Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006050
Gene name
Locationscaffold_1:1478383..1480284
Strand-
Gene length (bp)1901
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 8.1E-08 53 98
PF02878 PGM_PMM_I Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I 3.3E-08 102 175
PF00408 PGM_PMM_IV Phosphoglucomutase/phosphomannomutase, C-terminal domain 5.8E-11 453 526

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|F1RQM2|AGM1_PIG Phosphoacetylglucosamine mutase OS=Sus scrofa GN=PGM3 PE=1 SV=2 3 539 6.0E-168
sp|O95394|AGM1_HUMAN Phosphoacetylglucosamine mutase OS=Homo sapiens GN=PGM3 PE=1 SV=1 3 539 3.0E-162
sp|Q9CYR6|AGM1_MOUSE Phosphoacetylglucosamine mutase OS=Mus musculus GN=Pgm3 PE=1 SV=1 3 544 1.0E-160
sp|Q9P4V2|AGM1_CANAX Phosphoacetylglucosamine mutase OS=Candida albicans GN=AGM1 PE=1 SV=1 15 529 4.0E-157
sp|Q09770|AGM2_SCHPO Phosphoacetylglucosamine mutase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1296.01c PE=1 SV=2 12 530 1.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|F1RQM2|AGM1_PIG Phosphoacetylglucosamine mutase OS=Sus scrofa GN=PGM3 PE=1 SV=2 3 539 6.0E-168
sp|O95394|AGM1_HUMAN Phosphoacetylglucosamine mutase OS=Homo sapiens GN=PGM3 PE=1 SV=1 3 539 3.0E-162
sp|Q9CYR6|AGM1_MOUSE Phosphoacetylglucosamine mutase OS=Mus musculus GN=Pgm3 PE=1 SV=1 3 544 1.0E-160
sp|Q9P4V2|AGM1_CANAX Phosphoacetylglucosamine mutase OS=Candida albicans GN=AGM1 PE=1 SV=1 15 529 4.0E-157
sp|Q09770|AGM2_SCHPO Phosphoacetylglucosamine mutase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1296.01c PE=1 SV=2 12 530 1.0E-148
sp|Q09687|AGM1_SCHPO Phosphoacetylglucosamine mutase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13C5.05c PE=1 SV=1 22 529 8.0E-146
sp|P38628|AGM1_YEAST Phosphoacetylglucosamine mutase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCM1 PE=1 SV=2 1 512 1.0E-135
sp|P57750|AGM1_ARATH Phosphoacetylglucosamine mutase OS=Arabidopsis thaliana GN=DRT101 PE=1 SV=1 12 529 3.0E-133
sp|Q6ZDQ1|AGM1_ORYSJ Phosphoacetylglucosamine mutase OS=Oryza sativa subsp. japonica GN=Os07g0195400 PE=2 SV=1 16 526 6.0E-129
sp|Q8SSL7|AGM1_ENCCU Probable phosphoacetylglucosamine mutase OS=Encephalitozoon cuniculi (strain GB-M1) GN=PCM1 PE=1 SV=1 5 535 7.0E-80
sp|B2UYH3|GLMM_CLOBA Phosphoglucosamine mutase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=glmM PE=3 SV=1 123 529 4.0E-19
sp|B2TIN7|GLMM_CLOBB Phosphoglucosamine mutase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=glmM PE=3 SV=1 123 529 8.0E-18
sp|A2RIG0|GLMM_LACLM Phosphoglucosamine mutase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=glmM PE=3 SV=1 41 519 2.0E-16
sp|Q031P2|GLMM_LACLS Phosphoglucosamine mutase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=glmM PE=3 SV=1 41 534 3.0E-16
sp|C3KVJ0|GLMM_CLOB6 Phosphoglucosamine mutase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=glmM PE=3 SV=1 123 529 5.0E-16
sp|A1A2Z2|GLMM_BIFAA Phosphoglucosamine mutase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=glmM PE=3 SV=1 128 532 6.0E-16
sp|Q18CL0|GLMM_PEPD6 Phosphoglucosamine mutase OS=Peptoclostridium difficile (strain 630) GN=glmM PE=3 SV=2 127 532 7.0E-16
sp|C1FMP0|GLMM_CLOBJ Phosphoglucosamine mutase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=glmM PE=3 SV=1 121 529 7.0E-16
sp|B1IG08|GLMM_CLOBK Phosphoglucosamine mutase OS=Clostridium botulinum (strain Okra / Type B1) GN=glmM PE=3 SV=1 121 529 9.0E-16
sp|A5N4Y9|GLMM_CLOK5 Phosphoglucosamine mutase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=glmM PE=3 SV=1 3 529 1.0E-15
sp|B9DYJ3|GLMM_CLOK1 Phosphoglucosamine mutase OS=Clostridium kluyveri (strain NBRC 12016) GN=glmM PE=3 SV=1 3 529 1.0E-15
sp|Q821Z6|GLMM_CHLCV Phosphoglucosamine mutase OS=Chlamydophila caviae (strain GPIC) GN=glmM PE=3 SV=1 124 534 2.0E-15
sp|B1KSG4|GLMM_CLOBM Phosphoglucosamine mutase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=glmM PE=3 SV=1 121 529 3.0E-15
sp|A5I7E5|GLMM_CLOBH Phosphoglucosamine mutase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=glmM PE=3 SV=1 97 529 4.0E-15
sp|A7FZ14|GLMM_CLOB1 Phosphoglucosamine mutase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=glmM PE=3 SV=1 97 529 4.0E-15
sp|B7GUF2|GLMM_BIFLS Phosphoglucosamine mutase OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=glmM PE=3 SV=1 128 532 4.0E-15
sp|B1I1Y5|GLMM_DESAP Phosphoglucosamine mutase OS=Desulforudis audaxviator (strain MP104C) GN=glmM PE=3 SV=2 97 512 5.0E-15
sp|Q8G533|GLMM_BIFLO Phosphoglucosamine mutase OS=Bifidobacterium longum (strain NCC 2705) GN=glmM PE=3 SV=1 128 532 6.0E-15
sp|B3DTC2|GLMM_BIFLD Phosphoglucosamine mutase OS=Bifidobacterium longum (strain DJO10A) GN=glmM PE=3 SV=1 128 532 6.0E-15
sp|Q9KG46|GLMM_BACHD Phosphoglucosamine mutase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=glmM PE=3 SV=1 97 534 7.0E-15
sp|A6TW06|GLMM_ALKMQ Phosphoglucosamine mutase OS=Alkaliphilus metalliredigens (strain QYMF) GN=glmM PE=3 SV=1 97 534 1.0E-14
sp|B9K6U6|GLMM_THENN Phosphoglucosamine mutase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=glmM PE=3 SV=1 127 526 1.0E-14
sp|Q5WLG9|GLMM_BACSK Phosphoglucosamine mutase OS=Bacillus clausii (strain KSM-K16) GN=glmM PE=3 SV=1 97 534 2.0E-14
sp|B1N017|GLMM_LEUCK Phosphoglucosamine mutase OS=Leuconostoc citreum (strain KM20) GN=glmM PE=3 SV=1 120 533 2.0E-14
sp|B8DWH9|GLMM_BIFA0 Phosphoglucosamine mutase OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=glmM PE=3 SV=1 128 532 2.0E-14
sp|A7GJ15|GLMM_CLOBL Phosphoglucosamine mutase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=glmM PE=3 SV=1 121 529 2.0E-14
sp|Q03VW4|GLMM_LEUMM Phosphoglucosamine mutase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=glmM PE=3 SV=1 120 534 4.0E-14
sp|Q1WSZ9|GLMM_LACS1 Phosphoglucosamine mutase OS=Lactobacillus salivarius (strain UCC118) GN=glmM PE=3 SV=1 121 534 7.0E-14
sp|Q9CID9|GLMM_LACLA Phosphoglucosamine mutase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glmM PE=3 SV=1 127 534 2.0E-13
sp|A6LPX0|GLMM_CLOB8 Phosphoglucosamine mutase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=glmM PE=3 SV=1 123 529 2.0E-13
sp|C0MDT1|GLMM_STRS7 Phosphoglucosamine mutase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=glmM PE=3 SV=1 120 536 3.0E-13
sp|Q5L588|GLMM_CHLAB Phosphoglucosamine mutase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=glmM PE=3 SV=1 124 534 4.0E-13
sp|A8M4B8|GLMM_SALAI Phosphoglucosamine mutase OS=Salinispora arenicola (strain CNS-205) GN=glmM PE=3 SV=1 41 529 4.0E-13
sp|B8GNY2|GLMM_THISH Phosphoglucosamine mutase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=glmM PE=3 SV=1 126 526 4.0E-13
sp|A0PXZ6|GLMM_CLONN Phosphoglucosamine mutase OS=Clostridium novyi (strain NT) GN=glmM PE=3 SV=1 61 533 6.0E-13
sp|A8YUF8|GLMM_LACH4 Phosphoglucosamine mutase OS=Lactobacillus helveticus (strain DPC 4571) GN=glmM PE=3 SV=1 125 534 7.0E-13
sp|Q042H3|GLMM_LACGA Phosphoglucosamine mutase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=glmM PE=3 SV=1 125 519 7.0E-13
sp|A7GK66|GLMM_BACCN Phosphoglucosamine mutase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=glmM PE=3 SV=1 97 536 9.0E-13
sp|Q8Y5E6|GLMM_LISMO Phosphoglucosamine mutase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=glmM PE=3 SV=1 127 532 1.0E-12
sp|Q04BF6|GLMM_LACDB Phosphoglucosamine mutase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=glmM PE=3 SV=1 125 534 2.0E-12
sp|Q38VX2|GLMM_LACSS Phosphoglucosamine mutase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=glmM PE=3 SV=1 123 534 2.0E-12
sp|B1YH95|GLMM_EXIS2 Phosphoglucosamine mutase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=glmM PE=3 SV=1 120 529 2.0E-12
sp|Q1GB12|GLMM_LACDA Phosphoglucosamine mutase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=glmM PE=3 SV=1 125 534 3.0E-12
sp|Q5FL35|GLMM_LACAC Phosphoglucosamine mutase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=glmM PE=3 SV=1 125 534 3.0E-12
sp|B2A4R9|GLMM_NATTJ Phosphoglucosamine mutase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=glmM PE=3 SV=1 127 533 4.0E-12
sp|Q74K59|GLMM_LACJO Phosphoglucosamine mutase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=glmM PE=3 SV=2 125 519 5.0E-12
sp|A0AKM3|GLMM_LISW6 Phosphoglucosamine mutase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=glmM PE=3 SV=1 127 532 5.0E-12
sp|B9E9W9|GLMM_MACCJ Phosphoglucosamine mutase OS=Macrococcus caseolyticus (strain JCSC5402) GN=glmM PE=3 SV=1 121 529 7.0E-12
sp|C4KZK4|GLMM_EXISA Phosphoglucosamine mutase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=glmM PE=3 SV=1 123 537 7.0E-12
sp|Q8DTC6|GLMM_STRMU Phosphoglucosamine mutase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=glmM PE=3 SV=1 41 534 9.0E-12
sp|Q71XP5|GLMM_LISMF Phosphoglucosamine mutase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=glmM PE=3 SV=1 127 532 9.0E-12
sp|A4XBI5|GLMM_SALTO Phosphoglucosamine mutase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=glmM PE=3 SV=1 41 526 9.0E-12
sp|A7IIG5|GLMM_XANP2 Phosphoglucosamine mutase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=glmM PE=3 SV=2 124 515 1.0E-11
sp|B8D0U9|GLMM_HALOH Phosphoglucosamine mutase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=glmM PE=3 SV=1 123 532 1.0E-11
sp|Q929Q1|GLMM_LISIN Phosphoglucosamine mutase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=glmM PE=3 SV=1 127 532 1.0E-11
sp|Q6MBL8|GLMM_PARUW Phosphoglucosamine mutase OS=Protochlamydia amoebophila (strain UWE25) GN=glmM PE=3 SV=2 127 534 2.0E-11
sp|Q1MRX8|GLMM_LAWIP Phosphoglucosamine mutase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=glmM PE=3 SV=1 127 529 2.0E-11
sp|Q4FN15|GLMM_PELUB Phosphoglucosamine mutase OS=Pelagibacter ubique (strain HTCC1062) GN=glmM PE=3 SV=1 146 512 3.0E-11
sp|P0DB39|GLMM_STRPQ Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=glmM PE=3 SV=1 120 537 3.0E-11
sp|P0DB38|GLMM_STRP3 Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=glmM PE=3 SV=1 120 537 3.0E-11
sp|Q9Z6U1|GLMM_CHLPN Phosphoglucosamine mutase OS=Chlamydia pneumoniae GN=glmM PE=3 SV=1 127 537 3.0E-11
sp|A4VPP5|GLMM_PSEU5 Phosphoglucosamine mutase OS=Pseudomonas stutzeri (strain A1501) GN=glmM PE=3 SV=2 127 531 3.0E-11
sp|C4K7K5|GLMM_HAMD5 Phosphoglucosamine mutase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=glmM PE=3 SV=1 207 530 3.0E-11
sp|Q1AU65|GLMM_RUBXD Phosphoglucosamine mutase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=glmM PE=3 SV=1 127 535 4.0E-11
sp|A4J190|GLMM_DESRM Phosphoglucosamine mutase OS=Desulfotomaculum reducens (strain MI-1) GN=glmM PE=3 SV=1 127 529 4.0E-11
sp|Q48TV1|GLMM_STRPM Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=glmM PE=3 SV=1 120 537 5.0E-11
sp|A2REP8|GLMM_STRPG Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=glmM PE=3 SV=1 120 537 5.0E-11
sp|Q1J6W8|GLMM_STRPF Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=glmM PE=3 SV=1 120 537 5.0E-11
sp|Q1JH49|GLMM_STRPD Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=glmM PE=3 SV=1 120 537 5.0E-11
sp|Q5XCE0|GLMM_STRP6 Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=glmM PE=3 SV=1 120 537 5.0E-11
sp|A3DEL6|GLMM_CLOTH Phosphoglucosamine mutase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=glmM PE=3 SV=1 97 534 5.0E-11
sp|A7HCU0|GLMM_ANADF Phosphoglucosamine mutase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=glmM PE=3 SV=1 127 522 5.0E-11
sp|Q1JM03|GLMM_STRPC Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=glmM PE=3 SV=1 120 537 5.0E-11
sp|Q1JC19|GLMM_STRPB Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=glmM PE=3 SV=1 120 537 5.0E-11
sp|B3WD16|GLMM_LACCB Phosphoglucosamine mutase OS=Lactobacillus casei (strain BL23) GN=glmM PE=3 SV=1 120 531 5.0E-11
sp|Q03AF8|GLMM_LACC3 Phosphoglucosamine mutase OS=Lactobacillus casei (strain ATCC 334) GN=glmM PE=3 SV=1 120 531 5.0E-11
sp|Q8P179|GLMM_STRP8 Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=glmM PE=3 SV=1 120 537 6.0E-11
sp|Q2W2C2|GLMM_MAGSA Phosphoglucosamine mutase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=glmM PE=3 SV=1 207 512 6.0E-11
sp|Q2RVE4|GLMM_RHORT Phosphoglucosamine mutase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=glmM PE=3 SV=1 124 512 7.0E-11
sp|Q99ZW8|GLMM_STRP1 Phosphoglucosamine mutase OS=Streptococcus pyogenes serotype M1 GN=glmM PE=3 SV=1 120 537 8.0E-11
sp|Q03SJ3|GLMM_LACBA Phosphoglucosamine mutase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=glmM PE=3 SV=1 127 534 8.0E-11
sp|A7Z0V3|GLMM_BACMF Phosphoglucosamine mutase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=glmM PE=3 SV=1 97 536 9.0E-11
sp|A5WEW6|GLMM_PSYWF Phosphoglucosamine mutase OS=Psychrobacter sp. (strain PRwf-1) GN=glmM PE=3 SV=1 123 529 1.0E-10
sp|B8I0I6|GLMM_CLOCE Phosphoglucosamine mutase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=glmM PE=3 SV=1 116 515 2.0E-10
sp|Q9RSQ3|GLMM_DEIRA Phosphoglucosamine mutase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=glmM PE=3 SV=1 125 531 2.0E-10
sp|B8DN76|GLMM_DESVM Phosphoglucosamine mutase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=glmM PE=3 SV=1 127 526 3.0E-10
sp|C6E5P5|GLMM_GEOSM Phosphoglucosamine mutase OS=Geobacter sp. (strain M21) GN=glmM PE=3 SV=1 45 537 3.0E-10
sp|B5EHA7|GLMM_GEOBB Phosphoglucosamine mutase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=glmM PE=3 SV=1 45 535 5.0E-10
sp|A8AWM5|GLMM_STRGC Phosphoglucosamine mutase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glmM PE=3 SV=1 209 534 5.0E-10
sp|B9M5K3|GLMM_GEODF Phosphoglucosamine mutase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=glmM PE=3 SV=1 45 535 5.0E-10
sp|A6Q6B6|GLMM_SULNB Phosphoglucosamine mutase OS=Sulfurovum sp. (strain NBC37-1) GN=glmM PE=3 SV=1 61 515 6.0E-10
sp|Q7NRI6|GLMM_CHRVO Phosphoglucosamine mutase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=glmM PE=3 SV=1 116 519 6.0E-10
sp|A8LAZ9|GLMM_FRASN Phosphoglucosamine mutase OS=Frankia sp. (strain EAN1pec) GN=glmM PE=3 SV=1 123 529 6.0E-10
sp|A4VWE5|GLMM_STRSY Phosphoglucosamine mutase OS=Streptococcus suis (strain 05ZYH33) GN=glmM PE=3 SV=2 127 534 8.0E-10
sp|A4W2Q0|GLMM_STRS2 Phosphoglucosamine mutase OS=Streptococcus suis (strain 98HAH33) GN=glmM PE=3 SV=2 127 534 8.0E-10
sp|C1CWA3|GLMM_DEIDV Phosphoglucosamine mutase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=glmM PE=3 SV=1 125 529 9.0E-10
sp|Q311T0|GLMM_DESAG Phosphoglucosamine mutase OS=Desulfovibrio alaskensis (strain G20) GN=glmM PE=3 SV=1 127 526 9.0E-10
sp|A4XH45|GLMM_CALS8 Phosphoglucosamine mutase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=glmM PE=3 SV=1 97 525 2.0E-09
sp|C5BFB3|GLMM_EDWI9 Phosphoglucosamine mutase OS=Edwardsiella ictaluri (strain 93-146) GN=glmM PE=3 SV=1 180 529 2.0E-09
sp|Q2SUW3|GLMM_BURTA Phosphoglucosamine mutase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=glmM PE=3 SV=1 122 529 2.0E-09
sp|B1HMT3|GLMM_LYSSC Phosphoglucosamine mutase OS=Lysinibacillus sphaericus (strain C3-41) GN=glmM PE=3 SV=1 121 534 2.0E-09
sp|A1VED4|GLMM_DESVV Phosphoglucosamine mutase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=glmM PE=3 SV=1 127 526 2.0E-09
sp|Q72CK1|GLMM_DESVH Phosphoglucosamine mutase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=glmM PE=3 SV=1 127 526 2.0E-09
sp|Q8U9L9|GLMM_AGRFC Phosphoglucosamine mutase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glmM PE=3 SV=2 127 529 3.0E-09
sp|Q13W50|GLMM_BURXL Phosphoglucosamine mutase OS=Burkholderia xenovorans (strain LB400) GN=glmM PE=3 SV=1 122 529 3.0E-09
sp|Q73F50|GLMM_BACC1 Phosphoglucosamine mutase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=glmM PE=3 SV=1 209 536 3.0E-09
sp|A5FWQ4|GLMM_ACICJ Phosphoglucosamine mutase OS=Acidiphilium cryptum (strain JF-5) GN=glmM PE=3 SV=1 124 511 3.0E-09
sp|Q6HPL3|GLMM_BACHK Phosphoglucosamine mutase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=glmM PE=3 SV=1 209 536 3.0E-09
sp|Q63H45|GLMM_BACCZ Phosphoglucosamine mutase OS=Bacillus cereus (strain ZK / E33L) GN=glmM PE=3 SV=1 209 536 3.0E-09
sp|B9J0F1|GLMM_BACCQ Phosphoglucosamine mutase OS=Bacillus cereus (strain Q1) GN=glmM PE=3 SV=1 209 536 3.0E-09
sp|B7HQZ0|GLMM_BACC7 Phosphoglucosamine mutase OS=Bacillus cereus (strain AH187) GN=glmM PE=3 SV=1 209 536 3.0E-09
sp|C1EU11|GLMM_BACC3 Phosphoglucosamine mutase OS=Bacillus cereus (strain 03BB102) GN=glmM PE=3 SV=1 209 536 3.0E-09
sp|B7JL64|GLMM_BACC0 Phosphoglucosamine mutase OS=Bacillus cereus (strain AH820) GN=glmM PE=3 SV=1 209 536 3.0E-09
sp|Q81VN7|GLMM_BACAN Phosphoglucosamine mutase OS=Bacillus anthracis GN=glmM PE=1 SV=1 209 536 3.0E-09
sp|C3LJZ1|GLMM_BACAC Phosphoglucosamine mutase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=glmM PE=3 SV=1 209 536 3.0E-09
sp|C3PAL5|GLMM_BACAA Phosphoglucosamine mutase OS=Bacillus anthracis (strain A0248) GN=glmM PE=3 SV=1 209 536 3.0E-09
sp|B2JFP2|GLMM_BURP8 Phosphoglucosamine mutase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=glmM PE=3 SV=1 122 529 3.0E-09
sp|A9HB20|GLMM_GLUDA Phosphoglucosamine mutase OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=glmM PE=3 SV=1 124 512 3.0E-09
sp|B4U3I6|GLMM_STREM Phosphoglucosamine mutase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=glmM PE=3 SV=1 209 536 4.0E-09
sp|Q3A5V5|GLMM_PELCD Phosphoglucosamine mutase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=glmM PE=3 SV=2 45 534 4.0E-09
sp|A0R8M4|GLMM_BACAH Phosphoglucosamine mutase OS=Bacillus thuringiensis (strain Al Hakam) GN=glmM PE=3 SV=1 209 536 4.0E-09
sp|Q0C5U1|GLMM_HYPNA Phosphoglucosamine mutase OS=Hyphomonas neptunium (strain ATCC 15444) GN=glmM PE=3 SV=1 127 512 5.0E-09
sp|A7MIM5|GLMM_CROS8 Phosphoglucosamine mutase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=glmM PE=3 SV=1 180 529 5.0E-09
sp|B2GAN5|GLMM_LACF3 Phosphoglucosamine mutase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=glmM PE=3 SV=1 123 515 6.0E-09
sp|B9DSE8|GLMM_STRU0 Phosphoglucosamine mutase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=glmM PE=3 SV=1 209 534 6.0E-09
sp|B4R906|GLMM_PHEZH Phosphoglucosamine mutase OS=Phenylobacterium zucineum (strain HLK1) GN=glmM PE=3 SV=1 124 529 6.0E-09
sp|B0V9C8|GLMM_ACIBY Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain AYE) GN=glmM PE=3 SV=1 126 533 8.0E-09
sp|B7ICC7|GLMM_ACIB5 Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain AB0057) GN=glmM PE=3 SV=1 126 533 8.0E-09
sp|B7GV90|GLMM_ACIB3 Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain AB307-0294) GN=glmM PE=3 SV=1 126 533 8.0E-09
sp|C4XU39|GLMM_DESMR Phosphoglucosamine mutase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=glmM PE=3 SV=1 207 529 9.0E-09
sp|Q97LS0|GLMM_CLOAB Phosphoglucosamine mutase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glmM PE=3 SV=1 97 533 9.0E-09
sp|B7ITV9|GLMM_BACC2 Phosphoglucosamine mutase OS=Bacillus cereus (strain G9842) GN=glmM PE=3 SV=1 209 536 9.0E-09
sp|Q2N850|GLMM_ERYLH Phosphoglucosamine mutase OS=Erythrobacter litoralis (strain HTCC2594) GN=glmM PE=3 SV=1 127 529 1.0E-08
sp|A6VP84|GLMM_ACTSZ Phosphoglucosamine mutase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=glmM PE=3 SV=1 127 526 1.0E-08
sp|A1AVH5|GLMM_RUTMC Phosphoglucosamine mutase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=glmM PE=3 SV=1 207 528 1.0E-08
sp|A8F9E6|GLMM_BACP2 Phosphoglucosamine mutase OS=Bacillus pumilus (strain SAFR-032) GN=glmM PE=3 SV=1 275 534 1.0E-08
sp|A3CM30|GLMM_STRSV Phosphoglucosamine mutase OS=Streptococcus sanguinis (strain SK36) GN=glmM PE=3 SV=1 209 536 1.0E-08
sp|A3M9W5|GLMM_ACIBT Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=glmM PE=3 SV=2 126 533 2.0E-08
sp|B0VNX9|GLMM_ACIBS Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain SDF) GN=glmM PE=3 SV=1 126 533 2.0E-08
sp|A4G4B3|GLMM_HERAR Phosphoglucosamine mutase OS=Herminiimonas arsenicoxydans GN=glmM PE=3 SV=1 122 526 2.0E-08
sp|B2I1H8|GLMM_ACIBC Phosphoglucosamine mutase OS=Acinetobacter baumannii (strain ACICU) GN=glmM PE=3 SV=1 126 533 2.0E-08
sp|B7GIY9|GLMM_ANOFW Phosphoglucosamine mutase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=glmM PE=3 SV=1 275 534 2.0E-08
sp|Q4JTD7|GLMM_CORJK Phosphoglucosamine mutase OS=Corynebacterium jeikeium (strain K411) GN=glmM PE=3 SV=1 123 531 2.0E-08
sp|C0PZ59|GLMM_SALPC Phosphoglucosamine mutase OS=Salmonella paratyphi C (strain RKS4594) GN=glmM PE=3 SV=1 180 529 2.0E-08
sp|Q57JH3|GLMM_SALCH Phosphoglucosamine mutase OS=Salmonella choleraesuis (strain SC-B67) GN=glmM PE=3 SV=1 180 529 2.0E-08
sp|A9VPC3|GLMM_BACWK Phosphoglucosamine mutase OS=Bacillus weihenstephanensis (strain KBAB4) GN=glmM PE=3 SV=1 209 536 2.0E-08
sp|C0M9C4|GLMM_STRE4 Phosphoglucosamine mutase OS=Streptococcus equi subsp. equi (strain 4047) GN=glmM PE=3 SV=1 209 536 2.0E-08
sp|Q6FYQ7|GLMM_BARQU Phosphoglucosamine mutase OS=Bartonella quintana (strain Toulouse) GN=glmM PE=3 SV=1 124 515 2.0E-08
sp|Q7CPP9|GLMM_SALTY Phosphoglucosamine mutase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|Q8XF81|GLMM_SALTI Phosphoglucosamine mutase OS=Salmonella typhi GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|B4TWE3|GLMM_SALSV Phosphoglucosamine mutase OS=Salmonella schwarzengrund (strain CVM19633) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|A9N740|GLMM_SALPB Phosphoglucosamine mutase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|B4T705|GLMM_SALNS Phosphoglucosamine mutase OS=Salmonella newport (strain SL254) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|B4TJ12|GLMM_SALHS Phosphoglucosamine mutase OS=Salmonella heidelberg (strain SL476) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|B5REP2|GLMM_SALG2 Phosphoglucosamine mutase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|B5QZW4|GLMM_SALEP Phosphoglucosamine mutase OS=Salmonella enteritidis PT4 (strain P125109) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|B5FI19|GLMM_SALDC Phosphoglucosamine mutase OS=Salmonella dublin (strain CT_02021853) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|B5F6U4|GLMM_SALA4 Phosphoglucosamine mutase OS=Salmonella agona (strain SL483) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|Q81J03|GLMM_BACCR Phosphoglucosamine mutase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glmM PE=3 SV=1 209 536 3.0E-08
sp|B7HJK3|GLMM_BACC4 Phosphoglucosamine mutase OS=Bacillus cereus (strain B4264) GN=glmM PE=3 SV=1 209 536 3.0E-08
sp|A5F930|GLMM_VIBC3 Phosphoglucosamine mutase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=glmM PE=3 SV=1 166 531 3.0E-08
sp|C3LSP4|GLMM_VIBCM Phosphoglucosamine mutase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=glmM PE=3 SV=1 166 531 3.0E-08
sp|Q9KU84|GLMM_VIBCH Phosphoglucosamine mutase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=glmM PE=3 SV=1 166 531 3.0E-08
sp|Q0ALR7|GLMM_MARMM Phosphoglucosamine mutase OS=Maricaulis maris (strain MCS10) GN=glmM PE=3 SV=1 124 516 3.0E-08
sp|A8HUR7|GLMM_AZOC5 Phosphoglucosamine mutase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=glmM PE=3 SV=1 124 512 3.0E-08
sp|B5BGK0|GLMM_SALPK Phosphoglucosamine mutase OS=Salmonella paratyphi A (strain AKU_12601) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|Q5PLC4|GLMM_SALPA Phosphoglucosamine mutase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glmM PE=3 SV=1 180 529 3.0E-08
sp|B9MMU5|GLMM_CALBD Phosphoglucosamine mutase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=glmM PE=3 SV=1 123 513 4.0E-08
sp|Q8E049|GLMM_STRA5 Phosphoglucosamine mutase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=glmM PE=3 SV=1 209 536 4.0E-08
sp|Q8E5S6|GLMM_STRA3 Phosphoglucosamine mutase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=glmM PE=3 SV=1 209 536 4.0E-08
sp|Q3K1H1|GLMM_STRA1 Phosphoglucosamine mutase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=glmM PE=3 SV=1 209 536 4.0E-08
sp|B8ZLM2|GLMM_STRPJ Phosphoglucosamine mutase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=glmM PE=3 SV=1 209 536 4.0E-08
sp|A6UCS2|GLMM_SINMW Phosphoglucosamine mutase OS=Sinorhizobium medicae (strain WSM419) GN=glmM PE=3 SV=1 124 515 5.0E-08
sp|O34824|GLMM_BACSU Phosphoglucosamine mutase OS=Bacillus subtilis (strain 168) GN=glmM PE=1 SV=1 209 534 6.0E-08
sp|A5CXP9|GLMM_VESOH Phosphoglucosamine mutase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=glmM PE=3 SV=1 207 512 6.0E-08
sp|Q6G5P7|GLMM_BARHE Phosphoglucosamine mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=glmM PE=3 SV=1 124 519 7.0E-08
sp|A8AQ65|GLMM_CITK8 Phosphoglucosamine mutase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glmM PE=3 SV=1 180 529 7.0E-08
sp|Q92M99|GLMM_RHIME Phosphoglucosamine mutase OS=Rhizobium meliloti (strain 1021) GN=glmM PE=3 SV=1 124 528 7.0E-08
sp|A9MP31|GLMM_SALAR Phosphoglucosamine mutase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=glmM PE=3 SV=1 180 529 9.0E-08
sp|C6DKI6|GLMM_PECCP Phosphoglucosamine mutase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=glmM PE=3 SV=1 180 529 9.0E-08
sp|B7N0V9|GLMM_ECO81 Phosphoglucosamine mutase OS=Escherichia coli O81 (strain ED1a) GN=glmM PE=3 SV=1 180 529 1.0E-07
sp|Q0BT42|GLMM_GRABC Phosphoglucosamine mutase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=glmM PE=3 SV=1 124 512 2.0E-07
sp|C1CSI0|GLMM_STRZT Phosphoglucosamine mutase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=glmM PE=3 SV=1 209 536 2.0E-07
sp|C1CLQ9|GLMM_STRZP Phosphoglucosamine mutase OS=Streptococcus pneumoniae (strain P1031) GN=glmM PE=3 SV=1 209 536 2.0E-07
sp|C1CFE3|GLMM_STRZJ Phosphoglucosamine mutase OS=Streptococcus pneumoniae (strain JJA) GN=glmM PE=3 SV=1 209 536 2.0E-07
sp|C1C8F1|GLMM_STRP7 Phosphoglucosamine mutase OS=Streptococcus pneumoniae (strain 70585) GN=glmM PE=3 SV=1 209 536 2.0E-07
sp|A0JZ25|GLMM_ARTS2 Phosphoglucosamine mutase OS=Arthrobacter sp. (strain FB24) GN=glmM PE=3 SV=1 122 531 2.0E-07
sp|P9WN41|GLMM_MYCTU Phosphoglucosamine mutase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=glmM PE=1 SV=1 126 531 2.0E-07
sp|P9WN40|GLMM_MYCTO Phosphoglucosamine mutase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=glmM PE=3 SV=1 126 531 2.0E-07
sp|A5U8B7|GLMM_MYCTA Phosphoglucosamine mutase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=glmM PE=3 SV=1 126 531 2.0E-07
sp|C1AHQ0|GLMM_MYCBT Phosphoglucosamine mutase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=glmM PE=3 SV=1 126 531 2.0E-07
sp|A1KPC8|GLMM_MYCBP Phosphoglucosamine mutase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=glmM PE=3 SV=1 126 531 2.0E-07
sp|Q7TWH9|GLMM_MYCBO Phosphoglucosamine mutase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=glmM PE=3 SV=1 126 531 2.0E-07
sp|Q2K4M3|GLMM_RHIEC Phosphoglucosamine mutase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=glmM PE=3 SV=1 127 529 2.0E-07
sp|Q3YX65|GLMM_SHISS Phosphoglucosamine mutase OS=Shigella sonnei (strain Ss046) GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|Q1R6G2|GLMM_ECOUT Phosphoglucosamine mutase OS=Escherichia coli (strain UTI89 / UPEC) GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|B1LFS6|GLMM_ECOSM Phosphoglucosamine mutase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|B7NDG0|GLMM_ECOLU Phosphoglucosamine mutase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|Q8FD84|GLMM_ECOL6 Phosphoglucosamine mutase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|Q0TCT4|GLMM_ECOL5 Phosphoglucosamine mutase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|A1AG79|GLMM_ECOK1 Phosphoglucosamine mutase OS=Escherichia coli O1:K1 / APEC GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|B7MB95|GLMM_ECO45 Phosphoglucosamine mutase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|B7UJ69|GLMM_ECO27 Phosphoglucosamine mutase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|B5E6K3|GLMM_STRP4 Phosphoglucosamine mutase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=glmM PE=3 SV=1 209 536 2.0E-07
sp|B5YS65|GLMM_ECO5E Phosphoglucosamine mutase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|Q8X9L2|GLMM_ECO57 Phosphoglucosamine mutase OS=Escherichia coli O157:H7 GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|B7NKP3|GLMM_ECO7I Phosphoglucosamine mutase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glmM PE=3 SV=1 180 529 2.0E-07
sp|Q57BJ0|GLMM_BRUAB Phosphoglucosamine mutase OS=Brucella abortus biovar 1 (strain 9-941) GN=glmM PE=3 SV=1 207 515 2.0E-07
sp|Q2YQH8|GLMM_BRUA2 Phosphoglucosamine mutase OS=Brucella abortus (strain 2308) GN=glmM PE=3 SV=1 207 515 2.0E-07
sp|Q8FZ13|GLMM_BRUSU Phosphoglucosamine mutase OS=Brucella suis biovar 1 (strain 1330) GN=glmM PE=3 SV=1 207 533 2.0E-07
sp|A9WWG7|GLMM_BRUSI Phosphoglucosamine mutase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=glmM PE=3 SV=2 207 533 2.0E-07
sp|A5VS47|GLMM_BRUO2 Phosphoglucosamine mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=glmM PE=3 SV=1 207 533 2.0E-07
sp|A9M7I9|GLMM_BRUC2 Phosphoglucosamine mutase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=glmM PE=3 SV=2 207 533 2.0E-07
sp|B1ICY0|GLMM_STRPI Phosphoglucosamine mutase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=glmM PE=3 SV=1 209 536 2.0E-07
sp|Q5NNT4|GLMM_ZYMMO Phosphoglucosamine mutase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glmM PE=3 SV=1 127 525 3.0E-07
sp|Q1GUJ4|GLMM_SPHAL Phosphoglucosamine mutase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=glmM PE=3 SV=1 127 377 3.0E-07
sp|Q63V83|GLMM_BURPS Phosphoglucosamine mutase OS=Burkholderia pseudomallei (strain K96243) GN=glmM PE=3 SV=1 207 529 3.0E-07
sp|Q8YIU8|GLMM_BRUME Phosphoglucosamine mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=glmM PE=3 SV=2 207 533 3.0E-07
sp|Q8DP16|GLMM_STRR6 Phosphoglucosamine mutase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glmM PE=1 SV=1 209 536 3.0E-07
sp|Q04JI8|GLMM_STRP2 Phosphoglucosamine mutase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glmM PE=3 SV=1 209 536 3.0E-07
sp|C0QGV9|GLMM_DESAH Phosphoglucosamine mutase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=glmM PE=3 SV=1 207 512 3.0E-07
sp|B7LR43|GLMM_ESCF3 Phosphoglucosamine mutase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=glmM PE=3 SV=1 180 529 4.0E-07
sp|A1JIW5|GLMM_YERE8 Phosphoglucosamine mutase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glmM PE=3 SV=1 180 528 4.0E-07
sp|A5V2D8|GLMM_SPHWW Phosphoglucosamine mutase OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=glmM PE=3 SV=1 207 515 4.0E-07
sp|Q31W53|GLMM_SHIBS Phosphoglucosamine mutase OS=Shigella boydii serotype 4 (strain Sb227) GN=glmM PE=3 SV=1 180 529 5.0E-07
sp|Q5R0R2|GLMM_IDILO Phosphoglucosamine mutase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=glmM PE=3 SV=1 207 529 5.0E-07
sp|A9IYI0|GLMM_BART1 Phosphoglucosamine mutase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=glmM PE=3 SV=1 124 515 5.0E-07
sp|B2U201|GLMM_SHIB3 Phosphoglucosamine mutase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glmM PE=3 SV=1 180 529 5.0E-07
sp|B6I1P9|GLMM_ECOSE Phosphoglucosamine mutase OS=Escherichia coli (strain SE11) GN=glmM PE=3 SV=1 180 529 5.0E-07
sp|P31120|GLMM_ECOLI Phosphoglucosamine mutase OS=Escherichia coli (strain K12) GN=glmM PE=1 SV=3 180 529 5.0E-07
sp|B1IQU7|GLMM_ECOLC Phosphoglucosamine mutase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glmM PE=3 SV=1 180 529 5.0E-07
sp|A8A4Z0|GLMM_ECOHS Phosphoglucosamine mutase OS=Escherichia coli O9:H4 (strain HS) GN=glmM PE=3 SV=1 180 529 5.0E-07
sp|B1XGY6|GLMM_ECODH Phosphoglucosamine mutase OS=Escherichia coli (strain K12 / DH10B) GN=glmM PE=3 SV=1 180 529 5.0E-07
sp|C4ZSR5|GLMM_ECOBW Phosphoglucosamine mutase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glmM PE=3 SV=1 180 529 5.0E-07
sp|B7M082|GLMM_ECO8A Phosphoglucosamine mutase OS=Escherichia coli O8 (strain IAI1) GN=glmM PE=3 SV=1 180 529 5.0E-07
sp|A7ZS72|GLMM_ECO24 Phosphoglucosamine mutase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glmM PE=3 SV=1 180 529 5.0E-07
sp|Q2IHZ5|GLMM_ANADE Phosphoglucosamine mutase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=glmM PE=3 SV=1 182 526 5.0E-07
sp|Q6D9B6|GLMM_PECAS Phosphoglucosamine mutase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glmM PE=3 SV=1 180 529 5.0E-07
sp|Q98F91|GLMM_RHILO Phosphoglucosamine mutase OS=Rhizobium loti (strain MAFF303099) GN=glmM PE=3 SV=1 127 512 6.0E-07
sp|B2IR78|GLMM_STRPS Phosphoglucosamine mutase OS=Streptococcus pneumoniae (strain CGSP14) GN=glmM PE=3 SV=1 209 536 6.0E-07
sp|Q97PP4|GLMM_STRPN Phosphoglucosamine mutase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glmM PE=3 SV=1 209 536 6.0E-07
sp|Q32BF7|GLMM_SHIDS Phosphoglucosamine mutase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glmM PE=3 SV=1 182 529 6.0E-07
sp|B7LHN9|GLMM_ECO55 Phosphoglucosamine mutase OS=Escherichia coli (strain 55989 / EAEC) GN=glmM PE=3 SV=1 180 529 7.0E-07
sp|B3PYX0|GLMM_RHIE6 Phosphoglucosamine mutase OS=Rhizobium etli (strain CIAT 652) GN=glmM PE=3 SV=1 127 529 8.0E-07
sp|B1JMH4|GLMM_YERPY Phosphoglucosamine mutase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=glmM PE=3 SV=1 180 529 1.0E-06
sp|Q66F64|GLMM_YERPS Phosphoglucosamine mutase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=glmM PE=3 SV=1 180 529 1.0E-06
sp|A4TRI7|GLMM_YERPP Phosphoglucosamine mutase OS=Yersinia pestis (strain Pestoides F) GN=glmM PE=3 SV=1 180 529 1.0E-06
sp|Q1CEK9|GLMM_YERPN Phosphoglucosamine mutase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=glmM PE=3 SV=1 180 529 1.0E-06
sp|A9R599|GLMM_YERPG Phosphoglucosamine mutase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=glmM PE=3 SV=1 180 529 1.0E-06
sp|Q8ZBB8|GLMM_YERPE Phosphoglucosamine mutase OS=Yersinia pestis GN=glmM PE=3 SV=1 180 529 1.0E-06
sp|B2K2Q1|GLMM_YERPB Phosphoglucosamine mutase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=glmM PE=3 SV=1 180 529 1.0E-06
sp|Q1CC03|GLMM_YERPA Phosphoglucosamine mutase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=glmM PE=3 SV=1 180 529 1.0E-06
sp|A7FMS6|GLMM_YERP3 Phosphoglucosamine mutase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=glmM PE=3 SV=1 180 529 1.0E-06
sp|Q6LUJ6|GLMM_PHOPR Phosphoglucosamine mutase OS=Photobacterium profundum GN=glmM PE=3 SV=2 207 531 2.0E-06
sp|A4IJN4|GLMM_GEOTN Phosphoglucosamine mutase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=glmM PE=3 SV=1 97 534 2.0E-06
sp|A6WY87|GLMM_OCHA4 Phosphoglucosamine mutase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=glmM PE=3 SV=2 207 515 2.0E-06
sp|Q7VP94|GLMM_HAEDU Phosphoglucosamine mutase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=glmM PE=3 SV=1 207 529 2.0E-06
sp|B2SZR6|GLMM_BURPP Phosphoglucosamine mutase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=glmM PE=3 SV=1 207 529 2.0E-06
sp|Q5L3P1|GLMM_GEOKA Phosphoglucosamine mutase OS=Geobacillus kaustophilus (strain HTA426) GN=glmM PE=3 SV=1 275 534 3.0E-06
sp|Q30NW8|GLMM_SULDN Phosphoglucosamine mutase OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=glmM PE=3 SV=1 207 512 3.0E-06
sp|Q0T0A8|GLMM_SHIF8 Phosphoglucosamine mutase OS=Shigella flexneri serotype 5b (strain 8401) GN=glmM PE=3 SV=1 180 529 3.0E-06
sp|Q0I2Q5|GLMM_HAES1 Phosphoglucosamine mutase OS=Haemophilus somnus (strain 129Pt) GN=glmM PE=3 SV=1 207 526 4.0E-06
sp|B8F5R2|GLMM_HAEPS Phosphoglucosamine mutase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=glmM PE=3 SV=1 177 526 4.0E-06
sp|B0UTS2|GLMM_HISS2 Phosphoglucosamine mutase OS=Histophilus somni (strain 2336) GN=glmM PE=3 SV=1 207 526 5.0E-06
sp|A7MUV2|GLMM_VIBCB Phosphoglucosamine mutase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=glmM PE=3 SV=1 166 526 6.0E-06
sp|Q2GB44|GLMM_NOVAD Phosphoglucosamine mutase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=glmM PE=3 SV=1 207 512 6.0E-06
sp|Q03GV0|GLMM_PEDPA Phosphoglucosamine mutase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=glmM PE=3 SV=1 275 536 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0071704 organic substance metabolic process Yes
GO:0016868 intramolecular transferase activity, phosphotransferases Yes
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016853 isomerase activity No
GO:0016866 intramolecular transferase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006050
MPFNLDNIAALSNQHPKPTYYQYQYGTAGFRTLGDRLDSVVFRIGILAALRSMKHNSHAIGVMVTASHNPEQDNG
VKLIDPRGEMLEASWEVHATTIANARTTEELVNVIQHIIDVVNIDTTRPAVVIYGRDTRPTGESLVAALQDGIRA
AGADGRDAGITTTPIIHYLVRATNSKDFGEPTEIGYYTKMIDAFKKLVAGRPKISPLLVDCANGVGYIAADKVKK
YLGDTLSLILENTSTATAGALNNSCGADYVKTTQRLPPSLNGKLTPVQRGCSLDGDADRLIYFYIDEKRQFRMLD
GDKIASLVATFIVDLVRAAGLQGQIKVGTVQTAYANGSSTKFLAQRLPVKCVPTGVKYLHHAAESFDVGVYFEAN
GHGTVLFSRNTQETLEKHEPKTPAQQTALNHIINLTKLINQTVGDALSDMLLVEVVLAHRSYTGVEWDSLYTDLP
NRLVKVVVNDRNAFVTTDAERRLVSPPLLQQRIDELVLKYDGGRTFVRPSGTEDVVRVYAEASTRVQADDLAYRI
AGMVYDEAGGDSTRRPKEFI*
Coding >AgabiH97|006050
ATGCCTTTCAACCTCGATAACATCGCCGCCCTTTCCAACCAACACCCAAAGCCAACCTATTACCAATATCAGTAT
GGAACCGCCGGCTTCAGGACGCTAGGCGATCGCCTTGATTCAGTCGTGTTCCGCATTGGCATCCTGGCCGCTCTC
CGTAGCATGAAACACAATAGTCACGCCATTGGTGTAATGGTCACCGCATCCCATAATCCTGAGCAGGATAATGGA
GTAAAGCTCATCGATCCTCGCGGTGAAATGCTTGAGGCTAGCTGGGAAGTCCATGCAACTACCATTGCCAATGCG
CGCACGACGGAGGAGTTGGTCAATGTGATCCAACACATCATCGATGTTGTCAACATCGATACCACGAGGCCTGCT
GTTGTTATCTATGGACGAGATACCCGGCCCACCGGGGAATCATTGGTCGCTGCTCTCCAGGATGGTATAAGAGCT
GCAGGCGCAGATGGTCGCGATGCAGGTATCACAACTACACCCATTATACACTACCTCGTGCGAGCCACCAATTCA
AAGGATTTCGGTGAACCTACAGAAATTGGCTACTATACAAAAATGATTGATGCTTTCAAGAAGCTAGTTGCTGGG
AGACCAAAGATCAGTCCTTTGCTCGTTGATTGTGCGAATGGTGTCGGGTATATCGCTGCAGACAAGGTCAAGAAG
TATCTTGGAGACACGCTTTCTCTCATTCTTGAAAACACCTCAACAGCAACAGCGGGAGCTCTAAACAACTCATGT
GGTGCTGACTACGTCAAAACCACACAGCGTTTGCCTCCTTCGTTGAACGGTAAATTGACGCCTGTTCAACGAGGA
TGTAGTCTTGATGGTGATGCGGATCGACTTATCTACTTCTACATCGATGAAAAAAGGCAATTCCGTATGCTGGAC
GGTGACAAGATCGCCAGCTTAGTTGCAACTTTCATCGTAGATCTTGTCAGGGCGGCCGGTCTACAAGGTCAAATC
AAGGTCGGCACCGTGCAGACTGCATATGCAAATGGGTCTTCGACCAAGTTTTTGGCCCAACGTCTGCCTGTCAAA
TGTGTTCCGACCGGCGTTAAATACCTCCACCATGCTGCGGAGAGTTTTGATGTTGGCGTCTACTTCGAAGCAAAT
GGTCATGGAACCGTGCTTTTCTCTCGAAATACGCAAGAGACTTTGGAAAAACACGAGCCAAAGACTCCTGCTCAG
CAAACCGCTCTCAACCATATCATTAACTTGACAAAGCTCATTAATCAGACAGTCGGTGATGCACTGTCTGATATG
CTTCTGGTTGAAGTTGTTTTGGCTCATAGATCTTATACCGGCGTCGAGTGGGATTCGTTATACACCGATTTGCCA
AACCGATTGGTTAAAGTCGTTGTCAACGACAGGAATGCGTTCGTCACCACAGATGCTGAGCGTCGTTTGGTCAGC
CCACCCTTGCTGCAGCAAAGGATTGATGAGTTGGTCCTGAAATATGACGGGGGTCGCACTTTTGTACGACCCAGT
GGCACCGAAGATGTGGTTCGAGTCTATGCAGAGGCTTCGACTCGGGTTCAAGCCGACGACTTGGCCTATCGGATC
GCTGGAATGGTATATGACGAAGCTGGTGGTGATTCCACGAGGCGCCCCAAAGAATTCATTTAA
Transcript >AgabiH97|006050
ATGCCTTTCAACCTCGATAACATCGCCGCCCTTTCCAACCAACACCCAAAGCCAACCTATTACCAATATCAGTAT
GGAACCGCCGGCTTCAGGACGCTAGGCGATCGCCTTGATTCAGTCGTGTTCCGCATTGGCATCCTGGCCGCTCTC
CGTAGCATGAAACACAATAGTCACGCCATTGGTGTAATGGTCACCGCATCCCATAATCCTGAGCAGGATAATGGA
GTAAAGCTCATCGATCCTCGCGGTGAAATGCTTGAGGCTAGCTGGGAAGTCCATGCAACTACCATTGCCAATGCG
CGCACGACGGAGGAGTTGGTCAATGTGATCCAACACATCATCGATGTTGTCAACATCGATACCACGAGGCCTGCT
GTTGTTATCTATGGACGAGATACCCGGCCCACCGGGGAATCATTGGTCGCTGCTCTCCAGGATGGTATAAGAGCT
GCAGGCGCAGATGGTCGCGATGCAGGTATCACAACTACACCCATTATACACTACCTCGTGCGAGCCACCAATTCA
AAGGATTTCGGTGAACCTACAGAAATTGGCTACTATACAAAAATGATTGATGCTTTCAAGAAGCTAGTTGCTGGG
AGACCAAAGATCAGTCCTTTGCTCGTTGATTGTGCGAATGGTGTCGGGTATATCGCTGCAGACAAGGTCAAGAAG
TATCTTGGAGACACGCTTTCTCTCATTCTTGAAAACACCTCAACAGCAACAGCGGGAGCTCTAAACAACTCATGT
GGTGCTGACTACGTCAAAACCACACAGCGTTTGCCTCCTTCGTTGAACGGTAAATTGACGCCTGTTCAACGAGGA
TGTAGTCTTGATGGTGATGCGGATCGACTTATCTACTTCTACATCGATGAAAAAAGGCAATTCCGTATGCTGGAC
GGTGACAAGATCGCCAGCTTAGTTGCAACTTTCATCGTAGATCTTGTCAGGGCGGCCGGTCTACAAGGTCAAATC
AAGGTCGGCACCGTGCAGACTGCATATGCAAATGGGTCTTCGACCAAGTTTTTGGCCCAACGTCTGCCTGTCAAA
TGTGTTCCGACCGGCGTTAAATACCTCCACCATGCTGCGGAGAGTTTTGATGTTGGCGTCTACTTCGAAGCAAAT
GGTCATGGAACCGTGCTTTTCTCTCGAAATACGCAAGAGACTTTGGAAAAACACGAGCCAAAGACTCCTGCTCAG
CAAACCGCTCTCAACCATATCATTAACTTGACAAAGCTCATTAATCAGACAGTCGGTGATGCACTGTCTGATATG
CTTCTGGTTGAAGTTGTTTTGGCTCATAGATCTTATACCGGCGTCGAGTGGGATTCGTTATACACCGATTTGCCA
AACCGATTGGTTAAAGTCGTTGTCAACGACAGGAATGCGTTCGTCACCACAGATGCTGAGCGTCGTTTGGTCAGC
CCACCCTTGCTGCAGCAAAGGATTGATGAGTTGGTCCTGAAATATGACGGGGGTCGCACTTTTGTACGACCCAGT
GGCACCGAAGATGTGGTTCGAGTCTATGCAGAGGCTTCGACTCGGGTTCAAGCCGACGACTTGGCCTATCGGATC
GCTGGAATGGTATATGACGAAGCTGGTGGTGATTCCACGAGGCGCCCCAAAGAATTCATTTAA
Gene >AgabiH97|006050
ATGCCTTTCAACCTCGATAACATCGCCGCCCTTTCCAACCAACACCCAAAGCCAACCTATTACCAATATCAGTAT
GGAACCGCCGGCTTCAGGACGCTGTGAGCGCACCCTGATCCCTCTCCGCCGGATTCGCTGCTGAATATGACTGCT
CCTCTAGAGGCGATCGCCTTGATTCAGTCGTGTTCCGCATTGGCATCCTGGCCGCTCTCCGTAGCATGAAACACA
ATAGTCACGCCATTGGTGTAATGGTCACCGCATCCCATAATCCTGAGCAGGTGCATCTCTCTCTATGTGCTGTTC
CATGGCGCGTATCTCCAACGCCTTCTTCAGGATAATGGAGTAAAGCTCATCGATCCTCGCGGTGAAATGCTTGAG
GCTAGCTGGGAAGTCCATGCAACTACCATTGCCAATGCGCGCACGACGGAGGAGTTGGTCAATGTGATCCAACAC
ATCATCGATGTTGTCAACATCGATACCACGAGGCCTGCTGTTGTTATCTATGGACGAGATACCCGGCCCACCGGG
GAATCATTGGTCGCTGCTCTCCAGGATGGTATAAGAGCTGCAGGCGCAGATGGTCGCGATGCAGGTATCACAACT
ACACCCATTATACACTACCTCGTGCGAGCCACCAATTCAAAGGATTTCGGTGAACCTACAGAAATTGGCTACTAT
ACAAAAATGATTGATGCTTTCAAGAAGCTAGTTGTAGGTGTTTCGAATATGCACTATTTCTGACGCTAACACGAG
CATACAGGCTGGGAGACCAAAGATCAGTCCTTTGCTCGTTGATTGTGCGAATGGTGTCGGGTATATCGCTGCAGA
CAAGGTCAAGAAGTATCTTGGAGACACGCTTTCTCTCATTCTTGAAAACACCTCAACAGCAACAGCGGGAGCTCT
AAACAACTCATGTGGTGCTGACTACGTCAAAACCACACAGCGTTTGCCTCCTTCGTTGAACGGTAAATTGACGCC
TGTTCAACGAGGATGTAGTCTTGATGGTGATGCGGATCGACTTATCTACTTCTACATCGATGAAAAAAGGCAATT
CCGTATGCTGGACGGTGACAAGATCGCCAGCTTAGTTGCAACTTTCATCGTAGATCTTGTCAGGGCGGCCGGTCT
ACAAGGTCAAATCAAGGTCGGCACCGTGCAGACTGCATATGCAAATGGGTCTTCGACCAAGTTTTTGGCCCAAGT
GAGCATTTTGAATTCAGATATGACTTCATCTGATTGTGGAACTTTGCATAGCGTCTGCCTGTCAAATGTGTTCCG
ACCGGCGTTAAATACCTCCACCATGCTGCGGAGAGTTTTGATGTTGGCGTCTACTTCGAAGCAAATGGTCATGGA
ACCGTGCTTTTCTCTCGAAATACGCAAGAGACTTTGGAAAAACACGAGCCAAAGACTCCTGCTCAGCAAACCGCT
CTCAACCATATCATTAACTTGACAAAGCTCATTAATCAGACAGTCGGTGATGCACTGTCTGATATGCTTCTGGTT
GAAGTTGTTTTGGCTCATAGATCTTATACCGGCGTCGAGTGGGATTCGTTATACACCGATTTGCCAAACCGATTG
GTTAAAGTCGTTGTCAACGACAGGAATGCGTTCGTCACCACAGATGCTGAGCGTCGTTTGGTCAGCCCACCCTTG
CTGCAGCAAAGGATTGATGAGTTGGTCCTGAAATATGACGGGGGTCGCACTTTTGTACGACCCAGTGGCACCGAA
GATGTGGTTCGAGTCTATGCAGAGGCTTCGACTCGGGTTCAAGCCGACGGTATGTTATTTCCGTCGTTTGGAGAT
AAAGACTGATCGAACTGCTAGACTTGGCCTATCGGATCGCTGGAATGGTATATGACGAAGCTGGTGGTGATTCCA
CGAGGCGCCCCAAAGAATTCATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail