Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006150
Gene name
Locationscaffold_1:1500408..1501918
Strand+
Gene length (bp)1510
Transcript length (bp)1029
Coding sequence length (bp)1029
Protein length (aa) 343

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07991 IlvN Acetohydroxy acid isomeroreductase, NADPH-binding domain 3.4E-50 17 183
PF01450 IlvC Acetohydroxy acid isomeroreductase, catalytic domain 1.5E-21 190 336
PF03807 F420_oxidored NADP oxidoreductase coenzyme F420-dependent 1.2E-08 21 109
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 4.9E-05 21 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q97YJ9|ILVC2_SULSO Putative ketol-acid reductoisomerase 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ilvC2 PE=3 SV=1 11 342 7.0E-55
sp|Q97X13|ILVC3_SULSO Putative ketol-acid reductoisomerase 3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ilvC3 PE=3 SV=1 17 339 1.0E-52
sp|Q58938|ILVC_METJA Ketol-acid reductoisomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvC PE=3 SV=3 4 334 2.0E-52
sp|Q9UWX9|ILVC1_SULSO Ketol-acid reductoisomerase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ilvC1 PE=3 SV=1 3 298 6.0E-51
sp|C3MW82|ILVC_SULIM Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=ilvC PE=3 SV=1 3 298 1.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q97YJ9|ILVC2_SULSO Putative ketol-acid reductoisomerase 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ilvC2 PE=3 SV=1 11 342 7.0E-55
sp|Q97X13|ILVC3_SULSO Putative ketol-acid reductoisomerase 3 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ilvC3 PE=3 SV=1 17 339 1.0E-52
sp|Q58938|ILVC_METJA Ketol-acid reductoisomerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ilvC PE=3 SV=3 4 334 2.0E-52
sp|Q9UWX9|ILVC1_SULSO Ketol-acid reductoisomerase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=ilvC1 PE=3 SV=1 3 298 6.0E-51
sp|C3MW82|ILVC_SULIM Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=ilvC PE=3 SV=1 3 298 1.0E-50
sp|C4KHT9|ILVC_SULIK Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=ilvC PE=3 SV=1 3 298 1.0E-50
sp|C3N6C4|ILVC_SULIA Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain M.16.27) GN=ilvC PE=3 SV=1 3 298 1.0E-50
sp|Q5SJ03|ILVC_THET8 Ketol-acid reductoisomerase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ilvC PE=3 SV=1 5 298 1.0E-50
sp|Q72JC8|ILVC_THET2 Ketol-acid reductoisomerase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=ilvC PE=3 SV=1 5 298 1.0E-50
sp|C3NET2|ILVC_SULIY Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=ilvC PE=3 SV=1 3 298 1.0E-50
sp|Q2NAU8|ILVC_ERYLH Ketol-acid reductoisomerase OS=Erythrobacter litoralis (strain HTCC2594) GN=ilvC PE=3 SV=1 5 337 2.0E-50
sp|Q9X5F8|ILVC_ZYMMO Ketol-acid reductoisomerase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=ilvC PE=3 SV=1 5 298 3.0E-50
sp|C3NGW2|ILVC_SULIN Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=ilvC PE=3 SV=1 3 298 4.0E-50
sp|B9MNV1|ILVC_CALBD Ketol-acid reductoisomerase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ilvC PE=3 SV=1 4 337 4.0E-50
sp|C3MQK4|ILVC_SULIL Ketol-acid reductoisomerase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=ilvC PE=3 SV=1 3 298 4.0E-50
sp|A4YI15|ILVC_METS5 Ketol-acid reductoisomerase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=ilvC PE=3 SV=1 4 298 6.0E-50
sp|Q8RDK4|ILVC_CALS4 Ketol-acid reductoisomerase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=ilvC PE=3 SV=1 4 342 7.0E-50
sp|Q8KER7|ILVC_CHLTE Ketol-acid reductoisomerase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=ilvC PE=3 SV=1 6 298 8.0E-50
sp|Q2JXL2|ILVC_SYNJA Ketol-acid reductoisomerase OS=Synechococcus sp. (strain JA-3-3Ab) GN=ilvC PE=3 SV=1 4 342 1.0E-49
sp|B3EHP0|ILVC_CHLL2 Ketol-acid reductoisomerase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=ilvC PE=3 SV=1 7 341 2.0E-49
sp|Q2RX71|ILVC_RHORT Ketol-acid reductoisomerase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=ilvC PE=3 SV=1 5 298 2.0E-49
sp|Q971A9|ILVC_SULTO Ketol-acid reductoisomerase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=ilvC PE=3 SV=1 4 298 2.0E-49
sp|B4SDK7|ILVC_PELPB Ketol-acid reductoisomerase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ilvC PE=3 SV=1 6 341 5.0E-49
sp|Q74BW9|ILVC_GEOSL Ketol-acid reductoisomerase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=ilvC PE=3 SV=1 5 338 5.0E-49
sp|Q11I83|ILVC_CHESB Ketol-acid reductoisomerase OS=Chelativorans sp. (strain BNC1) GN=ilvC PE=3 SV=1 5 298 7.0E-49
sp|A7GXQ8|ILVC_CAMC5 Ketol-acid reductoisomerase OS=Campylobacter curvus (strain 525.92) GN=ilvC PE=3 SV=1 3 337 8.0E-49
sp|A1AS39|ILVC_PELPD Ketol-acid reductoisomerase OS=Pelobacter propionicus (strain DSM 2379) GN=ilvC PE=3 SV=1 5 337 9.0E-49
sp|A1BES5|ILVC_CHLPD Ketol-acid reductoisomerase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=ilvC PE=3 SV=1 6 342 1.0E-48
sp|Q1QJU8|ILVC_NITHX Ketol-acid reductoisomerase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=ilvC PE=3 SV=1 5 298 1.0E-48
sp|B2IHY4|ILVC_BEII9 Ketol-acid reductoisomerase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=ilvC PE=3 SV=1 5 298 1.0E-48
sp|B8HNI6|ILVC_CYAP4 Ketol-acid reductoisomerase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=ilvC PE=3 SV=1 4 342 1.0E-48
sp|B0T4Y1|ILVC_CAUSK Ketol-acid reductoisomerase OS=Caulobacter sp. (strain K31) GN=ilvC PE=3 SV=1 5 342 1.0E-48
sp|Q8ZTE1|ILVC_PYRAE Ketol-acid reductoisomerase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=ilvC PE=3 SV=1 4 298 2.0E-48
sp|B6ITR6|ILVC_RHOCS Ketol-acid reductoisomerase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=ilvC PE=3 SV=1 5 298 3.0E-48
sp|A4XIL7|ILVC_CALS8 Ketol-acid reductoisomerase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=ilvC PE=3 SV=1 4 337 4.0E-48
sp|B0K0Y0|ILVC_THEPX Ketol-acid reductoisomerase OS=Thermoanaerobacter sp. (strain X514) GN=ilvC PE=3 SV=1 4 342 5.0E-48
sp|A1B2W3|ILVC_PARDP Ketol-acid reductoisomerase OS=Paracoccus denitrificans (strain Pd 1222) GN=ilvC PE=3 SV=1 5 298 6.0E-48
sp|Q2K6M2|ILVC_RHIEC Ketol-acid reductoisomerase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ilvC PE=3 SV=1 5 298 7.0E-48
sp|B3PT89|ILVC_RHIE6 Ketol-acid reductoisomerase OS=Rhizobium etli (strain CIAT 652) GN=ilvC PE=3 SV=1 5 298 7.0E-48
sp|Q9UZ09|ILVC_PYRAB Ketol-acid reductoisomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=ilvC PE=3 SV=1 4 303 7.0E-48
sp|Q3B594|ILVC_CHLL7 Ketol-acid reductoisomerase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ilvC PE=3 SV=1 6 342 8.0E-48
sp|Q98KM7|ILVC_RHILO Ketol-acid reductoisomerase OS=Rhizobium loti (strain MAFF303099) GN=ilvC PE=3 SV=1 5 298 9.0E-48
sp|A5EPB5|ILVC_BRASB Ketol-acid reductoisomerase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=ilvC PE=3 SV=1 5 341 1.0E-47
sp|A3MX05|ILVC_PYRCJ Ketol-acid reductoisomerase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=ilvC PE=3 SV=1 4 298 1.0E-47
sp|A4WLK6|ILVC_PYRAR Ketol-acid reductoisomerase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=ilvC PE=3 SV=1 4 298 1.0E-47
sp|A6UAW6|ILVC_SINMW Ketol-acid reductoisomerase OS=Sinorhizobium medicae (strain WSM419) GN=ilvC PE=3 SV=1 5 298 2.0E-47
sp|B7KF23|ILVC_CYAP7 Ketol-acid reductoisomerase OS=Cyanothece sp. (strain PCC 7424) GN=ilvC PE=3 SV=1 4 309 2.0E-47
sp|B6JB83|ILVC_OLICO Ketol-acid reductoisomerase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=ilvC PE=3 SV=1 5 298 2.0E-47
sp|A1RRZ8|ILVC_PYRIL Ketol-acid reductoisomerase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=ilvC PE=3 SV=1 4 298 2.0E-47
sp|Q2W1G2|ILVC_MAGSA Ketol-acid reductoisomerase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=ilvC PE=3 SV=2 5 284 2.0E-47
sp|Q52955|ILVC_RHIME Ketol-acid reductoisomerase OS=Rhizobium meliloti (strain 1021) GN=ilvC PE=3 SV=2 5 298 2.0E-47
sp|Q211Z6|ILVC_RHOPB Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain BisB18) GN=ilvC PE=3 SV=1 5 341 2.0E-47
sp|Q8U2A3|ILVC_PYRFU Ketol-acid reductoisomerase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=ilvC PE=3 SV=1 4 303 2.0E-47
sp|Q7NH80|ILVC_GLOVI Ketol-acid reductoisomerase OS=Gloeobacter violaceus (strain PCC 7421) GN=ilvC PE=3 SV=1 1 298 2.0E-47
sp|B1Y9N6|ILVC_PYRNV Ketol-acid reductoisomerase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=ilvC PE=3 SV=1 4 298 2.0E-47
sp|B9JGH5|ILVC_AGRRK Ketol-acid reductoisomerase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ilvC PE=3 SV=1 5 298 2.0E-47
sp|A5G7V3|ILVC_GEOUR Ketol-acid reductoisomerase OS=Geobacter uraniireducens (strain Rf4) GN=ilvC PE=3 SV=1 5 338 3.0E-47
sp|B5ZVQ5|ILVC_RHILW Ketol-acid reductoisomerase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=ilvC PE=3 SV=1 5 298 3.0E-47
sp|Q39W76|ILVC_GEOMG Ketol-acid reductoisomerase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=ilvC PE=3 SV=1 5 338 3.0E-47
sp|A5UMJ9|ILVC_METS3 Ketol-acid reductoisomerase OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=ilvC PE=3 SV=1 5 300 4.0E-47
sp|A4SFC5|ILVC_CHLPM Ketol-acid reductoisomerase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=ilvC PE=3 SV=1 6 342 4.0E-47
sp|B8EKP4|ILVC_METSB Ketol-acid reductoisomerase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ilvC PE=3 SV=1 5 337 4.0E-47
sp|A7I5I8|ILVC_METB6 Ketol-acid reductoisomerase OS=Methanoregula boonei (strain 6A8) GN=ilvC PE=3 SV=1 5 342 5.0E-47
sp|B0KAH3|ILVC_THEP3 Ketol-acid reductoisomerase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=ilvC PE=3 SV=1 4 342 5.0E-47
sp|Q1GE81|ILVC_RUEST Ketol-acid reductoisomerase OS=Ruegeria sp. (strain TM1040) GN=ilvC PE=3 SV=1 5 298 5.0E-47
sp|B3EKV1|ILVC_CHLPB Ketol-acid reductoisomerase OS=Chlorobium phaeobacteroides (strain BS1) GN=ilvC PE=3 SV=1 7 342 5.0E-47
sp|Q3ALC5|ILVC_SYNSC Ketol-acid reductoisomerase OS=Synechococcus sp. (strain CC9605) GN=ilvC PE=3 SV=1 4 340 6.0E-47
sp|Q2FM37|ILVC_METHJ Ketol-acid reductoisomerase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ilvC PE=3 SV=1 7 298 7.0E-47
sp|A5GRI8|ILVC_SYNR3 Ketol-acid reductoisomerase OS=Synechococcus sp. (strain RCC307) GN=ilvC PE=3 SV=1 4 340 7.0E-47
sp|A9IW67|ILVC_BART1 Ketol-acid reductoisomerase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=ilvC PE=3 SV=1 5 298 7.0E-47
sp|A7IFE5|ILVC_XANP2 Ketol-acid reductoisomerase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=ilvC PE=3 SV=1 5 337 8.0E-47
sp|Q1GT37|ILVC_SPHAL Ketol-acid reductoisomerase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=ilvC PE=3 SV=1 5 342 8.0E-47
sp|Q7VGW6|ILVC_HELHP Ketol-acid reductoisomerase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ilvC PE=3 SV=1 5 337 9.0E-47
sp|A1UT97|ILVC_BARBK Ketol-acid reductoisomerase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ilvC PE=3 SV=1 5 298 9.0E-47
sp|Q0BS26|ILVC_GRABC Ketol-acid reductoisomerase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ilvC PE=3 SV=1 5 342 9.0E-47
sp|Q6A7Z2|ILVC_PROAC Ketol-acid reductoisomerase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=ilvC PE=3 SV=1 4 298 1.0E-46
sp|A4WQ93|ILVC_RHOS5 Ketol-acid reductoisomerase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ilvC PE=3 SV=1 5 298 1.0E-46
sp|A6Q461|ILVC_NITSB Ketol-acid reductoisomerase OS=Nitratiruptor sp. (strain SB155-2) GN=ilvC PE=3 SV=1 6 298 1.0E-46
sp|Q7V8M5|ILVC_PROMM Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9313) GN=ilvC PE=3 SV=1 4 340 2.0E-46
sp|Q3SQ46|ILVC_NITWN Ketol-acid reductoisomerase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=ilvC PE=3 SV=1 5 341 2.0E-46
sp|B4RG67|ILVC_PHEZH Ketol-acid reductoisomerase OS=Phenylobacterium zucineum (strain HLK1) GN=ilvC PE=3 SV=1 5 298 2.0E-46
sp|Q9A6H4|ILVC_CAUCR Ketol-acid reductoisomerase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=ilvC PE=3 SV=1 5 298 2.0E-46
sp|B8GXW2|ILVC_CAUCN Ketol-acid reductoisomerase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ilvC PE=3 SV=1 5 298 2.0E-46
sp|Q8YUM5|ILVC_NOSS1 Ketol-acid reductoisomerase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ilvC PE=3 SV=1 4 309 3.0E-46
sp|A4YZA6|ILVC_BRASO Ketol-acid reductoisomerase OS=Bradyrhizobium sp. (strain ORS278) GN=ilvC PE=3 SV=1 5 341 3.0E-46
sp|Q3J5C0|ILVC_RHOS4 Ketol-acid reductoisomerase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ilvC PE=3 SV=1 5 298 3.0E-46
sp|B9KM37|ILVC_RHOSK Ketol-acid reductoisomerase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ilvC PE=3 SV=1 5 298 3.0E-46
sp|A3PH14|ILVC_RHOS1 Ketol-acid reductoisomerase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ilvC PE=3 SV=1 5 298 3.0E-46
sp|Q3MGX7|ILVC_ANAVT Ketol-acid reductoisomerase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=ilvC PE=3 SV=1 4 309 3.0E-46
sp|C3ME70|ILVC_RHISN Ketol-acid reductoisomerase OS=Rhizobium sp. (strain NGR234) GN=ilvC PE=3 SV=1 5 298 3.0E-46
sp|A2C482|ILVC_PROM1 Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain NATL1A) GN=ilvC PE=3 SV=1 4 340 3.0E-46
sp|Q3AVC2|ILVC_SYNS9 Ketol-acid reductoisomerase OS=Synechococcus sp. (strain CC9902) GN=ilvC PE=3 SV=1 4 340 4.0E-46
sp|A1WUW3|ILVC_HALHL Ketol-acid reductoisomerase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=ilvC PE=3 SV=1 5 298 5.0E-46
sp|Q5LTP7|ILVC_RUEPO Ketol-acid reductoisomerase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ilvC PE=3 SV=1 5 298 5.0E-46
sp|Q10WP7|ILVC_TRIEI Ketol-acid reductoisomerase OS=Trichodesmium erythraeum (strain IMS101) GN=ilvC PE=3 SV=1 4 298 6.0E-46
sp|Q28T07|ILVC_JANSC Ketol-acid reductoisomerase OS=Jannaschia sp. (strain CCS1) GN=ilvC PE=3 SV=1 5 231 7.0E-46
sp|A8LS39|ILVC_DINSH Ketol-acid reductoisomerase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=ilvC PE=3 SV=1 5 298 1.0E-45
sp|Q46JF6|ILVC_PROMT Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain NATL2A) GN=ilvC PE=3 SV=1 4 340 1.0E-45
sp|A0L626|ILVC_MAGMM Ketol-acid reductoisomerase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ilvC PE=3 SV=1 5 298 1.0E-45
sp|Q4J8K9|ILVC_SULAC Ketol-acid reductoisomerase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=ilvC PE=3 SV=1 4 298 1.0E-45
sp|A5V3W3|ILVC_SPHWW Ketol-acid reductoisomerase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=ilvC PE=3 SV=1 5 298 1.0E-45
sp|Q1MED4|ILVC_RHIL3 Ketol-acid reductoisomerase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ilvC PE=3 SV=1 5 298 1.0E-45
sp|B1WNP1|ILVC_CYAA5 Ketol-acid reductoisomerase OS=Cyanothece sp. (strain ATCC 51142) GN=ilvC PE=3 SV=1 4 309 1.0E-45
sp|A4FYE4|ILVC_METM5 Ketol-acid reductoisomerase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=ilvC PE=3 SV=1 5 298 1.0E-45
sp|Q0RDI8|ILVC_FRAAA Ketol-acid reductoisomerase OS=Frankia alni (strain ACN14a) GN=ilvC PE=3 SV=1 5 317 2.0E-45
sp|B9JXM6|ILVC_AGRVS Ketol-acid reductoisomerase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=ilvC PE=3 SV=1 5 298 2.0E-45
sp|Q168N1|ILVC_ROSDO Ketol-acid reductoisomerase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ilvC PE=3 SV=1 5 298 2.0E-45
sp|A2CB87|ILVC_PROM3 Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9303) GN=ilvC PE=3 SV=1 4 340 2.0E-45
sp|C0R090|ILVC_BRAHW Ketol-acid reductoisomerase OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=ilvC PE=3 SV=1 5 298 2.0E-45
sp|A9VZF3|ILVC_METEP Ketol-acid reductoisomerase OS=Methylobacterium extorquens (strain PA1) GN=ilvC PE=3 SV=1 5 298 2.0E-45
sp|B7KYZ3|ILVC_METC4 Ketol-acid reductoisomerase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=ilvC PE=3 SV=1 5 298 2.0E-45
sp|O27491|ILVC_METTH Ketol-acid reductoisomerase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ilvC PE=3 SV=2 5 299 3.0E-45
sp|A6VJW0|ILVC_METM7 Ketol-acid reductoisomerase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=ilvC PE=3 SV=1 5 298 3.0E-45
sp|A5GMM6|ILVC_SYNPW Ketol-acid reductoisomerase OS=Synechococcus sp. (strain WH7803) GN=ilvC PE=3 SV=1 4 340 3.0E-45
sp|Q2IUS3|ILVC_RHOP2 Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain HaA2) GN=ilvC PE=3 SV=1 5 231 4.0E-45
sp|Q4FPQ6|ILVC_PELUB Ketol-acid reductoisomerase OS=Pelagibacter ubique (strain HTCC1062) GN=ilvC PE=3 SV=1 6 337 4.0E-45
sp|Q7U5Q1|ILVC_SYNPX Ketol-acid reductoisomerase OS=Synechococcus sp. (strain WH8102) GN=ilvC PE=3 SV=1 4 340 4.0E-45
sp|B4S6N3|ILVC_PROA2 Ketol-acid reductoisomerase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=ilvC PE=3 SV=1 6 298 4.0E-45
sp|A6WZX5|ILVC_OCHA4 Ketol-acid reductoisomerase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=ilvC PE=3 SV=1 5 298 4.0E-45
sp|B3QSP0|ILVC_CHLT3 Ketol-acid reductoisomerase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=ilvC PE=3 SV=1 5 298 4.0E-45
sp|Q8TX44|ILVC_METKA Ketol-acid reductoisomerase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=ilvC PE=3 SV=1 4 338 5.0E-45
sp|O28294|ILVC_ARCFU Ketol-acid reductoisomerase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ilvC PE=3 SV=1 4 342 5.0E-45
sp|Q3APC3|ILVC_CHLCH Ketol-acid reductoisomerase OS=Chlorobium chlorochromatii (strain CaD3) GN=ilvC PE=3 SV=1 6 342 5.0E-45
sp|Q0AB89|ILVC_ALKEH Ketol-acid reductoisomerase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ilvC PE=3 SV=1 5 298 5.0E-45
sp|B0TCQ9|ILVC_HELMI Ketol-acid reductoisomerase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=ilvC PE=3 SV=1 5 340 7.0E-45
sp|Q8UDV0|ILVC_AGRFC Ketol-acid reductoisomerase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ilvC PE=3 SV=1 5 298 7.0E-45
sp|A9BGP6|ILVC_PETMO Ketol-acid reductoisomerase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ilvC PE=3 SV=1 7 337 9.0E-45
sp|Q31MY7|ILVC_SYNE7 Ketol-acid reductoisomerase OS=Synechococcus elongatus (strain PCC 7942) GN=ilvC PE=3 SV=2 4 298 9.0E-45
sp|Q139A2|ILVC_RHOPS Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain BisB5) GN=ilvC PE=3 SV=1 5 231 1.0E-44
sp|Q8DGR0|ILVC_THEEB Ketol-acid reductoisomerase OS=Thermosynechococcus elongatus (strain BP-1) GN=ilvC PE=3 SV=2 4 298 1.0E-44
sp|Q6LZH4|ILVC_METMP Ketol-acid reductoisomerase OS=Methanococcus maripaludis (strain S2 / LL) GN=ilvC PE=3 SV=1 5 298 1.0E-44
sp|B3QCW2|ILVC_RHOPT Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain TIE-1) GN=ilvC PE=3 SV=1 5 231 1.0E-44
sp|Q6N869|ILVC_RHOPA Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=ilvC PE=3 SV=1 5 231 1.0E-44
sp|Q2NI95|ILVC_METST Ketol-acid reductoisomerase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ilvC PE=3 SV=1 5 299 1.0E-44
sp|A8M5F9|ILVC_SALAI Ketol-acid reductoisomerase OS=Salinispora arenicola (strain CNS-205) GN=ilvC PE=3 SV=1 3 298 1.0E-44
sp|A9A7D0|ILVC_METM6 Ketol-acid reductoisomerase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=ilvC PE=3 SV=1 5 298 1.0E-44
sp|C1DA41|ILVC_LARHH Ketol-acid reductoisomerase OS=Laribacter hongkongensis (strain HLHK9) GN=ilvC PE=3 SV=1 5 298 2.0E-44
sp|Q8FZU1|ILVC_BRUSU Ketol-acid reductoisomerase OS=Brucella suis biovar 1 (strain 1330) GN=ilvC PE=3 SV=1 5 298 2.0E-44
sp|A5VRC9|ILVC_BRUO2 Ketol-acid reductoisomerase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=ilvC PE=3 SV=1 5 298 2.0E-44
sp|A9M637|ILVC_BRUC2 Ketol-acid reductoisomerase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=ilvC PE=3 SV=1 5 298 2.0E-44
sp|Q07PJ7|ILVC_RHOP5 Ketol-acid reductoisomerase OS=Rhodopseudomonas palustris (strain BisA53) GN=ilvC PE=3 SV=1 5 231 2.0E-44
sp|A8MDY9|ILVC_CALMQ Ketol-acid reductoisomerase OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=ilvC PE=3 SV=1 4 326 2.0E-44
sp|B0CHG8|ILVC_BRUSI Ketol-acid reductoisomerase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=ilvC PE=3 SV=1 5 298 2.0E-44
sp|B8E2W8|ILVC_DICTD Ketol-acid reductoisomerase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=ilvC PE=3 SV=1 4 298 2.0E-44
sp|B8DVE0|ILVC_BIFA0 Ketol-acid reductoisomerase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=ilvC PE=3 SV=1 3 298 2.0E-44
sp|Q8G6V2|ILVC1_BIFLO Ketol-acid reductoisomerase 1 OS=Bifidobacterium longum (strain NCC 2705) GN=ilvC1 PE=3 SV=2 3 303 2.0E-44
sp|B8CX20|ILVC_HALOH Ketol-acid reductoisomerase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ilvC PE=3 SV=1 6 334 2.0E-44
sp|B2GFJ7|ILVC_KOCRD Ketol-acid reductoisomerase OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=ilvC PE=3 SV=1 4 298 2.0E-44
sp|Q5N667|ILVC_SYNP6 Ketol-acid reductoisomerase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=ilvC PE=3 SV=1 4 298 3.0E-44
sp|A8ERD8|ILVC_ARCB4 Ketol-acid reductoisomerase OS=Arcobacter butzleri (strain RM4018) GN=ilvC PE=3 SV=1 6 298 3.0E-44
sp|B9EBF4|ILVC_MACCJ Ketol-acid reductoisomerase OS=Macrococcus caseolyticus (strain JCSC5402) GN=ilvC PE=3 SV=1 4 304 3.0E-44
sp|Q8FPX1|ILVC_COREF Ketol-acid reductoisomerase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=ilvC PE=3 SV=2 5 309 3.0E-44
sp|Q0C516|ILVC_HYPNA Ketol-acid reductoisomerase OS=Hyphomonas neptunium (strain ATCC 15444) GN=ilvC PE=3 SV=1 5 284 4.0E-44
sp|B8GUB6|ILVC_THISH Ketol-acid reductoisomerase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=ilvC PE=3 SV=1 5 298 4.0E-44
sp|Q0IC80|ILVC_SYNS3 Ketol-acid reductoisomerase OS=Synechococcus sp. (strain CC9311) GN=ilvC PE=3 SV=1 4 298 4.0E-44
sp|B1ZI53|ILVC_METPB Ketol-acid reductoisomerase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=ilvC PE=3 SV=1 5 298 4.0E-44
sp|A1KAB7|ILVC_AZOSB Ketol-acid reductoisomerase OS=Azoarcus sp. (strain BH72) GN=ilvC PE=3 SV=1 5 231 4.0E-44
sp|A8I679|ILVC_AZOC5 Ketol-acid reductoisomerase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=ilvC PE=3 SV=1 5 298 4.0E-44
sp|O67289|ILVC_AQUAE Ketol-acid reductoisomerase OS=Aquifex aeolicus (strain VF5) GN=ilvC PE=3 SV=1 4 231 5.0E-44
sp|A7HVZ2|ILVC_PARL1 Ketol-acid reductoisomerase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=ilvC PE=3 SV=1 5 298 5.0E-44
sp|Q89G50|ILVC_BRADU Ketol-acid reductoisomerase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ilvC PE=3 SV=1 5 298 5.0E-44
sp|A9GW78|ILVC_SORC5 Ketol-acid reductoisomerase OS=Sorangium cellulosum (strain So ce56) GN=ilvC PE=3 SV=1 4 231 5.0E-44
sp|O32414|ILVC_PHAMO Ketol-acid reductoisomerase OS=Phaeospirillum molischianum GN=ilvC PE=3 SV=1 5 298 6.0E-44
sp|B1LXF3|ILVC_METRJ Ketol-acid reductoisomerase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=ilvC PE=3 SV=1 5 295 6.0E-44
sp|B4U6I9|ILVC_HYDS0 Ketol-acid reductoisomerase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ilvC PE=3 SV=1 4 231 8.0E-44
sp|Q7P0H9|ILVC_CHRVO Ketol-acid reductoisomerase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ilvC PE=3 SV=1 5 298 9.0E-44
sp|Q6G2T6|ILVC_BARHE Ketol-acid reductoisomerase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=ilvC PE=3 SV=1 5 298 9.0E-44
sp|A6USF9|ILVC_METVS Ketol-acid reductoisomerase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=ilvC PE=3 SV=1 5 298 1.0E-43
sp|Q47BH8|ILVC_DECAR Ketol-acid reductoisomerase OS=Dechloromonas aromatica (strain RCB) GN=ilvC PE=3 SV=1 5 231 1.0E-43
sp|B0U8N5|ILVC_METS4 Ketol-acid reductoisomerase OS=Methylobacterium sp. (strain 4-46) GN=ilvC PE=3 SV=1 5 231 1.0E-43
sp|A2SR20|ILVC_METLZ Ketol-acid reductoisomerase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=ilvC PE=3 SV=1 7 298 2.0E-43
sp|B8GIC5|ILVC_METPE Ketol-acid reductoisomerase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=ilvC PE=3 SV=1 5 298 2.0E-43
sp|Q5NXP4|ILVC_AROAE Ketol-acid reductoisomerase OS=Aromatoleum aromaticum (strain EbN1) GN=ilvC PE=3 SV=1 5 231 2.0E-43
sp|B0JRP2|ILVC_MICAN Ketol-acid reductoisomerase OS=Microcystis aeruginosa (strain NIES-843) GN=ilvC PE=3 SV=1 4 309 2.0E-43
sp|A5G1L8|ILVC_ACICJ Ketol-acid reductoisomerase OS=Acidiphilium cryptum (strain JF-5) GN=ilvC PE=3 SV=1 5 298 2.0E-43
sp|Q7M851|ILVC_WOLSU Ketol-acid reductoisomerase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ilvC PE=3 SV=1 6 337 2.0E-43
sp|C6BXE6|ILVC_DESAD Ketol-acid reductoisomerase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=ilvC PE=3 SV=1 5 298 3.0E-43
sp|Q57CC7|ILVC_BRUAB Ketol-acid reductoisomerase OS=Brucella abortus biovar 1 (strain 9-941) GN=ilvC PE=3 SV=1 5 298 3.0E-43
sp|Q2YQN2|ILVC_BRUA2 Ketol-acid reductoisomerase OS=Brucella abortus (strain 2308) GN=ilvC PE=3 SV=1 5 298 3.0E-43
sp|B2S6K5|ILVC_BRUA1 Ketol-acid reductoisomerase OS=Brucella abortus (strain S19) GN=ilvC PE=3 SV=1 5 298 3.0E-43
sp|A9BBT2|ILVC_PROM4 Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9211) GN=ilvC PE=3 SV=1 4 340 3.0E-43
sp|B2J2U6|ILVC_NOSP7 Ketol-acid reductoisomerase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=ilvC PE=3 SV=1 4 342 3.0E-43
sp|Q6FZ98|ILVC_BARQU Ketol-acid reductoisomerase OS=Bartonella quintana (strain Toulouse) GN=ilvC PE=3 SV=1 6 298 3.0E-43
sp|Q2IJB7|ILVC_ANADE Ketol-acid reductoisomerase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=ilvC PE=3 SV=1 4 298 4.0E-43
sp|B8J829|ILVC_ANAD2 Ketol-acid reductoisomerase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ilvC PE=3 SV=1 4 298 4.0E-43
sp|B5YEF3|ILVC_DICT6 Ketol-acid reductoisomerase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=ilvC PE=3 SV=1 4 340 4.0E-43
sp|A3CXJ5|ILVC_METMJ Ketol-acid reductoisomerase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ilvC PE=3 SV=1 7 298 5.0E-43
sp|Q8YI21|ILVC_BRUME Ketol-acid reductoisomerase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ilvC PE=3 SV=1 5 298 8.0E-43
sp|C0RE20|ILVC_BRUMB Ketol-acid reductoisomerase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=ilvC PE=3 SV=1 5 298 8.0E-43
sp|B0SL33|ILVC_LEPBP Ketol-acid reductoisomerase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=ilvC PE=3 SV=1 4 231 1.0E-42
sp|B0SCQ5|ILVC_LEPBA Ketol-acid reductoisomerase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=ilvC PE=3 SV=1 4 231 1.0E-42
sp|Q2J6V2|ILVC_FRASC Ketol-acid reductoisomerase OS=Frankia sp. (strain CcI3) GN=ilvC PE=3 SV=1 5 317 2.0E-42
sp|B5EP52|ILVC_ACIF5 Ketol-acid reductoisomerase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=ilvC PE=3 SV=1 5 298 2.0E-42
sp|B7J643|ILVC_ACIF2 Ketol-acid reductoisomerase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=ilvC PE=3 SV=1 5 298 2.0E-42
sp|Q6F821|ILVC_ACIAD Ketol-acid reductoisomerase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ilvC PE=3 SV=1 5 298 2.0E-42
sp|A9GZJ4|ILVC_GLUDA Ketol-acid reductoisomerase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=ilvC PE=3 SV=1 5 231 2.0E-42
sp|B9KYS1|ILVC_THERP Ketol-acid reductoisomerase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ilvC PE=3 SV=1 4 232 2.0E-42
sp|Q7VAR8|ILVC_PROMA Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=ilvC PE=3 SV=1 4 298 2.0E-42
sp|A4X4A5|ILVC_SALTO Ketol-acid reductoisomerase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=ilvC PE=3 SV=1 3 320 3.0E-42
sp|C0QTD8|ILVC_PERMH Ketol-acid reductoisomerase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=ilvC PE=3 SV=1 4 231 3.0E-42
sp|Q3AEQ7|ILVC_CARHZ Ketol-acid reductoisomerase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=ilvC PE=3 SV=1 5 298 3.0E-42
sp|Q47SB6|ILVC_THEFY Ketol-acid reductoisomerase OS=Thermobifida fusca (strain YX) GN=ilvC PE=3 SV=1 3 316 4.0E-42
sp|B2V7F0|ILVC_SULSY Ketol-acid reductoisomerase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=ilvC PE=3 SV=1 4 231 4.0E-42
sp|B1VZ72|ILVC_STRGG Ketol-acid reductoisomerase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=ilvC PE=3 SV=1 4 231 5.0E-42
sp|Q02CM4|ILVC_SOLUE Ketol-acid reductoisomerase OS=Solibacter usitatus (strain Ellin6076) GN=ilvC PE=3 SV=1 7 298 5.0E-42
sp|B5YJT0|ILVC_THEYD Ketol-acid reductoisomerase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=ilvC PE=3 SV=1 5 320 6.0E-42
sp|A6W7N6|ILVC_KINRD Ketol-acid reductoisomerase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=ilvC PE=3 SV=1 4 315 7.0E-42
sp|B4UAN4|ILVC_ANASK Ketol-acid reductoisomerase OS=Anaeromyxobacter sp. (strain K) GN=ilvC PE=3 SV=1 4 298 8.0E-42
sp|B2TIR4|ILVC_CLOBB Ketol-acid reductoisomerase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=ilvC PE=3 SV=1 5 298 8.0E-42
sp|Q605K9|ILVC_METCA Ketol-acid reductoisomerase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ilvC PE=3 SV=1 5 298 1.0E-41
sp|A1AW99|ILVC_RUTMC Ketol-acid reductoisomerase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=ilvC PE=3 SV=1 7 298 1.0E-41
sp|Q30T61|ILVC_SULDN Ketol-acid reductoisomerase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=ilvC PE=3 SV=2 6 298 1.0E-41
sp|A8L548|ILVC_FRASN Ketol-acid reductoisomerase OS=Frankia sp. (strain EAN1pec) GN=ilvC PE=3 SV=1 5 317 1.0E-41
sp|B2UYT8|ILVC_CLOBA Ketol-acid reductoisomerase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=ilvC PE=3 SV=1 5 298 1.0E-41
sp|Q5HVD9|ILVC_CAMJR Ketol-acid reductoisomerase OS=Campylobacter jejuni (strain RM1221) GN=ilvC PE=3 SV=1 6 298 1.0E-41
sp|Q8EN66|ILVC_OCEIH Ketol-acid reductoisomerase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ilvC PE=3 SV=1 4 295 2.0E-41
sp|C5CYN9|ILVC_VARPS Ketol-acid reductoisomerase OS=Variovorax paradoxus (strain S110) GN=ilvC PE=3 SV=1 5 298 2.0E-41
sp|A4IRH9|ILVC_GEOTN Ketol-acid reductoisomerase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=ilvC PE=3 SV=1 4 295 2.0E-41
sp|Q6AEP2|ILVC_LEIXX Ketol-acid reductoisomerase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=ilvC PE=3 SV=1 4 314 2.0E-41
sp|B9KB98|ILVC_THENN Ketol-acid reductoisomerase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=ilvC PE=3 SV=1 4 231 2.0E-41
sp|Q9PHN5|ILVC_CAMJE Ketol-acid reductoisomerase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ilvC PE=1 SV=1 6 298 2.0E-41
sp|A4J179|ILVC_DESRM Ketol-acid reductoisomerase OS=Desulfotomaculum reducens (strain MI-1) GN=ilvC PE=3 SV=1 5 231 2.0E-41
sp|A7H4H9|ILVC_CAMJD Ketol-acid reductoisomerase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=ilvC PE=3 SV=1 6 298 2.0E-41
sp|A1KUZ8|ILVC_NEIMF Ketol-acid reductoisomerase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ilvC PE=3 SV=1 5 231 3.0E-41
sp|Q9JYI2|ILVC_NEIMB Ketol-acid reductoisomerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ilvC PE=3 SV=1 5 231 3.0E-41
sp|A9M177|ILVC_NEIM0 Ketol-acid reductoisomerase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ilvC PE=3 SV=1 5 231 3.0E-41
sp|B8HAS8|ILVC_ARTCA Ketol-acid reductoisomerase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=ilvC PE=3 SV=1 5 317 3.0E-41
sp|Q7V0F0|ILVC_PROMP Ketol-acid reductoisomerase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=ilvC PE=3 SV=1 4 340 3.0E-41
sp|A2BSN6|ILVC_PROMS Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain AS9601) GN=ilvC PE=3 SV=1 4 340 4.0E-41
sp|Q9JTI3|ILVC_NEIMA Ketol-acid reductoisomerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ilvC PE=3 SV=1 5 231 4.0E-41
sp|A0B5E0|ILVC_METTP Ketol-acid reductoisomerase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=ilvC PE=3 SV=1 4 298 4.0E-41
sp|Q5FRY8|ILVC_GLUOX Ketol-acid reductoisomerase OS=Gluconobacter oxydans (strain 621H) GN=ilvC PE=3 SV=1 5 231 4.0E-41
sp|B1L8U5|ILVC_THESQ Ketol-acid reductoisomerase OS=Thermotoga sp. (strain RQ2) GN=ilvC PE=3 SV=1 4 231 4.0E-41
sp|Q9WZ20|ILVC_THEMA Ketol-acid reductoisomerase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ilvC PE=3 SV=1 4 231 4.0E-41
sp|Q59818|ILVC_STRAW Ketol-acid reductoisomerase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ilvC PE=3 SV=2 4 231 5.0E-41
sp|Q6HKA1|ILVC2_BACHK Ketol-acid reductoisomerase 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ilvC2 PE=3 SV=1 5 298 6.0E-41
sp|Q81S27|ILVC2_BACAN Ketol-acid reductoisomerase 2 OS=Bacillus anthracis GN=ilvC2 PE=3 SV=1 5 298 7.0E-41
sp|Q9RU74|ILVC_DEIRA Ketol-acid reductoisomerase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=ilvC PE=3 SV=2 3 298 7.0E-41
sp|C5D5M1|ILVC_GEOSW Ketol-acid reductoisomerase OS=Geobacillus sp. (strain WCH70) GN=ilvC PE=3 SV=1 4 295 7.0E-41
sp|A9BME9|ILVC_DELAS Ketol-acid reductoisomerase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=ilvC PE=3 SV=1 5 231 8.0E-41
sp|A7ZEF1|ILVC_CAMC1 Ketol-acid reductoisomerase OS=Campylobacter concisus (strain 13826) GN=ilvC PE=3 SV=1 6 337 8.0E-41
sp|C0ZXM2|ILVC_RHOE4 Ketol-acid reductoisomerase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ilvC PE=3 SV=1 3 303 8.0E-41
sp|Q2JKN5|ILVC_SYNJB Ketol-acid reductoisomerase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ilvC PE=3 SV=1 4 342 8.0E-41
sp|P29107|ILVC_SYNY3 Ketol-acid reductoisomerase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ilvC PE=1 SV=3 4 335 9.0E-41
sp|A3PEE9|ILVC_PROM0 Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9301) GN=ilvC PE=3 SV=1 4 340 1.0E-40
sp|A9AZM5|ILVC_HERA2 Ketol-acid reductoisomerase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=ilvC PE=3 SV=1 4 231 1.0E-40
sp|B8J2E2|ILVC_DESDA Ketol-acid reductoisomerase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=ilvC PE=3 SV=1 5 298 1.0E-40
sp|A1VYZ2|ILVC_CAMJJ Ketol-acid reductoisomerase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=ilvC PE=3 SV=1 6 298 1.0E-40
sp|Q319H3|ILVC_PROM9 Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9312) GN=ilvC PE=3 SV=1 4 340 1.0E-40
sp|B2ILY8|ILVC_STRPS Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain CGSP14) GN=ilvC PE=3 SV=1 3 300 1.0E-40
sp|Q5F7E5|ILVC_NEIG1 Ketol-acid reductoisomerase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ilvC PE=3 SV=1 5 231 1.0E-40
sp|A8FL53|ILVC_CAMJ8 Ketol-acid reductoisomerase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=ilvC PE=3 SV=1 6 298 1.0E-40
sp|B9DMJ5|ILVC_STACT Ketol-acid reductoisomerase OS=Staphylococcus carnosus (strain TM300) GN=ilvC PE=3 SV=1 6 337 2.0E-40
sp|C1CPV5|ILVC_STRZT Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=ilvC PE=3 SV=1 3 300 2.0E-40
sp|C1CIU7|ILVC_STRZP Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain P1031) GN=ilvC PE=3 SV=1 3 300 2.0E-40
sp|C1CCK9|ILVC_STRZJ Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain JJA) GN=ilvC PE=3 SV=1 3 300 2.0E-40
sp|Q8DR03|ILVC_STRR6 Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ilvC PE=3 SV=1 3 300 2.0E-40
sp|Q97SD7|ILVC_STRPN Ketol-acid reductoisomerase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ilvC PE=3 SV=2 3 300 2.0E-40
sp|B8ZLL0|ILVC_STRPJ Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=ilvC PE=3 SV=1 3 300 2.0E-40
sp|C1C5I0|ILVC_STRP7 Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain 70585) GN=ilvC PE=3 SV=1 3 300 2.0E-40
sp|Q04M32|ILVC_STRP2 Ketol-acid reductoisomerase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ilvC PE=3 SV=1 3 300 2.0E-40
sp|B1XL20|ILVC_SYNP2 Ketol-acid reductoisomerase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=ilvC PE=3 SV=1 4 340 2.0E-40
sp|A5CPY6|ILVC_CLAM3 Ketol-acid reductoisomerase OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=ilvC PE=3 SV=1 6 314 2.0E-40
sp|B1I9N6|ILVC_STRPI Ketol-acid reductoisomerase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=ilvC PE=3 SV=1 3 300 2.0E-40
sp|A8G6C6|ILVC_PROM2 Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9215) GN=ilvC PE=3 SV=1 4 340 3.0E-40
sp|A5IJM5|ILVC_THEP1 Ketol-acid reductoisomerase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=ilvC PE=3 SV=1 4 231 3.0E-40
sp|C4XSF4|ILVC_DESMR Ketol-acid reductoisomerase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=ilvC PE=3 SV=1 5 298 3.0E-40
sp|A2BY22|ILVC_PROM5 Ketol-acid reductoisomerase OS=Prochlorococcus marinus (strain MIT 9515) GN=ilvC PE=3 SV=1 4 340 4.0E-40
sp|C1B2M1|ILVC_RHOOB Ketol-acid reductoisomerase OS=Rhodococcus opacus (strain B4) GN=ilvC PE=3 SV=1 3 303 4.0E-40
sp|Q0S2H3|ILVC_RHOJR Ketol-acid reductoisomerase OS=Rhodococcus jostii (strain RHA1) GN=ilvC PE=3 SV=1 3 303 4.0E-40
sp|A0JXZ6|ILVC_ARTS2 Ketol-acid reductoisomerase OS=Arthrobacter sp. (strain FB24) GN=ilvC PE=3 SV=1 5 317 4.0E-40
sp|A8AVN4|ILVC_STRGC Ketol-acid reductoisomerase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=ilvC PE=3 SV=1 3 300 5.0E-40
sp|B0V5G8|ILVC_ACIBY Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain AYE) GN=ilvC PE=3 SV=1 5 231 5.0E-40
sp|A3M254|ILVC_ACIBT Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=ilvC PE=3 SV=2 5 231 5.0E-40
sp|B0VKP5|ILVC_ACIBS Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain SDF) GN=ilvC PE=3 SV=1 5 231 5.0E-40
sp|B2HTC8|ILVC_ACIBC Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain ACICU) GN=ilvC PE=3 SV=1 5 231 5.0E-40
sp|B7I5I9|ILVC_ACIB5 Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain AB0057) GN=ilvC PE=3 SV=1 5 231 5.0E-40
sp|B7H047|ILVC_ACIB3 Ketol-acid reductoisomerase OS=Acinetobacter baumannii (strain AB307-0294) GN=ilvC PE=3 SV=1 5 231 5.0E-40
sp|Q63CV4|ILVC2_BACCZ Ketol-acid reductoisomerase 2 OS=Bacillus cereus (strain ZK / E33L) GN=ilvC2 PE=3 SV=1 5 298 5.0E-40
sp|Q4FUB6|ILVC_PSYA2 Ketol-acid reductoisomerase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ilvC PE=3 SV=1 6 231 5.0E-40
sp|B0RIN6|ILVC_CLAMS Ketol-acid reductoisomerase OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=ilvC PE=3 SV=1 6 314 5.0E-40
sp|Q49Z11|ILVC_STAS1 Ketol-acid reductoisomerase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ilvC PE=3 SV=1 6 307 6.0E-40
sp|B7K0S6|ILVC_CYAP8 Ketol-acid reductoisomerase OS=Cyanothece sp. (strain PCC 8801) GN=ilvC PE=3 SV=1 4 309 6.0E-40
sp|Q3J875|ILVC_NITOC Ketol-acid reductoisomerase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ilvC PE=3 SV=1 6 298 7.0E-40
sp|B3E5X4|ILVC_GEOLS Ketol-acid reductoisomerase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=ilvC PE=3 SV=1 6 298 7.0E-40
sp|B1XUJ0|ILVC_POLNS Ketol-acid reductoisomerase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ilvC PE=3 SV=1 5 231 8.0E-40
sp|Q5KWJ2|ILVC_GEOKA Ketol-acid reductoisomerase OS=Geobacillus kaustophilus (strain HTA426) GN=ilvC PE=3 SV=1 4 298 8.0E-40
sp|Q8DW43|ILVC_STRMU Ketol-acid reductoisomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ilvC PE=3 SV=1 3 303 8.0E-40
sp|A7I0D4|ILVC_CAMHC Ketol-acid reductoisomerase OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=ilvC PE=3 SV=1 6 337 8.0E-40
sp|Q9K8E7|ILVC_BACHD Ketol-acid reductoisomerase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ilvC PE=3 SV=1 4 295 9.0E-40
sp|Q0W834|ILVC_METAR Ketol-acid reductoisomerase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=ilvC PE=3 SV=1 4 298 9.0E-40
sp|Q81F27|ILVC2_BACCR Ketol-acid reductoisomerase 2 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ilvC2 PE=3 SV=1 5 298 1.0E-39
sp|Q8Y5S0|ILVC_LISMO Ketol-acid reductoisomerase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ilvC PE=3 SV=1 4 341 1.0E-39
sp|Q5M2F2|ILVC_STRT2 Ketol-acid reductoisomerase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=ilvC PE=3 SV=1 3 300 1.0E-39
sp|Q5LXV0|ILVC_STRT1 Ketol-acid reductoisomerase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=ilvC PE=3 SV=1 3 300 1.0E-39
sp|B8IGT3|ILVC_METNO Ketol-acid reductoisomerase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=ilvC PE=3 SV=1 5 337 1.0E-39
sp|Q4JUN9|ILVC_CORJK Ketol-acid reductoisomerase OS=Corynebacterium jeikeium (strain K411) GN=ilvC PE=3 SV=1 6 341 1.0E-39
sp|Q9F0I7|ILVC_STRTR Ketol-acid reductoisomerase OS=Streptococcus thermophilus GN=ilvC PE=3 SV=1 3 300 2.0E-39
sp|Q03IJ9|ILVC_STRTD Ketol-acid reductoisomerase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=ilvC PE=3 SV=1 3 300 2.0E-39
sp|Q8G6V1|ILVC2_BIFLO Ketol-acid reductoisomerase 2 OS=Bifidobacterium longum (strain NCC 2705) GN=ilvC2 PE=3 SV=1 3 298 2.0E-39
sp|Q1QDE6|ILVC_PSYCK Ketol-acid reductoisomerase OS=Psychrobacter cryohalolentis (strain K5) GN=ilvC PE=3 SV=1 6 231 2.0E-39
sp|Q2G623|ILVC_NOVAD Ketol-acid reductoisomerase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=ilvC PE=3 SV=1 5 298 2.0E-39
sp|A0AK91|ILVC_LISW6 Ketol-acid reductoisomerase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=ilvC PE=3 SV=1 4 298 2.0E-39
sp|P9WKJ7|ILVC_MYCTU Ketol-acid reductoisomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ilvC PE=1 SV=2 5 294 3.0E-39
sp|P9WKJ6|ILVC_MYCTO Ketol-acid reductoisomerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ilvC PE=3 SV=2 5 294 3.0E-39
sp|A5U713|ILVC_MYCTA Ketol-acid reductoisomerase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ilvC PE=3 SV=2 5 294 3.0E-39
sp|A1KMZ6|ILVC_MYCBP Ketol-acid reductoisomerase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ilvC PE=3 SV=2 5 294 3.0E-39
sp|P65150|ILVC_MYCBO Ketol-acid reductoisomerase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ilvC PE=3 SV=2 5 294 3.0E-39
sp|Q5YRW2|ILVC_NOCFA Ketol-acid reductoisomerase OS=Nocardia farcinica (strain IFM 10152) GN=ilvC PE=3 SV=1 3 232 3.0E-39
sp|B9KCI3|ILVC_CAMLR Ketol-acid reductoisomerase OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=ilvC PE=3 SV=1 3 231 3.0E-39
sp|A1W6T4|ILVC_ACISJ Ketol-acid reductoisomerase OS=Acidovorax sp. (strain JS42) GN=ilvC PE=3 SV=1 5 231 3.0E-39
sp|B9MA35|ILVC_ACIET Ketol-acid reductoisomerase OS=Acidovorax ebreus (strain TPSY) GN=ilvC PE=3 SV=1 5 231 3.0E-39
sp|Q3SHE4|ILVC_THIDA Ketol-acid reductoisomerase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ilvC PE=3 SV=1 5 298 3.0E-39
sp|Q5V520|ILVC_HALMA Ketol-acid reductoisomerase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=ilvC PE=3 SV=1 3 300 4.0E-39
sp|Q73VH7|ILVC_MYCPA Ketol-acid reductoisomerase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ilvC PE=3 SV=2 6 323 4.0E-39
sp|A0QJC6|ILVC_MYCA1 Ketol-acid reductoisomerase OS=Mycobacterium avium (strain 104) GN=ilvC PE=3 SV=1 6 323 4.0E-39
sp|C1CWT7|ILVC_DEIDV Ketol-acid reductoisomerase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=ilvC PE=3 SV=1 3 298 4.0E-39
sp|B7GH18|ILVC_ANOFW Ketol-acid reductoisomerase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=ilvC PE=3 SV=1 5 337 4.0E-39
sp|C0Z9C7|ILVC_BREBN Ketol-acid reductoisomerase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ilvC PE=3 SV=1 5 295 5.0E-39
sp|A9IGJ3|ILVC_BORPD Ketol-acid reductoisomerase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=ilvC PE=3 SV=1 5 298 5.0E-39
sp|B8DNQ9|ILVC_DESVM Ketol-acid reductoisomerase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=ilvC PE=3 SV=1 5 298 5.0E-39
sp|Q1GZE9|ILVC_METFK Ketol-acid reductoisomerase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ilvC PE=3 SV=1 5 298 5.0E-39
sp|B1VG26|ILVC_CORU7 Ketol-acid reductoisomerase OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=ilvC PE=3 SV=1 6 231 6.0E-39
sp|B0CE35|ILVC_ACAM1 Ketol-acid reductoisomerase OS=Acaryochloris marina (strain MBIC 11017) GN=ilvC PE=3 SV=1 4 335 6.0E-39
sp|B8I1T8|ILVC_CLOCE Ketol-acid reductoisomerase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ilvC PE=3 SV=1 4 298 6.0E-39
sp|B8DBU5|ILVC_LISMH Ketol-acid reductoisomerase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=ilvC PE=3 SV=1 4 298 6.0E-39
sp|Q71Y36|ILVC_LISMF Ketol-acid reductoisomerase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=ilvC PE=3 SV=1 4 298 6.0E-39
sp|C1KWT0|ILVC_LISMC Ketol-acid reductoisomerase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=ilvC PE=3 SV=1 4 298 6.0E-39
sp|Q92A29|ILVC_LISIN Ketol-acid reductoisomerase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=ilvC PE=3 SV=1 4 298 6.0E-39
sp|A4SXR3|ILVC_POLSQ Ketol-acid reductoisomerase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ilvC PE=3 SV=1 5 231 6.0E-39
sp|Q30ZD3|ILVC_DESAG Ketol-acid reductoisomerase OS=Desulfovibrio alaskensis (strain G20) GN=ilvC PE=3 SV=1 5 298 7.0E-39
sp|C1DFH7|ILVC_AZOVD Ketol-acid reductoisomerase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ilvC PE=1 SV=1 5 231 8.0E-39
sp|B5E1Q6|ILVC_STRP4 Ketol-acid reductoisomerase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=ilvC PE=3 SV=1 3 300 8.0E-39
sp|A1TRT6|ILVC_ACIAC Ketol-acid reductoisomerase OS=Acidovorax citrulli (strain AAC00-1) GN=ilvC PE=3 SV=1 5 231 8.0E-39
sp|A6LPX8|ILVC_CLOB8 Ketol-acid reductoisomerase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=ilvC PE=3 SV=1 1 231 9.0E-39
sp|Q9HVA2|ILVC_PSEAE Ketol-acid reductoisomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ilvC PE=1 SV=1 5 231 9.0E-39
sp|Q02FX9|ILVC_PSEAB Ketol-acid reductoisomerase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ilvC PE=3 SV=1 5 231 9.0E-39
sp|B7V1A6|ILVC_PSEA8 Ketol-acid reductoisomerase OS=Pseudomonas aeruginosa (strain LESB58) GN=ilvC PE=3 SV=1 5 231 9.0E-39
sp|A6VCE7|ILVC_PSEA7 Ketol-acid reductoisomerase OS=Pseudomonas aeruginosa (strain PA7) GN=ilvC PE=3 SV=1 5 231 9.0E-39
sp|Q5H4C1|ILVC_XANOR Ketol-acid reductoisomerase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ilvC PE=3 SV=2 18 298 1.0E-38
sp|B2SNG5|ILVC_XANOP Ketol-acid reductoisomerase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ilvC PE=3 SV=1 18 298 1.0E-38
sp|Q2P757|ILVC_XANOM Ketol-acid reductoisomerase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ilvC PE=3 SV=1 18 298 1.0E-38
sp|A9WP08|ILVC_RENSM Ketol-acid reductoisomerase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=ilvC PE=3 SV=1 5 314 1.0E-38
sp|Q1J0T2|ILVC_DEIGD Ketol-acid reductoisomerase OS=Deinococcus geothermalis (strain DSM 11300) GN=ilvC PE=3 SV=1 3 298 1.0E-38
sp|A0PPY3|ILVC_MYCUA Ketol-acid reductoisomerase OS=Mycobacterium ulcerans (strain Agy99) GN=ilvC PE=3 SV=1 6 302 1.0E-38
sp|A4VXL3|ILVC_STRSY Ketol-acid reductoisomerase OS=Streptococcus suis (strain 05ZYH33) GN=ilvC PE=3 SV=1 3 300 1.0E-38
sp|A4W3V8|ILVC_STRS2 Ketol-acid reductoisomerase OS=Streptococcus suis (strain 98HAH33) GN=ilvC PE=3 SV=1 3 300 1.0E-38
sp|A3CQ86|ILVC_STRSV Ketol-acid reductoisomerase OS=Streptococcus sanguinis (strain SK36) GN=ilvC PE=3 SV=1 8 300 1.0E-38
sp|A5CWZ1|ILVC_VESOH Ketol-acid reductoisomerase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=ilvC PE=3 SV=1 6 298 1.0E-38
sp|Q59500|ILVC_MYCAV Ketol-acid reductoisomerase OS=Mycobacterium avium GN=ilvC PE=3 SV=1 6 323 2.0E-38
sp|Q1R092|ILVC_CHRSD Ketol-acid reductoisomerase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ilvC PE=3 SV=1 5 231 2.0E-38
sp|Q73A47|ILVC2_BACC1 Ketol-acid reductoisomerase 2 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ilvC2 PE=3 SV=1 5 298 2.0E-38
sp|Q2S9V9|ILVC_HAHCH Ketol-acid reductoisomerase OS=Hahella chejuensis (strain KCTC 2396) GN=ilvC PE=3 SV=1 5 231 2.0E-38
sp|A9KQ65|ILVC_CLOPH Ketol-acid reductoisomerase OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ilvC PE=3 SV=1 4 285 2.0E-38
sp|Q8P5L5|ILVC_XANCP Ketol-acid reductoisomerase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ilvC PE=3 SV=1 18 295 2.0E-38
sp|B0RP32|ILVC_XANCB Ketol-acid reductoisomerase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ilvC PE=3 SV=1 18 295 2.0E-38
sp|Q4UYF7|ILVC_XANC8 Ketol-acid reductoisomerase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ilvC PE=3 SV=1 18 295 2.0E-38
sp|Q2YBU1|ILVC_NITMU Ketol-acid reductoisomerase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ilvC PE=3 SV=1 6 298 2.0E-38
sp|Q17X66|ILVC_HELAH Ketol-acid reductoisomerase OS=Helicobacter acinonychis (strain Sheeba) GN=ilvC PE=3 SV=1 6 298 3.0E-38
sp|Q24XT5|ILVC_DESHY Ketol-acid reductoisomerase OS=Desulfitobacterium hafniense (strain Y51) GN=ilvC PE=3 SV=1 4 298 3.0E-38
sp|B8FU98|ILVC_DESHD Ketol-acid reductoisomerase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=ilvC PE=3 SV=1 4 298 3.0E-38
sp|Q8PH09|ILVC_XANAC Ketol-acid reductoisomerase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ilvC PE=3 SV=1 18 298 4.0E-38
sp|A4G4H8|ILVC_HERAR Ketol-acid reductoisomerase OS=Herminiimonas arsenicoxydans GN=ilvC PE=3 SV=1 5 231 5.0E-38
sp|Q9F7L6|ILVC_PRB01 Ketol-acid reductoisomerase OS=Gamma-proteobacterium EBAC31A08 GN=ilvC PE=3 SV=1 5 300 6.0E-38
sp|Q9PCF9|ILVC_XYLFA Ketol-acid reductoisomerase OS=Xylella fastidiosa (strain 9a5c) GN=ilvC PE=3 SV=2 21 311 7.0E-38
sp|C5C2I2|ILVC_BEUC1 Ketol-acid reductoisomerase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=ilvC PE=3 SV=1 4 314 7.0E-38
sp|Q9FBT8|ILVC2_STRCO Ketol-acid reductoisomerase 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ilvC2 PE=3 SV=1 4 231 7.0E-38
sp|Q87CM2|ILVC_XYLFT Ketol-acid reductoisomerase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ilvC PE=3 SV=1 21 311 7.0E-38
sp|Q2RIS6|ILVC_MOOTA Ketol-acid reductoisomerase OS=Moorella thermoacetica (strain ATCC 39073) GN=ilvC PE=3 SV=1 4 298 8.0E-38
sp|A3DIE1|ILVC_CLOTH Ketol-acid reductoisomerase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=ilvC PE=3 SV=1 4 298 8.0E-38
sp|Q02138|ILVC_LACLA Ketol-acid reductoisomerase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=ilvC PE=3 SV=2 3 306 9.0E-38
sp|A1VE41|ILVC_DESVV Ketol-acid reductoisomerase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ilvC PE=3 SV=1 5 298 1.0E-37
sp|Q72CA6|ILVC_DESVH Ketol-acid reductoisomerase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ilvC PE=3 SV=1 5 298 1.0E-37
sp|A6SZZ1|ILVC_JANMA Ketol-acid reductoisomerase OS=Janthinobacterium sp. (strain Marseille) GN=ilvC PE=3 SV=1 5 298 1.0E-37
sp|Q0KCU2|ILVC_CUPNH Ketol-acid reductoisomerase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ilvC PE=3 SV=1 5 298 1.0E-37
sp|Q473V5|ILVC_CUPPJ Ketol-acid reductoisomerase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ilvC PE=3 SV=1 5 298 1.0E-37
sp|Q82UZ3|ILVC_NITEU Ketol-acid reductoisomerase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ilvC PE=3 SV=1 5 298 1.0E-37
sp|Q1LPX7|ILVC_CUPMC Ketol-acid reductoisomerase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ilvC PE=3 SV=1 5 231 2.0E-37
sp|Q8XXN8|ILVC_RALSO Ketol-acid reductoisomerase OS=Ralstonia solanacearum (strain GMI1000) GN=ilvC PE=3 SV=1 5 231 2.0E-37
sp|C3PFX1|ILVC_CORA7 Ketol-acid reductoisomerase OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=ilvC PE=3 SV=1 8 294 2.0E-37
sp|Q3BPK3|ILVC_XANC5 Ketol-acid reductoisomerase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ilvC PE=3 SV=1 18 298 2.0E-37
sp|A7GMU0|ILVC_BACCN Ketol-acid reductoisomerase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ilvC PE=3 SV=1 4 295 2.0E-37
sp|B2U7S3|ILVC_RALPJ Ketol-acid reductoisomerase OS=Ralstonia pickettii (strain 12J) GN=ilvC PE=3 SV=1 5 231 3.0E-37
sp|A1VN04|ILVC_POLNA Ketol-acid reductoisomerase OS=Polaromonas naphthalenivorans (strain CJ2) GN=ilvC PE=3 SV=1 5 298 4.0E-37
sp|B3R3V4|ILVC_CUPTR Ketol-acid reductoisomerase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=ilvC PE=3 SV=1 5 231 4.0E-37
sp|Q12B50|ILVC_POLSJ Ketol-acid reductoisomerase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=ilvC PE=3 SV=1 5 231 4.0E-37
sp|Q5WEN2|ILVC_BACSK Ketol-acid reductoisomerase OS=Bacillus clausii (strain KSM-K16) GN=ilvC PE=3 SV=1 4 295 4.0E-37
sp|A0RQ02|ILVC_CAMFF Ketol-acid reductoisomerase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=ilvC PE=3 SV=1 6 298 4.0E-37
sp|A5WD25|ILVC_PSYWF Ketol-acid reductoisomerase OS=Psychrobacter sp. (strain PRwf-1) GN=ilvC PE=3 SV=1 6 231 4.0E-37
sp|A4XR11|ILVC_PSEMY Ketol-acid reductoisomerase OS=Pseudomonas mendocina (strain ymp) GN=ilvC PE=3 SV=1 5 231 5.0E-37
sp|Q8CRQ6|ILVC_STAES Ketol-acid reductoisomerase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ilvC PE=3 SV=1 4 334 6.0E-37
sp|Q5HMG0|ILVC_STAEQ Ketol-acid reductoisomerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ilvC PE=3 SV=1 4 334 6.0E-37
sp|C3K225|ILVC_PSEFS Ketol-acid reductoisomerase OS=Pseudomonas fluorescens (strain SBW25) GN=ilvC PE=3 SV=1 5 231 6.0E-37
sp|Q57179|ILVC_CORGL Ketol-acid reductoisomerase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ilvC PE=3 SV=1 5 309 9.0E-37
sp|A4QDN4|ILVC_CORGB Ketol-acid reductoisomerase OS=Corynebacterium glutamicum (strain R) GN=ilvC PE=3 SV=1 5 309 9.0E-37
sp|Q888N4|ILVC_PSESM Ketol-acid reductoisomerase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ilvC PE=3 SV=1 5 231 9.0E-37
sp|B2URB8|ILVC_AKKM8 Ketol-acid reductoisomerase OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ilvC PE=3 SV=1 6 298 1.0E-36
sp|Q4ZY66|ILVC_PSEU2 Ketol-acid reductoisomerase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ilvC PE=3 SV=1 5 231 1.0E-36
sp|Q48N66|ILVC_PSE14 Ketol-acid reductoisomerase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ilvC PE=3 SV=1 5 231 1.0E-36
sp|Q18C83|ILVC_PEPD6 Ketol-acid reductoisomerase OS=Peptoclostridium difficile (strain 630) GN=ilvC PE=3 SV=1 4 295 1.0E-36
sp|Q9Z565|ILVC1_STRCO Ketol-acid reductoisomerase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=ilvC1 PE=3 SV=1 4 231 1.0E-36
sp|Q3K6T1|ILVC_PSEPF Ketol-acid reductoisomerase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ilvC PE=3 SV=1 5 231 1.0E-36
sp|Q4K608|ILVC_PSEF5 Ketol-acid reductoisomerase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ilvC PE=3 SV=1 5 231 1.0E-36
sp|Q63DX9|ILVC1_BACCZ Ketol-acid reductoisomerase 1 OS=Bacillus cereus (strain ZK / E33L) GN=ilvC1 PE=3 SV=1 4 231 1.0E-36
sp|Q2S0M9|ILVC_SALRD Ketol-acid reductoisomerase OS=Salinibacter ruber (strain DSM 13855 / M31) GN=ilvC PE=3 SV=1 6 298 1.0E-36
sp|Q6NHN2|ILVC_CORDI Ketol-acid reductoisomerase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=ilvC PE=3 SV=1 5 232 1.0E-36
sp|C4LJH6|ILVC_CORK4 Ketol-acid reductoisomerase OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=ilvC PE=3 SV=1 5 338 1.0E-36
sp|Q73BA1|ILVC1_BACC1 Ketol-acid reductoisomerase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ilvC1 PE=3 SV=1 4 231 1.0E-36
sp|Q7W566|ILVC_BORPA Ketol-acid reductoisomerase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ilvC PE=3 SV=1 5 298 2.0E-36
sp|Q7WCP6|ILVC_BORBR Ketol-acid reductoisomerase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ilvC PE=3 SV=1 5 298 2.0E-36
sp|Q81T69|ILVC1_BACAN Ketol-acid reductoisomerase 1 OS=Bacillus anthracis GN=ilvC1 PE=3 SV=1 4 231 2.0E-36
sp|P65153|ILVC_STAAW Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain MW2) GN=ilvC PE=3 SV=1 6 304 2.0E-36
sp|Q6GF17|ILVC_STAAR Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain MRSA252) GN=ilvC PE=3 SV=1 6 304 2.0E-36
sp|P65152|ILVC_STAAN Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain N315) GN=ilvC PE=3 SV=1 6 304 2.0E-36
sp|P65151|ILVC_STAAM Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ilvC PE=3 SV=1 6 304 2.0E-36
sp|Q2YUF3|ILVC_STAAB Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ilvC PE=3 SV=1 6 304 2.0E-36
sp|A5IUK2|ILVC_STAA9 Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain JH9) GN=ilvC PE=3 SV=1 6 304 2.0E-36
sp|A6U3E1|ILVC_STAA2 Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain JH1) GN=ilvC PE=3 SV=1 6 304 2.0E-36
sp|A7X4M9|ILVC_STAA1 Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ilvC PE=3 SV=1 6 304 2.0E-36
sp|A0QUX8|ILVC_MYCS2 Ketol-acid reductoisomerase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ilvC PE=1 SV=1 3 294 2.0E-36
sp|Q6HLF4|ILVC1_BACHK Ketol-acid reductoisomerase 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ilvC1 PE=3 SV=1 4 295 2.0E-36
sp|A0Q0E9|ILVC_CLONN Ketol-acid reductoisomerase OS=Clostridium novyi (strain NT) GN=ilvC PE=3 SV=1 4 295 2.0E-36
sp|A4VPI6|ILVC_PSEU5 Ketol-acid reductoisomerase OS=Pseudomonas stutzeri (strain A1501) GN=ilvC PE=3 SV=1 5 231 2.0E-36
sp|Q8EYH2|ILVC_LEPIN Ketol-acid reductoisomerase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=ilvC PE=3 SV=2 4 231 3.0E-36
sp|Q72M00|ILVC_LEPIC Ketol-acid reductoisomerase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=ilvC PE=3 SV=2 4 231 3.0E-36
sp|A8FFW6|ILVC_BACP2 Ketol-acid reductoisomerase OS=Bacillus pumilus (strain SAFR-032) GN=ilvC PE=3 SV=1 5 298 3.0E-36
sp|Q6G7Q2|ILVC_STAAS Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain MSSA476) GN=ilvC PE=3 SV=1 6 304 3.0E-36
sp|Q056H8|ILVC_LEPBL Ketol-acid reductoisomerase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=ilvC PE=3 SV=1 4 231 3.0E-36
sp|Q04P56|ILVC_LEPBJ Ketol-acid reductoisomerase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ilvC PE=3 SV=1 4 231 3.0E-36
sp|A2RKQ6|ILVC_LACLM Ketol-acid reductoisomerase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=ilvC PE=3 SV=1 3 306 4.0E-36
sp|Q3IRQ2|ILVC_NATPD Ketol-acid reductoisomerase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=ilvC PE=3 SV=1 1 298 5.0E-36
sp|A1T6Y9|ILVC_MYCVP Ketol-acid reductoisomerase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ilvC PE=3 SV=1 3 294 6.0E-36
sp|Q7VZU4|ILVC_BORPE Ketol-acid reductoisomerase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ilvC PE=3 SV=1 5 298 6.0E-36
sp|Q12Y03|ILVC_METBU Ketol-acid reductoisomerase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=ilvC PE=3 SV=1 5 298 7.0E-36
sp|B8G7X1|ILVC_CHLAD Ketol-acid reductoisomerase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ilvC PE=3 SV=1 4 321 8.0E-36
sp|Q2KWH7|ILVC_BORA1 Ketol-acid reductoisomerase OS=Bordetella avium (strain 197N) GN=ilvC PE=3 SV=1 5 298 8.0E-36
sp|Q1ILZ3|ILVC_KORVE Ketol-acid reductoisomerase OS=Koribacter versatilis (strain Ellin345) GN=ilvC PE=3 SV=1 4 231 9.0E-36
sp|B3PK17|ILVC_CELJU Ketol-acid reductoisomerase OS=Cellvibrio japonicus (strain Ueda107) GN=ilvC PE=3 SV=1 6 231 9.0E-36
sp|Q81G13|ILVC1_BACCR Ketol-acid reductoisomerase 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ilvC1 PE=3 SV=2 4 231 1.0E-35
sp|O33114|ILVC_MYCLE Ketol-acid reductoisomerase OS=Mycobacterium leprae (strain TN) GN=ilvC PE=3 SV=2 6 279 1.0E-35
sp|B1J2D7|ILVC_PSEPW Ketol-acid reductoisomerase OS=Pseudomonas putida (strain W619) GN=ilvC PE=3 SV=1 5 231 1.0E-35
sp|C0QMX0|ILVC_HELP2 Ketol-acid reductoisomerase OS=Helicobacter pylori (strain P12) GN=ilvC PE=3 SV=1 6 298 1.0E-35
sp|Q88DZ0|ILVC_PSEPK Ketol-acid reductoisomerase OS=Pseudomonas putida (strain KT2440) GN=ilvC PE=3 SV=1 5 231 1.0E-35
sp|B0KHU2|ILVC_PSEPG Ketol-acid reductoisomerase OS=Pseudomonas putida (strain GB-1) GN=ilvC PE=3 SV=1 5 231 1.0E-35
sp|A5W952|ILVC_PSEP1 Ketol-acid reductoisomerase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ilvC PE=3 SV=1 5 231 1.0E-35
sp|A4FMQ5|ILVC_SACEN Ketol-acid reductoisomerase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=ilvC PE=3 SV=1 3 338 2.0E-35
sp|Q18GT4|ILVC_HALWD Ketol-acid reductoisomerase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=ilvC PE=3 SV=3 6 298 2.0E-35
sp|A1TZ11|ILVC_MARHV Ketol-acid reductoisomerase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ilvC PE=3 SV=1 5 231 2.0E-35
sp|Q31HZ1|ILVC_THICR Ketol-acid reductoisomerase OS=Thiomicrospira crunogena (strain XCL-2) GN=ilvC PE=3 SV=1 5 231 2.0E-35
sp|A8Z4V9|ILVC_STAAT Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ilvC PE=3 SV=1 6 304 2.0E-35
sp|A6QIQ2|ILVC_STAAE Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain Newman) GN=ilvC PE=3 SV=1 6 304 2.0E-35
sp|Q5HEE5|ILVC_STAAC Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain COL) GN=ilvC PE=3 SV=1 6 304 2.0E-35
sp|Q2FWK4|ILVC_STAA8 Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain NCTC 8325) GN=ilvC PE=3 SV=1 6 304 2.0E-35
sp|Q2FF68|ILVC_STAA3 Ketol-acid reductoisomerase OS=Staphylococcus aureus (strain USA300) GN=ilvC PE=3 SV=1 6 304 2.0E-35
sp|Q1I4R5|ILVC_PSEE4 Ketol-acid reductoisomerase OS=Pseudomonas entomophila (strain L48) GN=ilvC PE=3 SV=1 5 231 2.0E-35
sp|Q8TJJ4|ILVC_METAC Ketol-acid reductoisomerase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ilvC PE=3 SV=1 4 298 2.0E-35
sp|Q0AGM0|ILVC_NITEC Ketol-acid reductoisomerase OS=Nitrosomonas eutropha (strain C91) GN=ilvC PE=3 SV=1 5 298 3.0E-35
sp|Q65GI7|ILVC_BACLD Ketol-acid reductoisomerase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ilvC PE=3 SV=1 5 298 3.0E-35
sp|Q4L7T9|ILVC_STAHJ Ketol-acid reductoisomerase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ilvC PE=3 SV=1 4 232 3.0E-35
sp|Q1CUH1|ILVC_HELPH Ketol-acid reductoisomerase OS=Helicobacter pylori (strain HPAG1) GN=ilvC PE=3 SV=1 6 298 4.0E-35
sp|Q02YY8|ILVC_LACLS Ketol-acid reductoisomerase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=ilvC PE=3 SV=1 3 306 4.0E-35
sp|Q1ARE4|ILVC_RUBXD Ketol-acid reductoisomerase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ilvC PE=3 SV=1 4 298 4.0E-35
sp|A7NJH8|ILVC_ROSCS Ketol-acid reductoisomerase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=ilvC PE=3 SV=1 4 325 5.0E-35
sp|B2USG1|ILVC_HELPS Ketol-acid reductoisomerase OS=Helicobacter pylori (strain Shi470) GN=ilvC PE=3 SV=1 6 298 5.0E-35
sp|B9LGM7|ILVC_CHLSY Ketol-acid reductoisomerase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=ilvC PE=3 SV=1 4 298 5.0E-35
sp|A9WC26|ILVC_CHLAA Ketol-acid reductoisomerase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=ilvC PE=3 SV=1 4 298 5.0E-35
sp|A7Z7B9|ILVC_BACMF Ketol-acid reductoisomerase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ilvC PE=3 SV=1 5 298 5.0E-35
sp|O25097|ILVC_HELPY Ketol-acid reductoisomerase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ilvC PE=3 SV=1 6 298 5.0E-35
sp|Q0AV19|ILVC_SYNWW Ketol-acid reductoisomerase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=ilvC PE=3 SV=1 4 295 6.0E-35
sp|C5BQZ6|ILVC_TERTT Ketol-acid reductoisomerase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ilvC PE=3 SV=1 5 231 7.0E-35
sp|Q9ZMA9|ILVC_HELPJ Ketol-acid reductoisomerase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ilvC PE=3 SV=1 6 298 1.0E-34
sp|Q46FY8|ILVC_METBF Ketol-acid reductoisomerase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=ilvC PE=3 SV=1 4 298 1.0E-34
sp|Q03UU4|ILVC_LEUMM Ketol-acid reductoisomerase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=ilvC PE=3 SV=1 3 307 1.0E-34
sp|Q7UKY0|ILVC_RHOBA Ketol-acid reductoisomerase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ilvC PE=3 SV=1 3 231 2.0E-34
sp|Q1BAR7|ILVC_MYCSS Ketol-acid reductoisomerase OS=Mycobacterium sp. (strain MCS) GN=ilvC PE=3 SV=1 3 314 2.0E-34
sp|A1UE95|ILVC_MYCSK Ketol-acid reductoisomerase OS=Mycobacterium sp. (strain KMS) GN=ilvC PE=3 SV=1 3 314 2.0E-34
sp|A3PXP9|ILVC_MYCSJ Ketol-acid reductoisomerase OS=Mycobacterium sp. (strain JLS) GN=ilvC PE=3 SV=1 3 314 2.0E-34
sp|C1F6Z5|ILVC_ACIC5 Ketol-acid reductoisomerase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ilvC PE=3 SV=1 4 231 2.0E-34
sp|Q0VSB5|ILVC_ALCBS Ketol-acid reductoisomerase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ilvC PE=3 SV=2 5 231 2.0E-34
sp|A4TE07|ILVC_MYCGI Ketol-acid reductoisomerase OS=Mycobacterium gilvum (strain PYR-GCK) GN=ilvC PE=3 SV=1 3 294 3.0E-34
sp|B1HR99|ILVC_LYSSC Ketol-acid reductoisomerase OS=Lysinibacillus sphaericus (strain C3-41) GN=ilvC PE=3 SV=1 4 295 4.0E-34
sp|A6TTL2|ILVC_ALKMQ Ketol-acid reductoisomerase OS=Alkaliphilus metalliredigens (strain QYMF) GN=ilvC PE=3 SV=1 4 298 4.0E-34
sp|Q2SZP8|ILVC_BURTA Ketol-acid reductoisomerase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ilvC PE=3 SV=1 5 298 5.0E-34
sp|Q8PZ26|ILVC_METMA Ketol-acid reductoisomerase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=ilvC PE=3 SV=1 4 298 1.0E-33
sp|Q21T70|ILVC_RHOFT Ketol-acid reductoisomerase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ilvC PE=3 SV=1 5 231 1.0E-33
sp|Q21HN0|ILVC_SACD2 Ketol-acid reductoisomerase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ilvC PE=3 SV=1 5 231 1.0E-33
sp|B2JDN9|ILVC_BURP8 Ketol-acid reductoisomerase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ilvC PE=3 SV=1 5 298 2.0E-33
sp|Q63VP6|ILVC_BURPS Ketol-acid reductoisomerase OS=Burkholderia pseudomallei (strain K96243) GN=ilvC PE=3 SV=1 5 298 3.0E-33
sp|A3N7K4|ILVC_BURP6 Ketol-acid reductoisomerase OS=Burkholderia pseudomallei (strain 668) GN=ilvC PE=3 SV=1 5 298 3.0E-33
sp|Q3JUC2|ILVC_BURP1 Ketol-acid reductoisomerase OS=Burkholderia pseudomallei (strain 1710b) GN=ilvC PE=3 SV=1 5 298 3.0E-33
sp|A3NT91|ILVC_BURP0 Ketol-acid reductoisomerase OS=Burkholderia pseudomallei (strain 1106a) GN=ilvC PE=3 SV=1 5 298 3.0E-33
sp|A1V2K2|ILVC_BURMS Ketol-acid reductoisomerase OS=Burkholderia mallei (strain SAVP1) GN=ilvC PE=3 SV=1 5 298 3.0E-33
sp|Q62IM0|ILVC_BURMA Ketol-acid reductoisomerase OS=Burkholderia mallei (strain ATCC 23344) GN=ilvC PE=3 SV=1 5 298 3.0E-33
sp|A2S472|ILVC_BURM9 Ketol-acid reductoisomerase OS=Burkholderia mallei (strain NCTC 10229) GN=ilvC PE=3 SV=1 5 298 3.0E-33
sp|A3MI87|ILVC_BURM7 Ketol-acid reductoisomerase OS=Burkholderia mallei (strain NCTC 10247) GN=ilvC PE=3 SV=1 5 298 3.0E-33
sp|P37253|ILVC_BACSU Ketol-acid reductoisomerase OS=Bacillus subtilis (strain 168) GN=ilvC PE=1 SV=1 5 298 3.0E-33
sp|B9M5B1|ILVC_GEODF Ketol-acid reductoisomerase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=ilvC PE=3 SV=1 6 298 7.0E-33
sp|B2T2D1|ILVC_BURPP Ketol-acid reductoisomerase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=ilvC PE=3 SV=1 5 231 2.0E-32
sp|Q0BDB6|ILVC_BURCM Ketol-acid reductoisomerase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ilvC PE=3 SV=1 6 298 3.0E-32
sp|B1YTS0|ILVC_BURA4 Ketol-acid reductoisomerase OS=Burkholderia ambifaria (strain MC40-6) GN=ilvC PE=3 SV=1 6 298 3.0E-32
[Show less]

GO

GO Term Description Terminal node
GO:0004455 ketol-acid reductoisomerase activity Yes
GO:0009082 branched-chain amino acid biosynthetic process Yes
GO:0050661 NADP binding Yes
GO:0006520 cellular amino acid metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0009058 biosynthetic process No
GO:1901363 heterocyclic compound binding No
GO:0044283 small molecule biosynthetic process No
GO:0036094 small molecule binding No
GO:0016053 organic acid biosynthetic process No
GO:0000166 nucleotide binding No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043436 oxoacid metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0044238 primary metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0016491 oxidoreductase activity No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0044249 cellular biosynthetic process No
GO:0009081 branched-chain amino acid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006150
MPSAKIYYDSDVDFGLLTGKQIVFLGFGNQGAAQALNLRDSGIPNDKICIANRDDSYAEDAKAKGFTVEHNFEKA
ASLADVLFILIPDQVQPKLFNNTILPHLKDDVTIVVASGYNVFFKLLQFKPKQNVVMVAPRMIGSSVRSLYEKGK
GFPCFVSVEQDGSGNGLQVALAICKAIGATKAGAIASSAREETIMDLLAEQALWPNIIMLFREAFEVLQKAGCSD
EALCYEMWMSKEPAEIFERAADEGFITQLKHHSTCSQFGQLNGALKLNGETAKRHFEDILYNQILSGKFSAEFSN
LEDDFEKEGDQNPLNRLYDRASDSALGQAEKRVRARLADLLK*
Coding >AgabiH97|006150
ATGCCTTCAGCGAAGATCTATTACGACTCAGATGTCGACTTTGGGCTGTTGACCGGAAAGCAAATAGTGTTCCTT
GGTTTTGGAAATCAGGGCGCCGCCCAAGCCTTGAATCTCAGGGACTCTGGAATCCCCAACGATAAGATATGCATT
GCCAACCGAGATGACTCGTATGCAGAAGATGCGAAAGCCAAGGGTTTTACTGTTGAACATAATTTTGAAAAGGCT
GCGTCTCTCGCGGATGTGTTGTTCATCCTCATCCCGGATCAGGTGCAACCCAAATTGTTCAATAACACCATCTTG
CCCCACTTGAAGGACGATGTTACAATTGTTGTAGCCAGCGGATACAATGTTTTCTTCAAGTTGCTTCAATTCAAA
CCAAAGCAGAACGTTGTGATGGTTGCCCCTAGAATGATTGGGTCGTCGGTGCGCTCTTTGTACGAGAAAGGGAAA
GGCTTTCCTTGTTTCGTTTCGGTCGAGCAAGATGGCTCGGGAAATGGGCTTCAAGTCGCGCTCGCCATTTGTAAA
GCAATCGGCGCCACTAAAGCAGGAGCAATCGCGTCCTCTGCTCGAGAAGAGACTATCATGGATTTATTGGCGGAG
CAAGCTTTGTGGCCCAACATCATCATGCTGTTCAGAGAGGCCTTTGAAGTCCTCCAGAAAGCCGGGTGCTCAGAC
GAGGCATTGTGTTATGAAATGTGGATGTCCAAAGAGCCAGCAGAGATATTCGAACGCGCTGCTGATGAAGGGTTC
ATTACTCAGCTCAAACACCATTCGACCTGCTCACAGTTTGGTCAACTGAACGGCGCATTGAAGTTAAACGGAGAG
ACCGCAAAGCGTCACTTCGAGGATATCTTGTACAATCAGATTTTGAGCGGAAAATTCTCCGCTGAATTCTCCAAT
CTTGAAGACGATTTTGAAAAGGAAGGCGACCAGAACCCTTTGAACAGATTGTATGATCGCGCCAGCGATTCAGCC
CTCGGACAGGCAGAGAAAAGAGTTCGGGCTCGTTTAGCAGATTTATTGAAGTAG
Transcript >AgabiH97|006150
ATGCCTTCAGCGAAGATCTATTACGACTCAGATGTCGACTTTGGGCTGTTGACCGGAAAGCAAATAGTGTTCCTT
GGTTTTGGAAATCAGGGCGCCGCCCAAGCCTTGAATCTCAGGGACTCTGGAATCCCCAACGATAAGATATGCATT
GCCAACCGAGATGACTCGTATGCAGAAGATGCGAAAGCCAAGGGTTTTACTGTTGAACATAATTTTGAAAAGGCT
GCGTCTCTCGCGGATGTGTTGTTCATCCTCATCCCGGATCAGGTGCAACCCAAATTGTTCAATAACACCATCTTG
CCCCACTTGAAGGACGATGTTACAATTGTTGTAGCCAGCGGATACAATGTTTTCTTCAAGTTGCTTCAATTCAAA
CCAAAGCAGAACGTTGTGATGGTTGCCCCTAGAATGATTGGGTCGTCGGTGCGCTCTTTGTACGAGAAAGGGAAA
GGCTTTCCTTGTTTCGTTTCGGTCGAGCAAGATGGCTCGGGAAATGGGCTTCAAGTCGCGCTCGCCATTTGTAAA
GCAATCGGCGCCACTAAAGCAGGAGCAATCGCGTCCTCTGCTCGAGAAGAGACTATCATGGATTTATTGGCGGAG
CAAGCTTTGTGGCCCAACATCATCATGCTGTTCAGAGAGGCCTTTGAAGTCCTCCAGAAAGCCGGGTGCTCAGAC
GAGGCATTGTGTTATGAAATGTGGATGTCCAAAGAGCCAGCAGAGATATTCGAACGCGCTGCTGATGAAGGGTTC
ATTACTCAGCTCAAACACCATTCGACCTGCTCACAGTTTGGTCAACTGAACGGCGCATTGAAGTTAAACGGAGAG
ACCGCAAAGCGTCACTTCGAGGATATCTTGTACAATCAGATTTTGAGCGGAAAATTCTCCGCTGAATTCTCCAAT
CTTGAAGACGATTTTGAAAAGGAAGGCGACCAGAACCCTTTGAACAGATTGTATGATCGCGCCAGCGATTCAGCC
CTCGGACAGGCAGAGAAAAGAGTTCGGGCTCGTTTAGCAGATTTATTGAAGTAG
Gene >AgabiH97|006150
ATGCCTTCAGCGAAGATGTGAGTGATTTGGCCGTTTACAACTAGAACCTCATGGTTGACTATGAAGGCTCGCAGC
TATTACGACTCAGATGTCGACTTTGGGCTGTTGACCGGAAAGCAAATAGTGTTCCTTGGGTGAACTACACCTGTT
TCAAGATTGTCATACATATCCTCATAATAGTCGCCTCAGTTTTGGAAATCAGGGCGCCGCCCAAGCCTTGAATCT
CAGGGACTCTGGAATCCCCAACGATAAGATATGCATTGCCAACCGAGATGACTCGTATGCAGAAGATGCGAAAGC
CAAGGGTTTTACTGTTGAACATAATTTTGAAAAGGCTGCGTCTCTCGCGGATGGTCAATCTGTTTCCACGTATAG
ATCGTATGCCAGGAGACTGATGTTGTCGTATTCTAGTGTTGTTCATCCTCATCCCGGATCAGGTGCAACCCAAAT
TGTTCAATAACACCATCTTGCCCCACTTGAAGGACGATGTTACAATTGTTGTAGCCAGCGGATACAATGTTTTCT
TCAAGTTGCTTCAATTCAAACCAAAGCAGAACGTTGTGATGGTTGCCCCTAGGTTTGCCCAAACCCTATTTGAAA
CGAATTCATGACCGTAACCTGCACGACAGAATGATTGGGTCGTCGGTGCGCTCTTTGTACGAGAAAGGGAAAGGC
TTTCCTTGTTTCGTTTCGGTCGAGCAAGATGGCTCGGGAAATGGGCTTCAAGTCGCGCTCGCCATTTGTAAAGCA
ATCGGCGCCACTAAAGCAGGAGCAATCGCGTCCTCTGCTCGAGAAGAGACTATCATGGATTTATTGGCGGGTAAA
GATTATTGTCTGCACAAACTCGACATTTCACTGATGTCGATGTTCCAGAGCAAGCTTTGTGGCCCAACATCATCA
TGCTGTTCAGGTCAGAGATTTGGTATTGCATGTTTCGATGAAGTTGACTGTTGAACGCGTTATAGAGAGGCCTTT
GAAGTCCTCCAGAAAGCCGGGTGCTCAGACGAGGCATTGTGTTATGAAATGTGGGAATATTTCTTCTCCTAGCTG
CATGAGGCCAACGTCATTTCAGGTGGATGTCCAAAGAGCCAGCAGAGATATTCGAACGCGCTGCTGATGAAGGGT
TCATTACTCAGGTAGACAATCTCACTATGGGTTTGGGACGCGGCCTGATGCATCGCCATAACAGCTCAAACACCA
TTCGACCTGCTCACAGTTTGGTCAACTGAACGGCGCATTGAAGTTAAACGGAGAGACCGCAAAGCGTCACTTCGA
GGATATCTTGTACAATCAGGTATGAAGTATTCGAGATTGCTTACTTGCTACTTGACCACCATATTTCAAGATTTT
GAGCGGAAAATTCTCCGCTGAATTCTCCAATCTTGAAGACGATTTTGAAAAGGAAGGCGACCAGAACCCTTTGAA
CAGATTGTATGATCGCGCCAGCGATTCAGCCCTCGGACAGGCAGAGAAAAGAGTTCGGGCTCGTTTAGCAGATTT
ATTGAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail