Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006060
Gene name
Locationscaffold_1:1480410..1481449
Strand+
Gene length (bp)1039
Transcript length (bp)888
Coding sequence length (bp)888
Protein length (aa) 296

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14938 SNAP Soluble NSF attachment protein, SNAP 1.4E-106 7 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P78603|SEC17_COPC7 Vesicular-fusion protein SEC17 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=SEC17 PE=3 SV=2 1 287 3.0E-149
sp|Q9P6A5|SEC17_NEUCR Probable vesicular-fusion protein sec17 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B1D1.150 PE=3 SV=1 8 288 2.0E-58
sp|Q9P4X4|SEC17_SCHPO Probable vesicular-fusion protein sec17 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec17 PE=1 SV=1 6 284 6.0E-58
sp|Q75D68|SEC17_ASHGO Vesicular-fusion protein SEC17 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC17 PE=3 SV=1 5 282 6.0E-54
sp|P32602|SEC17_YEAST Alpha-soluble NSF attachment protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC17 PE=1 SV=4 10 284 1.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P78603|SEC17_COPC7 Vesicular-fusion protein SEC17 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=SEC17 PE=3 SV=2 1 287 3.0E-149
sp|Q9P6A5|SEC17_NEUCR Probable vesicular-fusion protein sec17 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B1D1.150 PE=3 SV=1 8 288 2.0E-58
sp|Q9P4X4|SEC17_SCHPO Probable vesicular-fusion protein sec17 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec17 PE=1 SV=1 6 284 6.0E-58
sp|Q75D68|SEC17_ASHGO Vesicular-fusion protein SEC17 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC17 PE=3 SV=1 5 282 6.0E-54
sp|P32602|SEC17_YEAST Alpha-soluble NSF attachment protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC17 PE=1 SV=4 10 284 1.0E-53
sp|Q23983|SNAP_DROME Alpha-soluble NSF attachment protein OS=Drosophila melanogaster GN=alphaSnap PE=1 SV=1 10 280 1.0E-51
sp|Q9P4D0|SEC17_PICPG Vesicular-fusion protein SEC17 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SEC17 PE=3 SV=2 5 282 5.0E-50
sp|P93798|SNAA_VITVI Alpha-soluble NSF attachment protein OS=Vitis vinifera PE=2 SV=1 22 283 1.0E-48
sp|Q54NP6|SNAA_DICDI Alpha-soluble NSF attachment protein OS=Dictyostelium discoideum GN=snpA PE=1 SV=1 1 286 3.0E-48
sp|P28663|SNAB_MOUSE Beta-soluble NSF attachment protein OS=Mus musculus GN=Napb PE=1 SV=2 10 288 4.0E-47
sp|Q9H115|SNAB_HUMAN Beta-soluble NSF attachment protein OS=Homo sapiens GN=NAPB PE=1 SV=2 10 288 4.0E-47
sp|Q9SPE6|SNAA2_ARATH Alpha-soluble NSF attachment protein 2 OS=Arabidopsis thaliana GN=ASNAP2 PE=1 SV=1 22 283 5.0E-47
sp|Q9DB05|SNAA_MOUSE Alpha-soluble NSF attachment protein OS=Mus musculus GN=Napa PE=1 SV=1 16 283 1.0E-46
sp|P81125|SNAA_BOVIN Alpha-soluble NSF attachment protein OS=Bos taurus GN=NAPA PE=1 SV=1 16 283 2.0E-46
sp|P81126|SNAB_BOVIN Beta-soluble NSF attachment protein OS=Bos taurus GN=NAPB PE=1 SV=1 10 288 2.0E-46
sp|P54920|SNAA_HUMAN Alpha-soluble NSF attachment protein OS=Homo sapiens GN=NAPA PE=1 SV=3 16 283 2.0E-46
sp|P54921|SNAA_RAT Alpha-soluble NSF attachment protein OS=Rattus norvegicus GN=Napa PE=1 SV=2 16 283 2.0E-46
sp|Q9M5P8|SNAA_SOLTU Alpha-soluble NSF attachment protein OS=Solanum tuberosum PE=2 SV=1 12 283 3.0E-45
sp|P85969|SNAB_RAT Beta-soluble NSF attachment protein OS=Rattus norvegicus GN=Napb PE=1 SV=1 10 288 3.0E-45
sp|O90758|V033_FOWPN Soluble NSF attachment protein homolog FPV033 OS=Fowlpox virus (strain NVSL) GN=SNAP PE=3 SV=1 33 283 2.0E-25
sp|Q9J5J0|V011_FOWPN Soluble NSF attachment protein homolog FPV011 OS=Fowlpox virus (strain NVSL) GN=FPV011 PE=3 SV=1 30 280 8.0E-20
sp|Q9LXZ5|SNAA1_ARATH Alpha-soluble NSF attachment protein 1 OS=Arabidopsis thaliana GN=ASNAP1 PE=1 SV=1 12 267 7.0E-19
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006060
MPAKSPAQVLLEKADKKANSSTGWFSSASTKFEEAGDLYQQAANNFKIEKLFKEAGDTFAREAECREKCNEANEA
GNAWWNAAKAYKKTHPDLAIQALTQTITHLTKLGRFRQAADREKEIGQIYLQEFHDLGKACDSFVQAGDWYAQED
AAATANACYKEAADLLADLGQYTQAIARYEHVADHSLTSALTKYSVKEYWLRAGLCALALNDVVTVRRNMTKYGS
QDTTFLSTREAKFVNALAEAVDAADAEMFTGAVVEFDSVTKLDNWKTSILLKIKREIEQPSGESAWGGLT*
Coding >AgabiH97|006060
ATGCCCGCCAAATCGCCTGCGCAGGTCCTTCTTGAAAAGGCAGACAAGAAGGCAAATTCTTCTACAGGATGGTTC
TCTTCTGCGTCGACCAAATTTGAGGAAGCCGGCGACCTCTACCAACAGGCAGCCAACAACTTCAAGATCGAGAAG
CTCTTCAAGGAGGCTGGAGATACCTTTGCCCGTGAAGCAGAGTGTCGAGAGAAGTGCAATGAAGCGAACGAAGCT
GGTAATGCTTGGTGGAACGCAGCCAAGGCATACAAGAAGACTCACCCGGACCTCGCCATTCAGGCGCTGACACAA
ACCATCACTCACCTCACCAAGTTGGGCCGCTTCAGGCAAGCAGCGGATCGTGAAAAGGAAATTGGACAGATCTAC
TTGCAGGAATTCCATGACCTTGGAAAAGCCTGTGATAGTTTCGTTCAAGCCGGTGACTGGTACGCCCAAGAGGAC
GCCGCAGCAACGGCCAATGCTTGTTATAAGGAAGCAGCAGATCTATTGGCCGATTTGGGCCAGTATACCCAAGCC
ATTGCACGTTACGAACATGTCGCCGATCATTCACTTACTTCGGCTTTGACCAAGTATAGTGTCAAAGAGTATTGG
TTGCGGGCAGGTCTTTGCGCACTGGCCCTGAACGACGTTGTGACGGTCAGACGAAACATGACGAAGTATGGAAGT
CAGGATACCACGTTCCTAAGTACGCGAGAAGCCAAGTTTGTTAACGCACTGGCGGAGGCAGTGGACGCGGCAGAT
GCAGAAATGTTTACGGGCGCTGTTGTGGAGTTTGACTCGGTGACGAAGCTTGATAATTGGAAAACAAGCATTTTG
CTGAAGATCAAACGAGAAATTGAACAGCCTTCTGGTGAATCTGCTTGGGGAGGACTTACTTGA
Transcript >AgabiH97|006060
ATGCCCGCCAAATCGCCTGCGCAGGTCCTTCTTGAAAAGGCAGACAAGAAGGCAAATTCTTCTACAGGATGGTTC
TCTTCTGCGTCGACCAAATTTGAGGAAGCCGGCGACCTCTACCAACAGGCAGCCAACAACTTCAAGATCGAGAAG
CTCTTCAAGGAGGCTGGAGATACCTTTGCCCGTGAAGCAGAGTGTCGAGAGAAGTGCAATGAAGCGAACGAAGCT
GGTAATGCTTGGTGGAACGCAGCCAAGGCATACAAGAAGACTCACCCGGACCTCGCCATTCAGGCGCTGACACAA
ACCATCACTCACCTCACCAAGTTGGGCCGCTTCAGGCAAGCAGCGGATCGTGAAAAGGAAATTGGACAGATCTAC
TTGCAGGAATTCCATGACCTTGGAAAAGCCTGTGATAGTTTCGTTCAAGCCGGTGACTGGTACGCCCAAGAGGAC
GCCGCAGCAACGGCCAATGCTTGTTATAAGGAAGCAGCAGATCTATTGGCCGATTTGGGCCAGTATACCCAAGCC
ATTGCACGTTACGAACATGTCGCCGATCATTCACTTACTTCGGCTTTGACCAAGTATAGTGTCAAAGAGTATTGG
TTGCGGGCAGGTCTTTGCGCACTGGCCCTGAACGACGTTGTGACGGTCAGACGAAACATGACGAAGTATGGAAGT
CAGGATACCACGTTCCTAAGTACGCGAGAAGCCAAGTTTGTTAACGCACTGGCGGAGGCAGTGGACGCGGCAGAT
GCAGAAATGTTTACGGGCGCTGTTGTGGAGTTTGACTCGGTGACGAAGCTTGATAATTGGAAAACAAGCATTTTG
CTGAAGATCAAACGAGAAATTGAACAGCCTTCTGGTGAATCTGCTTGGGGAGGACTTACTTGA
Gene >AgabiH97|006060
ATGCCCGCCAAATCGCCTGCGCAGGTCCTTCTTGAAAAGGCAGACAAGAAGGCAAATTCTTCTACAGGATGGTTC
TCTTCTGCGTCGACCAAATTTGAGGAAGCCGGCGACCTCTACCAACAGGCAGCCAACAACTTCAAGATCGAGAAG
CTCTTCAAGGAGGCTGGAGATACCTTTGCCCGTGAAGCAGAGTGTCGAGAGAAGTGCAATGAAGCGAACGAAGCT
GGTAATGCTTGGTGGAACGCAGCCAAGGCATACAAGAAGACTCACCCGGACCGTGCGCACTGTTCATTGTTTGAT
GTAACACTCTTCCCCTCTCATCCAAATTTTAGTCGCCATTCAGGCGCTGACACAAACCATCACTCACCTCACCAA
GTTGGGCCGCTTCAGGCAAGCAGCGGATCGTGAAAAGGAAATTGGACAGATCTACTTGCAGGAATTCCATGACCT
TGGAAAAGCCTGTGATAGTTTCGTTCAAGCCGGTGACTGGTACGCCCAAGAGGACGCCGCAGCGCAAGTTCTTTA
TATTCTCTGCTGTTTCAAAGCTGATGATGCGAATAGAACGGCCAATGCTTGTTATAAGGAAGCAGCAGATCTATT
GGCCGATTTGGGCCAGTATACCCAAGCCATTGCACGTTACGAACATGTCGCCGATCATTCACTTACTTCGGCTTT
GACCAAGTATAGTGTCAAAGAGTATTGGTTGCGGGCAGGTCTTTGCGCACTGGCCCTGAACGTGAGGGATTTTGT
TTTGACGTGGTGACAGTTTCTCAATTCTATAAAGGACGTTGTGACGGTCAGACGAAACATGACGAAGTATGGAAG
TCAGGATACCACGTTCCTAAGTACGCGAGAAGCCAAGTTTGTTAACGCACTGGCGGAGGCAGTGGACGCGGCAGA
TGCAGAAATGTTTACGGGCGCTGTTGTGGAGTTTGACTCGGTGACGAAGCTTGATAATTGGAAAACAAGCATTTT
GCTGAAGATCAAACGAGAAATTGAACAGCCTTCTGGTGAATCTGCTTGGGGAGGACTTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail