Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|006040
Gene name
Locationscaffold_1:1476683..1478162
Strand-
Gene length (bp)1479
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13230 GATase_4 Glutamine amidotransferases class-II 1.1E-19 16 283
PF13522 GATase_6 Glutamine amidotransferase domain 5.4E-09 88 162

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53871|DUG3_YEAST Probable glutamine amidotransferase DUG3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUG3 PE=1 SV=1 1 324 2.0E-103
sp|P54004|Y199_SYNY3 Putative glutamine amidotransferase slr0199 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0199 PE=3 SV=1 1 283 1.0E-29
sp|A0R5M9|EGTC_MYCS2 Gamma-glutamyl-hercynylcysteine sulfoxide hydrolase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=egtC PE=1 SV=1 1 125 9.0E-07
sp|O69670|EGTC_MYCTU Gamma-glutamyl-hercynylcysteine sulfoxide hydrolase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=egtC PE=1 SV=1 1 125 6.0E-06
sp|P44098|Y1037_HAEIN Putative glutamine amidotransferase HI_1037 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1037 PE=3 SV=1 87 214 7.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|006040
MCRFVIYKGTSPVQLSHLLTRPCHSIINQAFDSRLRLDRRRPMNGDGFGVGWYDSVYDPELGGQPCIFTSVTPAW
NNANLARLAVKIKSPLVFAHVRATTAGSLSLDNCHPFAYENLMFMHNGNIADFHLFKRRLQADLPDHLFSFVQGN
TDSEWSFALFLSKVPDPNARSFSPEILRNAMLETITSLNQYAEDAGVTEPSLMNFCVTDGSSIVVSRYISSRKDE
AASLWFSSGTEFNEYAEGGHYRMSKSDKRENIIMIASEPLTFERADWMEIKTNHLVVITPKMNLLQIPIEDKYFV
SPSDPASLARDTDFAEEKGLLNPLTRQSKLAHDAAATAHESPFKRQVTAEH*
Coding >AgabiH97|006040
ATGTGTCGATTCGTCATATATAAAGGAACTTCACCTGTACAACTCTCCCATCTTCTCACACGACCATGTCATTCT
ATCATCAACCAAGCCTTTGATTCTCGACTTCGACTGGATAGACGGAGGCCAATGAATGGCGACGGATTTGGCGTT
GGATGGTACGATTCGGTCTATGATCCAGAACTCGGAGGTCAACCTTGCATATTCACGTCTGTGACGCCTGCGTGG
AACAATGCTAATCTAGCTCGACTAGCTGTCAAGATCAAGTCTCCCCTTGTATTTGCTCACGTTCGCGCCACCACT
GCGGGATCGCTGTCCTTGGACAACTGCCACCCTTTCGCTTACGAAAACTTGATGTTTATGCACAACGGAAATATT
GCAGATTTCCATCTTTTCAAACGGCGCCTCCAAGCCGACCTACCGGACCACTTATTCTCTTTCGTCCAAGGCAAT
ACAGACTCCGAATGGTCGTTTGCACTTTTTCTATCCAAAGTACCTGACCCCAATGCACGGAGTTTCTCTCCAGAG
ATCCTGCGCAACGCCATGCTGGAAACCATTACATCACTAAATCAGTATGCTGAAGATGCTGGAGTGACTGAACCA
AGTTTGATGAATTTTTGTGTGACCGATGGGTCAAGCATCGTAGTATCGCGTTACATCTCCTCGAGAAAGGACGAG
GCAGCATCCTTGTGGTTCTCTTCTGGAACAGAGTTCAACGAATACGCTGAGGGTGGCCATTACAGAATGTCAAAG
TCGGACAAGCGGGAAAACATAATAATGATTGCAAGCGAACCCTTAACATTTGAGAGGGCGGACTGGATGGAGATC
AAGACAAACCACTTGGTGGTAATTACACCCAAGATGAATCTATTACAGATTCCGATCGAAGACAAGTATTTTGTT
TCCCCGTCAGACCCGGCTTCACTTGCTCGCGATACAGACTTTGCCGAGGAGAAGGGGTTGTTAAATCCATTGACT
CGACAGAGCAAGCTGGCACACGACGCGGCCGCTACAGCGCATGAATCTCCATTCAAACGACAGGTCACTGCTGAG
CATTGA
Transcript >AgabiH97|006040
ATGTGTCGATTCGTCATATATAAAGGAACTTCACCTGTACAACTCTCCCATCTTCTCACACGACCATGTCATTCT
ATCATCAACCAAGCCTTTGATTCTCGACTTCGACTGGATAGACGGAGGCCAATGAATGGCGACGGATTTGGCGTT
GGATGGTACGATTCGGTCTATGATCCAGAACTCGGAGGTCAACCTTGCATATTCACGTCTGTGACGCCTGCGTGG
AACAATGCTAATCTAGCTCGACTAGCTGTCAAGATCAAGTCTCCCCTTGTATTTGCTCACGTTCGCGCCACCACT
GCGGGATCGCTGTCCTTGGACAACTGCCACCCTTTCGCTTACGAAAACTTGATGTTTATGCACAACGGAAATATT
GCAGATTTCCATCTTTTCAAACGGCGCCTCCAAGCCGACCTACCGGACCACTTATTCTCTTTCGTCCAAGGCAAT
ACAGACTCCGAATGGTCGTTTGCACTTTTTCTATCCAAAGTACCTGACCCCAATGCACGGAGTTTCTCTCCAGAG
ATCCTGCGCAACGCCATGCTGGAAACCATTACATCACTAAATCAGTATGCTGAAGATGCTGGAGTGACTGAACCA
AGTTTGATGAATTTTTGTGTGACCGATGGGTCAAGCATCGTAGTATCGCGTTACATCTCCTCGAGAAAGGACGAG
GCAGCATCCTTGTGGTTCTCTTCTGGAACAGAGTTCAACGAATACGCTGAGGGTGGCCATTACAGAATGTCAAAG
TCGGACAAGCGGGAAAACATAATAATGATTGCAAGCGAACCCTTAACATTTGAGAGGGCGGACTGGATGGAGATC
AAGACAAACCACTTGGTGGTAATTACACCCAAGATGAATCTATTACAGATTCCGATCGAAGACAAGTATTTTGTT
TCCCCGTCAGACCCGGCTTCACTTGCTCGCGATACAGACTTTGCCGAGGAGAAGGGGTTGTTAAATCCATTGACT
CGACAGAGCAAGCTGGCACACGACGCGGCCGCTACAGCGCATGAATCTCCATTCAAACGACAGGTCACTGCTGAG
CATTGA
Gene >AgabiH97|006040
ATGTGTCGATTCGTCATATATAAAGGAACTTCACCTGTACAACTCTCCCATGTTTGTCCCTTAGAGTGTTCGTTG
AGGTTAGCTGAAGTTGACAGTCGTTCTCTCCAGCTTCTCACACGACCATGTCATTCTATCATCAACCAAGCCTTT
GATTCTCGACTTCGACTGGATAGACGGAGGCCAATGAATGGCGACGGATTTGGCGTTGGTTAGAGTTTGAAATTG
AGGTCTGCCTTAGCCTGAATAACCTCAACAACAGGATGGTACGATTCGGTCTATGATCCAGAACTCGGAGGTCAA
CCTTGCATATTCACGTCTGTGACGCCTGTGAGCTTCTTTAGACGTGGTTCATCGTCGGAAAACGTGCTCACAGAG
TGACCAGGCGTGGAACAATGCTAATCTAGCTCGACTAGCTGTCAAGATCAAGTCTCCCCTTGTATTGTGCATACT
CTCTCTTCTTGGGTCCTGCTTTAGTACCTTAATATCCGTACCAGTGCTCACGTTCGCGCCACCACTGCGGGATCG
CTGTCCTTGGACAACTGCCACCCTTTCGCTTACGAAAACTTGATGGTACGAGTCTTTCTGCATCCATACCAGAAA
AGGCGCTCATCAAAAATGGTAGTTTATGCACAACGGAAATATTGCAGATTTCCATCTTTTCAAACGGCGCCTCCA
AGCCGACCTACCGGACCACTTATTCTCTTTCGTCCAAGGCAATACAGACTCCGAATGGTCGTTTGCACTTTTTCT
ATCCAAAGTCTGTTGTGCAACTTGTCTCTTGTCCTTTGCTGTTACTTACACAGCATCAGGTACCTGACCCCAATG
CACGGAGTTTCTCTCCAGAGATCCTGCGCAACGCCATGCTGGAAACCATTACATCACTAAATCAGTATGCTGAAG
ATGCTGGAGTGACTGAACCAAGTTTGATGAATTTTTGTGTGACCGATGGGTCAAGCATCGTAGTATCGCGTTACA
TCTCCTCGAGAAAGGACGAGGCAGCATCCTTGGTATCTATGATTTAATGTTATCCGCTCCATGCACTGATCATTT
GTACTAGTGGTTCTCTTCTGGAACAGAGTTCAACGAATACGCTGAGGGTGGCCATTACAGAATGTCAAAGTCGGA
CAAGCGGGAAAACATAATAATGATTGCAAGCGAACCCTTAACATTTGAGAGGGGTAAGCACTGGGTTTGAACGGG
TTCAGCTTGGTTACTGACATAATCTGGCTAGCGGACTGGATGGAGATCAAGACAAACCACTTGGTGGTAATTACA
CCCAAGATGAATCTATTACAGATTCCGATCGAAGACAAGTATTTTGTTTCCCCGTCAGACCCGGCTTCACTTGCT
CGCGATACAGACTTTGCCGAGGAGAAGGGGTTGTTAAATCCATTGACTCGACAGAGCAAGCTGGCACACGACGCG
GCCGCTACAGCGCATGAATCTCCATTCAAACGACAGGTCACTGCTGAGCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail