Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006260
Gene name
Locationscaffold_1:1524433..1525082
Strand+
Gene length (bp)649
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00186 DHFR_1 Dihydrofolate reductase 8.1E-31 4 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P16184|DYR_PNECA Dihydrofolate reductase OS=Pneumocystis carinii PE=1 SV=1 4 197 3.0E-42
sp|Q07801|DYR_CRYNJ Dihydrofolate reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DFR1 PE=1 SV=1 4 197 1.0E-39
sp|P51820|DRTS_SOYBN Bifunctional dihydrofolate reductase-thymidylate synthase OS=Glycine max PE=1 SV=1 6 196 1.0E-36
sp|P45350|DRTS_DAUCA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Daucus carota PE=2 SV=1 6 196 1.0E-35
sp|P22906|DYR_CANAX Dihydrofolate reductase OS=Candida albicans GN=DFR1 PE=1 SV=4 4 196 2.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P16184|DYR_PNECA Dihydrofolate reductase OS=Pneumocystis carinii PE=1 SV=1 4 197 3.0E-42
sp|Q07801|DYR_CRYNJ Dihydrofolate reductase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DFR1 PE=1 SV=1 4 197 1.0E-39
sp|P51820|DRTS_SOYBN Bifunctional dihydrofolate reductase-thymidylate synthase OS=Glycine max PE=1 SV=1 6 196 1.0E-36
sp|P45350|DRTS_DAUCA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Daucus carota PE=2 SV=1 6 196 1.0E-35
sp|P22906|DYR_CANAX Dihydrofolate reductase OS=Candida albicans GN=DFR1 PE=1 SV=4 4 196 2.0E-35
sp|O81395|DRTS_MAIZE Bifunctional dihydrofolate reductase-thymidylate synthase OS=Zea mays GN=DRTS PE=2 SV=1 6 196 8.0E-34
sp|Q05762|DRTS1_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 1 OS=Arabidopsis thaliana GN=THY-1 PE=1 SV=2 6 153 1.0E-33
sp|Q2QRX6|DRTS_ORYSJ Putative bifunctional dihydrofolate reductase-thymidylate synthase OS=Oryza sativa subsp. japonica GN=Os12g0446900 PE=3 SV=2 15 153 2.0E-33
sp|Q05763|DRTS2_ARATH Bifunctional dihydrofolate reductase-thymidylate synthase 2 OS=Arabidopsis thaliana GN=THY-2 PE=2 SV=2 2 153 4.0E-33
sp|P28019|DYR_AEDAL Dihydrofolate reductase OS=Aedes albopictus GN=DHFR PE=3 SV=1 1 196 2.0E-32
sp|P00377|DYR_PIG Dihydrofolate reductase OS=Sus scrofa GN=DHFR PE=1 SV=1 4 197 6.0E-31
sp|P27421|DYR_SHV24 Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 484-77) GN=DHFR PE=3 SV=1 4 197 1.0E-30
sp|P00378|DYR_CHICK Dihydrofolate reductase OS=Gallus gallus GN=DHFR PE=1 SV=1 4 197 2.0E-30
sp|P00376|DYR_BOVIN Dihydrofolate reductase OS=Bos taurus GN=DHFR PE=1 SV=3 4 197 3.0E-30
sp|P00375|DYR_MOUSE Dihydrofolate reductase OS=Mus musculus GN=Dhfr PE=1 SV=3 4 197 5.0E-30
sp|P36591|DYR_SCHPO Dihydrofolate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dfr1 PE=2 SV=2 4 197 5.0E-30
sp|Q920D2|DYR_RAT Dihydrofolate reductase OS=Rattus norvegicus GN=Dhfr PE=2 SV=3 4 197 1.0E-29
sp|P09503|DYR_SHV21 Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 11) GN=DHFR PE=3 SV=1 4 197 1.0E-29
sp|Q93341|DYR_CAEEL Putative dihydrofolate reductase OS=Caenorhabditis elegans GN=dhfr-1 PE=3 SV=1 1 194 1.0E-29
sp|P04753|DYR_MESAU Dihydrofolate reductase OS=Mesocricetus auratus GN=DHFR PE=2 SV=4 4 197 3.0E-29
sp|P22573|DYR_SHV2C Viral dihydrofolate reductase OS=Saimiriine herpesvirus 2 (strain 488) GN=DHFR PE=3 SV=1 4 196 7.0E-29
sp|P00374|DYR_HUMAN Dihydrofolate reductase OS=Homo sapiens GN=DHFR PE=1 SV=2 4 197 1.0E-28
sp|P17719|DYR_DROME Dihydrofolate reductase OS=Drosophila melanogaster GN=Dhfr PE=1 SV=3 1 197 9.0E-27
sp|Q9U8B8|DYR_HELVI Dihydrofolate reductase OS=Heliothis virescens GN=DHFR PE=1 SV=1 3 196 1.0E-25
sp|Q86XF0|DYRL1_HUMAN Dihydrofolate reductase, mitochondrial OS=Homo sapiens GN=DHFRL1 PE=1 SV=1 4 197 2.0E-23
sp|Q2HRC6|DYR_HHV8P Putative Dihydrofolate reductase OS=Human herpesvirus 8 type P (isolate GK18) GN=ORF2 PE=3 SV=1 4 152 2.0E-22
sp|P07807|DYR_YEAST Dihydrofolate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFR1 PE=1 SV=2 6 197 4.0E-21
sp|P12833|DYR3_SALTM Dihydrofolate reductase type 3 OS=Salmonella typhimurium GN=dhfrIII PE=1 SV=1 4 159 3.0E-20
sp|P16126|DRTS_LEIAM Bifunctional dihydrofolate reductase-thymidylate synthase OS=Leishmania amazonensis PE=3 SV=1 4 153 5.0E-20
sp|P04174|DYR_NEIGO Dihydrofolate reductase OS=Neisseria gonorrhoeae GN=folA PE=1 SV=1 1 170 3.0E-19
sp|Q27783|DRTS_TRYBB Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma brucei brucei PE=1 SV=1 4 134 3.0E-19
sp|P07382|DRTS_LEIMA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Leishmania major GN=LmjF06.0860 PE=1 SV=1 4 153 3.0E-19
sp|Q23695|DRTS_CRIFA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Crithidia fasciculata PE=3 SV=1 4 141 6.0E-19
sp|Q07422|DRTS_TOXGO Bifunctional dihydrofolate reductase-thymidylate synthase OS=Toxoplasma gondii PE=1 SV=1 4 155 4.0E-18
sp|P11045|DYR_BACSU Dihydrofolate reductase OS=Bacillus subtilis (strain 168) GN=dfrA PE=1 SV=2 4 196 5.0E-18
sp|P43791|DYR_HAEIN Dihydrofolate reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=folA PE=3 SV=1 4 171 6.0E-17
sp|P9WNX1|DYR_MYCTU Dihydrofolate reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=folA PE=1 SV=2 1 170 7.0E-17
sp|P9WNX0|DYR_MYCTO Dihydrofolate reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=folA PE=3 SV=2 1 170 7.0E-17
sp|P0A547|DYR_MYCBO Dihydrofolate reductase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=folA PE=3 SV=2 1 170 7.0E-17
sp|Q27793|DRTS_TRYCR Bifunctional dihydrofolate reductase-thymidylate synthase OS=Trypanosoma cruzi PE=1 SV=2 4 133 7.0E-17
sp|Q27713|DRTS_PLABA Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium berghei (strain Anka) PE=3 SV=1 15 158 8.0E-16
sp|Q9K168|DYR_NEIMB Dihydrofolate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=folA PE=3 SV=1 1 170 2.0E-15
sp|P46103|DRTS_PLAVN Bifunctional dihydrofolate reductase-thymidylate synthase (Fragment) OS=Plasmodium vinckei PE=3 SV=1 15 141 2.0E-15
sp|Q9JSQ9|DYR_NEIMA Dihydrofolate reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=folA PE=3 SV=1 1 170 2.0E-15
sp|P20712|DRTS_PLACH Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium chabaudi PE=3 SV=1 15 158 3.0E-15
sp|P13922|DRTS_PLAFK Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium falciparum (isolate K1 / Thailand) PE=1 SV=2 15 158 5.0E-15
sp|Q9CBW1|DYR_MYCLE Dihydrofolate reductase OS=Mycobacterium leprae (strain TN) GN=folA PE=3 SV=1 1 141 2.0E-14
sp|Q59397|DYR9_ECOLX Dihydrofolate reductase type 9 OS=Escherichia coli GN=dhfrIX PE=3 SV=1 1 194 7.0E-14
sp|O02604|DRTS_PLAVI Bifunctional dihydrofolate reductase-thymidylate synthase OS=Plasmodium vivax PE=1 SV=2 15 158 1.0E-13
sp|P0A017|DYR_STAAU Dihydrofolate reductase OS=Staphylococcus aureus GN=folA PE=1 SV=2 4 155 2.0E-13
sp|Q5HFZ7|DYR_STAAC Dihydrofolate reductase OS=Staphylococcus aureus (strain COL) GN=folA PE=3 SV=3 4 155 2.0E-13
sp|P0A016|DYR_STAAM Dihydrofolate reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=folA PE=3 SV=2 4 155 2.0E-13
sp|P99079|DYR_STAAN Dihydrofolate reductase OS=Staphylococcus aureus (strain N315) GN=folA PE=1 SV=2 4 155 2.0E-13
sp|Q6GGY1|DYR_STAAR Dihydrofolate reductase OS=Staphylococcus aureus (strain MRSA252) GN=folA PE=3 SV=3 4 155 2.0E-13
sp|P0C0P0|DYR_STAEP Dihydrofolate reductase OS=Staphylococcus epidermidis GN=folA PE=1 SV=1 4 155 2.0E-13
sp|Q5HPB1|DYR_STAEQ Dihydrofolate reductase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=folA PE=3 SV=1 4 155 2.0E-13
sp|P0C0P1|DYR_STAES Dihydrofolate reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=folA PE=3 SV=1 4 155 2.0E-13
sp|O62583|DYR_ENCCU Dihydrofolate reductase OS=Encephalitozoon cuniculi (strain GB-M1) GN=DHFR-1 PE=3 SV=1 4 153 3.0E-13
sp|Q8NWQ9|DYR_STAAW Dihydrofolate reductase OS=Staphylococcus aureus (strain MW2) GN=folA PE=3 SV=3 4 155 7.0E-13
sp|Q6G9D5|DYR_STAAS Dihydrofolate reductase OS=Staphylococcus aureus (strain MSSA476) GN=folA PE=3 SV=3 4 155 7.0E-13
sp|P13955|DYRA_STAAU Dihydrofolate reductase type 1 from Tn4003 OS=Staphylococcus aureus GN=dfrA PE=1 SV=3 4 155 8.0E-13
sp|Q89AV2|DYR_BUCBP Dihydrofolate reductase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=folA PE=3 SV=1 4 155 3.0E-12
sp|P57243|DYR_BUCAI Dihydrofolate reductase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=folA PE=3 SV=1 4 162 5.0E-12
sp|Q5UQG3|DRTS_MIMIV Bifunctional dihydrofolate reductase-thymidylate synthase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R497 PE=3 SV=1 1 141 9.0E-12
sp|P31073|DYR_CITFR Dihydrofolate reductase OS=Citrobacter freundii GN=folA PE=3 SV=1 4 162 1.0E-11
sp|P0ABQ6|DYR_SHIFL Dihydrofolate reductase OS=Shigella flexneri GN=folA PE=3 SV=1 4 162 1.0E-11
sp|P0ABQ4|DYR_ECOLI Dihydrofolate reductase OS=Escherichia coli (strain K12) GN=folA PE=1 SV=1 4 162 1.0E-11
sp|P0ABQ5|DYR_ECOL6 Dihydrofolate reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=folA PE=3 SV=1 4 162 1.0E-11
sp|P00381|DYR_LACCA Dihydrofolate reductase OS=Lactobacillus casei GN=folA PE=1 SV=3 4 150 2.0E-11
sp|Q27828|DRTS_PARTE Bifunctional dihydrofolate reductase-thymidylate synthase OS=Paramecium tetraurelia GN=GSPATT00019973001 PE=3 SV=1 4 192 2.0E-11
sp|Q5V600|DYR2_HALMA Dihydrofolate reductase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=folA2 PE=3 SV=1 7 153 5.0E-11
sp|Q54277|DYR_STAHA Dihydrofolate reductase OS=Staphylococcus haemolyticus GN=dfrD PE=1 SV=1 3 196 7.0E-11
sp|P31074|DYR_ENTAE Dihydrofolate reductase OS=Enterobacter aerogenes GN=folA PE=3 SV=1 4 155 8.0E-11
sp|Q9UWQ4|DYRB_HALVO Dihydrofolate reductase HdrB OS=Haloferax volcanii GN=hdrB PE=1 SV=1 6 168 9.0E-11
sp|Q8K9Z8|DYR_BUCAP Dihydrofolate reductase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=folA PE=3 SV=1 3 162 1.0E-09
sp|Q9PR30|DYR_UREPA Dihydrofolate reductase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=folA PE=3 SV=1 4 153 1.0E-09
sp|P00380|DYR_ENTFC Dihydrofolate reductase OS=Enterococcus faecium GN=folA PE=1 SV=1 10 196 1.0E-09
sp|Q54801|DYR_STRPN Dihydrofolate reductase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dhfR PE=1 SV=2 1 157 3.0E-09
sp|P47470|DYR_MYCGE Dihydrofolate reductase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=folA PE=3 SV=1 4 153 6.0E-09
sp|Q5V3R2|DYR1_HALMA Dihydrofolate reductase 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=folA1 PE=3 SV=1 2 182 8.0E-09
sp|Q59487|DYR_LACLA Dihydrofolate reductase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=folA PE=3 SV=2 16 166 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004146 dihydrofolate reductase activity Yes
GO:0046654 tetrahydrofolate biosynthetic process Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0046653 tetrahydrofolate metabolic process No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0009058 biosynthetic process No
GO:0042559 pteridine-containing compound biosynthetic process No
GO:0042558 pteridine-containing compound metabolic process No
GO:0016646 oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006575 cellular modified amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0009396 folic acid-containing compound biosynthetic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016645 oxidoreductase activity, acting on the CH-NH group of donors No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0006760 folic acid-containing compound metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0016491 oxidoreductase activity No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006260
MSRLTIIVAATVSNGIGKNGTLPWHLPKDLKYFAQATSTAPEGMQNAVIMGRNTWESIPVKYRPLKGRLNVVVSR
DSQYNLAVASGVAASLAGNLQSALDCINGTLPTAKPIHRAFIIGGSSIINETLSASLVDRVLLTRILSPNFESDT
FIPDFLESGQWSRSSDTDLKAWLGFDVPEGVQMENDIRYEFQMWTRN*
Coding >AgabiH97|006260
ATGTCGCGTCTTACTATCATTGTCGCTGCCACCGTTTCCAACGGTATTGGGAAAAATGGTACATTGCCCTGGCAT
CTTCCCAAAGATCTCAAGTATTTTGCCCAAGCTACTTCTACTGCGCCAGAGGGCATGCAGAATGCAGTGATAATG
GGAAGGAATACTTGGGAAAGTATTCCAGTCAAGTACAGACCATTGAAGGGACGTCTGAACGTCGTCGTCAGCCGC
GATTCTCAATACAACCTGGCTGTCGCCTCTGGTGTAGCGGCATCACTCGCTGGTAATCTCCAGTCCGCTTTGGAC
TGCATCAACGGTACACTCCCGACCGCAAAACCAATCCATCGAGCTTTCATTATCGGCGGCTCATCGATCATCAAC
GAAACACTCTCTGCCTCTTTAGTCGACAGAGTACTCCTCACGCGTATTTTGTCTCCCAATTTCGAGTCCGACACA
TTCATACCCGATTTTTTGGAGTCTGGACAATGGTCTCGCTCTTCAGATACAGACTTGAAGGCTTGGTTGGGATTT
GATGTACCGGAAGGTGTGCAGATGGAGAATGATATTAGATACGAGTTCCAGATGTGGACTAGGAATTAA
Transcript >AgabiH97|006260
ATGTCGCGTCTTACTATCATTGTCGCTGCCACCGTTTCCAACGGTATTGGGAAAAATGGTACATTGCCCTGGCAT
CTTCCCAAAGATCTCAAGTATTTTGCCCAAGCTACTTCTACTGCGCCAGAGGGCATGCAGAATGCAGTGATAATG
GGAAGGAATACTTGGGAAAGTATTCCAGTCAAGTACAGACCATTGAAGGGACGTCTGAACGTCGTCGTCAGCCGC
GATTCTCAATACAACCTGGCTGTCGCCTCTGGTGTAGCGGCATCACTCGCTGGTAATCTCCAGTCCGCTTTGGAC
TGCATCAACGGTACACTCCCGACCGCAAAACCAATCCATCGAGCTTTCATTATCGGCGGCTCATCGATCATCAAC
GAAACACTCTCTGCCTCTTTAGTCGACAGAGTACTCCTCACGCGTATTTTGTCTCCCAATTTCGAGTCCGACACA
TTCATACCCGATTTTTTGGAGTCTGGACAATGGTCTCGCTCTTCAGATACAGACTTGAAGGCTTGGTTGGGATTT
GATGTACCGGAAGGTGTGCAGATGGAGAATGATATTAGATACGAGTTCCAGATGTGGACTAGGAATTAA
Gene >AgabiH97|006260
ATGTCGCGTCTTACTATCATTGTCGCTGCCACCGTTTCCAACGGTATTGGGAAAAATGGTACATTGCCCTGGCAT
CTTCCCAAAGATCTCAAGTATTTTGCCCAAGCTACTTCTACTGCGCCAGAGGGCATGCAGAATGCAGTGATAATG
GGAAGGAATACTTGGGAAAGTATTCCAGTCAAGTACAGACCATTGAAGGGACGTCTGAACGTCGTCGTCAGCCGC
GATTCTCAATACAACCTGTACGTGAAAAAAAAAACCTCATCCTGCGTCTGCCTACTTATCATGCCCATGAAGGGC
TGTCGCCTCTGGTGTAGCGGCATCACTCGCTGGTAATCTCCAGTCCGCTTTGGACTGCATCAACGGTACACTCCC
GACCGCAAAACCAATCCATCGAGCTTTCATTATCGGCGGCTCATCGATCATCAACGAAACACTCTCTGCCTCTTT
AGTCGACAGAGTACTCCTCACGCGTATTTTGTCTCCCAATTTCGAGTCCGACACATTCATACCCGATTTTTTGGA
GTCTGGACAATGGTCTCGCTCTTCAGATACAGACTTGAAGGCTTGGTTGGGATTTGATGTACCGGAAGGTGTGCA
GATGGAGAATGATATTAGATACGAGTTCCAGATGTGGACTAGGAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail