GN=folA PE=1 SV=1 | 4 | 155 | 2.0E-13 |
sp|Q5HPB1|DYR_STAEQ | Dihydrofolate reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=folA PE=3 SV=1 | 4 | 155 | 2.0E-13 |
sp|P0C0P1|DYR_STAES | Dihydrofolate reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=folA PE=3 SV=1 | 4 | 155 | 2.0E-13 |
sp|O62583|DYR_ENCCU | Dihydrofolate reductase OS=Encephalitozoon cuniculi (strain GB-M1) GN=DHFR-1 PE=3 SV=1 | 4 | 153 | 3.0E-13 |
sp|Q8NWQ9|DYR_STAAW | Dihydrofolate reductase OS=Staphylococcus aureus (strain MW2) GN=folA PE=3 SV=3 | 4 | 155 | 7.0E-13 |
sp|Q6G9D5|DYR_STAAS | Dihydrofolate reductase OS=Staphylococcus aureus (strain MSSA476) GN=folA PE=3 SV=3 | 4 | 155 | 7.0E-13 |
sp|P13955|DYRA_STAAU | Dihydrofolate reductase type 1 from Tn4003 OS=Staphylococcus aureus GN=dfrA PE=1 SV=3 | 4 | 155 | 8.0E-13 |
sp|Q89AV2|DYR_BUCBP | Dihydrofolate reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=folA PE=3 SV=1 | 4 | 155 | 3.0E-12 |
sp|P57243|DYR_BUCAI | Dihydrofolate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=folA PE=3 SV=1 | 4 | 162 | 5.0E-12 |
sp|Q5UQG3|DRTS_MIMIV | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R497 PE=3 SV=1 | 1 | 141 | 9.0E-12 |
sp|P31073|DYR_CITFR | Dihydrofolate reductase OS=Citrobacter freundii GN=folA PE=3 SV=1 | 4 | 162 | 1.0E-11 |
sp|P0ABQ6|DYR_SHIFL | Dihydrofolate reductase OS=Shigella flexneri GN=folA PE=3 SV=1 | 4 | 162 | 1.0E-11 |
sp|P0ABQ4|DYR_ECOLI | Dihydrofolate reductase OS=Escherichia coli (strain K12) GN=folA PE=1 SV=1 | 4 | 162 | 1.0E-11 |
sp|P0ABQ5|DYR_ECOL6 | Dihydrofolate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=folA PE=3 SV=1 | 4 | 162 | 1.0E-11 |
sp|P00381|DYR_LACCA | Dihydrofolate reductase OS=Lactobacillus casei GN=folA PE=1 SV=3 | 4 | 150 | 2.0E-11 |
sp|Q27828|DRTS_PARTE | Bifunctional dihydrofolate reductase-thymidylate synthase OS=Paramecium tetraurelia GN=GSPATT00019973001 PE=3 SV=1 | 4 | 192 | 2.0E-11 |
sp|Q5V600|DYR2_HALMA | Dihydrofolate reductase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=folA2 PE=3 SV=1 | 7 | 153 | 5.0E-11 |
sp|Q54277|DYR_STAHA | Dihydrofolate reductase OS=Staphylococcus haemolyticus GN=dfrD PE=1 SV=1 | 3 | 196 | 7.0E-11 |
sp|P31074|DYR_ENTAE | Dihydrofolate reductase OS=Enterobacter aerogenes GN=folA PE=3 SV=1 | 4 | 155 | 8.0E-11 |
sp|Q9UWQ4|DYRB_HALVO | Dihydrofolate reductase HdrB OS=Haloferax volcanii GN=hdrB PE=1 SV=1 | 6 | 168 | 9.0E-11 |
sp|Q8K9Z8|DYR_BUCAP | Dihydrofolate reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=folA PE=3 SV=1 | 3 | 162 | 1.0E-09 |
sp|Q9PR30|DYR_UREPA | Dihydrofolate reductase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=folA PE=3 SV=1 | 4 | 153 | 1.0E-09 |
sp|P00380|DYR_ENTFC | Dihydrofolate reductase OS=Enterococcus faecium GN=folA PE=1 SV=1 | 10 | 196 | 1.0E-09 |
sp|Q54801|DYR_STRPN | Dihydrofolate reductase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dhfR PE=1 SV=2 | 1 | 157 | 3.0E-09 |
sp|P47470|DYR_MYCGE | Dihydrofolate reductase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=folA PE=3 SV=1 | 4 | 153 | 6.0E-09 |
sp|Q5V3R2|DYR1_HALMA | Dihydrofolate reductase 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=folA1 PE=3 SV=1 | 2 | 182 | 8.0E-09 |
sp|Q59487|DYR_LACLA | Dihydrofolate reductase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=folA PE=3 SV=2 | 16 | 166 | 6.0E-08 |
GO Term | Description | Terminal node |
---|---|---|
GO:0004146 | dihydrofolate reductase activity | Yes |
GO:0046654 | tetrahydrofolate biosynthetic process | Yes |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0008152 | metabolic process | No |
GO:0019438 | aromatic compound biosynthetic process | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0046653 | tetrahydrofolate metabolic process | No |
GO:0008150 | biological_process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:1901360 | organic cyclic compound metabolic process | No |
GO:0042398 | cellular modified amino acid biosynthetic process | No |
GO:0009058 | biosynthetic process | No |
GO:0042559 | pteridine-containing compound biosynthetic process | No |
GO:0042558 | pteridine-containing compound metabolic process | No |
GO:0016646 | oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0006575 | cellular modified amino acid metabolic process | No |
GO:0046483 | heterocycle metabolic process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0018130 | heterocycle biosynthetic process | No |
GO:0009396 | folic acid-containing compound biosynthetic process | No |
GO:0003674 | molecular_function | No |
GO:1901362 | organic cyclic compound biosynthetic process | No |
GO:0016645 | oxidoreductase activity, acting on the CH-NH group of donors | No |
GO:0006725 | cellular aromatic compound metabolic process | No |
GO:0009987 | cellular process | No |
GO:0006760 | folic acid-containing compound metabolic process | No |
GO:0003824 | catalytic activity | No |
GO:0044237 | cellular metabolic process | No |
GO:0016491 | oxidoreductase activity | No |
GO:0044249 | cellular biosynthetic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 18 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >AgabiH97|006260 MSRLTIIVAATVSNGIGKNGTLPWHLPKDLKYFAQATSTAPEGMQNAVIMGRNTWESIPVKYRPLKGRLNVVVSR DSQYNLAVASGVAASLAGNLQSALDCINGTLPTAKPIHRAFIIGGSSIINETLSASLVDRVLLTRILSPNFESDT FIPDFLESGQWSRSSDTDLKAWLGFDVPEGVQMENDIRYEFQMWTRN* |
Coding | >AgabiH97|006260 ATGTCGCGTCTTACTATCATTGTCGCTGCCACCGTTTCCAACGGTATTGGGAAAAATGGTACATTGCCCTGGCAT CTTCCCAAAGATCTCAAGTATTTTGCCCAAGCTACTTCTACTGCGCCAGAGGGCATGCAGAATGCAGTGATAATG GGAAGGAATACTTGGGAAAGTATTCCAGTCAAGTACAGACCATTGAAGGGACGTCTGAACGTCGTCGTCAGCCGC GATTCTCAATACAACCTGGCTGTCGCCTCTGGTGTAGCGGCATCACTCGCTGGTAATCTCCAGTCCGCTTTGGAC TGCATCAACGGTACACTCCCGACCGCAAAACCAATCCATCGAGCTTTCATTATCGGCGGCTCATCGATCATCAAC GAAACACTCTCTGCCTCTTTAGTCGACAGAGTACTCCTCACGCGTATTTTGTCTCCCAATTTCGAGTCCGACACA TTCATACCCGATTTTTTGGAGTCTGGACAATGGTCTCGCTCTTCAGATACAGACTTGAAGGCTTGGTTGGGATTT GATGTACCGGAAGGTGTGCAGATGGAGAATGATATTAGATACGAGTTCCAGATGTGGACTAGGAATTAA |
Transcript | >AgabiH97|006260 ATGTCGCGTCTTACTATCATTGTCGCTGCCACCGTTTCCAACGGTATTGGGAAAAATGGTACATTGCCCTGGCAT CTTCCCAAAGATCTCAAGTATTTTGCCCAAGCTACTTCTACTGCGCCAGAGGGCATGCAGAATGCAGTGATAATG GGAAGGAATACTTGGGAAAGTATTCCAGTCAAGTACAGACCATTGAAGGGACGTCTGAACGTCGTCGTCAGCCGC GATTCTCAATACAACCTGGCTGTCGCCTCTGGTGTAGCGGCATCACTCGCTGGTAATCTCCAGTCCGCTTTGGAC TGCATCAACGGTACACTCCCGACCGCAAAACCAATCCATCGAGCTTTCATTATCGGCGGCTCATCGATCATCAAC GAAACACTCTCTGCCTCTTTAGTCGACAGAGTACTCCTCACGCGTATTTTGTCTCCCAATTTCGAGTCCGACACA TTCATACCCGATTTTTTGGAGTCTGGACAATGGTCTCGCTCTTCAGATACAGACTTGAAGGCTTGGTTGGGATTT GATGTACCGGAAGGTGTGCAGATGGAGAATGATATTAGATACGAGTTCCAGATGTGGACTAGGAATTAA |
Gene | >AgabiH97|006260 ATGTCGCGTCTTACTATCATTGTCGCTGCCACCGTTTCCAACGGTATTGGGAAAAATGGTACATTGCCCTGGCAT CTTCCCAAAGATCTCAAGTATTTTGCCCAAGCTACTTCTACTGCGCCAGAGGGCATGCAGAATGCAGTGATAATG GGAAGGAATACTTGGGAAAGTATTCCAGTCAAGTACAGACCATTGAAGGGACGTCTGAACGTCGTCGTCAGCCGC GATTCTCAATACAACCTGTACGTGAAAAAAAAAACCTCATCCTGCGTCTGCCTACTTATCATGCCCATGAAGGGC TGTCGCCTCTGGTGTAGCGGCATCACTCGCTGGTAATCTCCAGTCCGCTTTGGACTGCATCAACGGTACACTCCC GACCGCAAAACCAATCCATCGAGCTTTCATTATCGGCGGCTCATCGATCATCAACGAAACACTCTCTGCCTCTTT AGTCGACAGAGTACTCCTCACGCGTATTTTGTCTCCCAATTTCGAGTCCGACACATTCATACCCGATTTTTTGGA GTCTGGACAATGGTCTCGCTCTTCAGATACAGACTTGAAGGCTTGGTTGGGATTTGATGTACCGGAAGGTGTGCA GATGGAGAATGATATTAGATACGAGTTCCAGATGTGGACTAGGAATTAA |