Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|005950
Gene name
Locationscaffold_1:1459580..1460338
Strand-
Gene length (bp)758
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P04927|SANT_PLAFF S-antigen protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) PE=4 SV=1 70 231 1.0E-10
sp|P04927|SANT_PLAFF S-antigen protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) PE=4 SV=1 63 212 1.0E-10
sp|P04927|SANT_PLAFF S-antigen protein OS=Plasmodium falciparum (isolate FC27 / Papua New Guinea) PE=4 SV=1 49 190 3.0E-09
sp|A8YPR9|SVMI1_CERCE Snake venom metalloprotease inhibitor 02A10 OS=Cerastes cerastes GN=Svmpi-Cce12 PE=1 SV=1 55 216 3.0E-07
sp|A8YPR9|SVMI1_CERCE Snake venom metalloprotease inhibitor 02A10 OS=Cerastes cerastes GN=Svmpi-Cce12 PE=1 SV=1 55 210 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|005950
MRAFFIISALFLAFASQIMGAPVKMPMPLAREAKSIETFSAYVRRQGLSVEEPVSKRSDVPVERPSKSLNGVVEA
YDKRSDVPVERPSKSLNGVVEAYDKRSDVPVERPSKSLNGVVEAYDKRSDVPVERPSKSINGVVEAYDKRSDVPV
ERPSKSLNGVVEAYDKRSDVPVERPSKSTNGVVEAYDKRSDVPVERPSKSLNGVVEAYDKRSDVPVERPSQSLQG
VVEPYN*
Coding >AgabiH97|005950
ATGCGTGCCTTCTTCATCATCTCCGCGCTTTTCCTCGCTTTCGCTAGTCAGATCATGGGAGCTCCTGTTAAAATG
CCCATGCCCCTTGCACGCGAGGCAAAATCGATTGAAACTTTTAGTGCTTATGTCCGTCGCCAGGGCCTCTCAGTA
GAGGAGCCAGTCAGCAAGAGGAGCGATGTACCCGTCGAGCGGCCATCCAAGTCCCTCAACGGAGTCGTCGAAGCT
TATGACAAGAGGAGCGATGTACCTGTCGAGCGGCCGTCCAAGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAG
AGAAGCGATGTACCCGTCGAGCGGCCTTCCAAGTCCCTTAACGGAGTCGTCGAGGCATATGACAAGAGGAGCGAT
GTACCTGTCGAGCGACCATCCAAATCCATCAACGGAGTCGTCGAAGCTTATGACAAGAGGAGCGATGTACCTGTC
GAGCGGCCTTCCAAGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAGAGGAGTGACGTACCCGTCGAGCGGCCA
TCCAAGTCCACCAACGGAGTCGTAGAAGCCTACGACAAGAGAAGTGATGTACCCGTCGAGAGGCCGTCCAAGTCC
CTCAACGGAGTCGTCGAGGCATATGACAAGAGGAGCGATGTACCCGTTGAGCGGCCATCCCAATCCCTCCAGGGA
GTCGTTGAACCCTACAATTGA
Transcript >AgabiH97|005950
ATGCGTGCCTTCTTCATCATCTCCGCGCTTTTCCTCGCTTTCGCTAGTCAGATCATGGGAGCTCCTGTTAAAATG
CCCATGCCCCTTGCACGCGAGGCAAAATCGATTGAAACTTTTAGTGCTTATGTCCGTCGCCAGGGCCTCTCAGTA
GAGGAGCCAGTCAGCAAGAGGAGCGATGTACCCGTCGAGCGGCCATCCAAGTCCCTCAACGGAGTCGTCGAAGCT
TATGACAAGAGGAGCGATGTACCTGTCGAGCGGCCGTCCAAGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAG
AGAAGCGATGTACCCGTCGAGCGGCCTTCCAAGTCCCTTAACGGAGTCGTCGAGGCATATGACAAGAGGAGCGAT
GTACCTGTCGAGCGACCATCCAAATCCATCAACGGAGTCGTCGAAGCTTATGACAAGAGGAGCGATGTACCTGTC
GAGCGGCCTTCCAAGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAGAGGAGTGACGTACCCGTCGAGCGGCCA
TCCAAGTCCACCAACGGAGTCGTAGAAGCCTACGACAAGAGAAGTGATGTACCCGTCGAGAGGCCGTCCAAGTCC
CTCAACGGAGTCGTCGAGGCATATGACAAGAGGAGCGATGTACCCGTTGAGCGGCCATCCCAATCCCTCCAGGGA
GTCGTTGAACCCTACAATTGA
Gene >AgabiH97|005950
ATGCGTGCCTTCTTCATCATCTCCGCGCTTTTCCTCGCTTTCGCTAGTCAGATCATGGGAGCTCCTGTTAAAATG
CCCATGCCCCTTGCAGTCAGTCCTTTCATGCCTTGCTTCATTTTTCCATCGCTTCTAACGCAGAGGATGGTCAAC
AGCGCGAGGCAAAATCGATTGAAACTTTTAGTGCTTATGTCCGTCGCCAGGGCCTCTCAGTAGAGGAGCCAGTCA
GCAAGAGGAGCGATGTACCCGTCGAGCGGCCATCCAAGTCCCTCAACGGAGTCGTCGAAGCTTATGACAAGAGGA
GCGATGTACCTGTCGAGCGGCCGTCCAAGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAGAGAAGCGATGTAC
CCGTCGAGCGGCCTTCCAAGTCCCTTAACGGAGTCGTCGAGGCATATGACAAGAGGAGCGATGTACCTGTCGAGC
GACCATCCAAATCCATCAACGGAGTCGTCGAAGCTTATGACAAGAGGAGCGATGTACCTGTCGAGCGGCCTTCCA
AGTCCCTCAACGGAGTCGTCGAGGCGTATGACAAGAGGAGTGACGTACCCGTCGAGCGGCCATCCAAGTCCACCA
ACGGAGTCGTAGAAGCCTACGACAAGAGAAGTGATGTACCCGTCGAGAGGCCGTCCAAGTCCCTCAACGGAGTCG
TCGAGGCATATGACAAGAGGAGCGATGTACCCGTTGAGCGGCCATCCCAATCCCTCCAGGGAGTCGTTGAACCCT
ACAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail