Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|005680
Gene name
Locationscaffold_1:1400091..1402615
Strand+
Gene length (bp)2524
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.7E-31 78 476

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 8 536 5.0E-49
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 7 531 7.0E-48
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 54 496 6.0E-19
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 7 274 2.0E-18
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 22 377 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 8 536 5.0E-49
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 7 531 7.0E-48
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 54 496 6.0E-19
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 7 274 2.0E-18
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 22 377 3.0E-17
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 7 527 1.0E-16
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 51 315 1.0E-15
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 56 377 4.0E-13
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 47 277 4.0E-11
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 39 527 4.0E-11
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 57 462 5.0E-11
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 48 435 6.0E-11
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 48 435 6.0E-11
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 58 499 7.0E-11
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 93 479 8.0E-11
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 24 533 2.0E-10
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 130 247 4.0E-10
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 57 527 4.0E-10
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 24 526 7.0E-10
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 34 533 8.0E-10
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 34 533 1.0E-09
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 15 527 2.0E-09
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 88 250 2.0E-08
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 57 527 2.0E-08
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 130 243 1.0E-07
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 117 248 2.0E-07
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 117 248 2.0E-07
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 56 527 5.0E-07
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 56 250 3.0E-06
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 130 248 4.0E-06
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 130 407 5.0E-06
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 53 273 6.0E-06
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 53 273 6.0E-06
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 53 273 6.0E-06
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 53 273 6.0E-06
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 53 273 6.0E-06
sp|Q8ZCH3|NANT_YERPE Putative sialic acid transporter OS=Yersinia pestis GN=nanT PE=3 SV=1 53 273 7.0E-06
sp|Q1C5V2|NANT_YERPA Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nanT PE=3 SV=1 53 273 7.0E-06
sp|B1JFW5|NANT_YERPY Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nanT PE=3 SV=1 53 273 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 109 131 22
3 138 160 22
4 170 192 22
5 199 221 22
6 225 247 22
7 315 334 19
8 339 361 22
9 368 390 22
10 405 427 22
11 434 456 22
12 466 488 22
13 500 522 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|005680
MAFGILEDHYLENVPGTALLTDLSVSRGKQVVINEARKMKMGSGQYSHIVLVPQPSDDPNDPLNWPRWKKELCFW
TLAFAASLDGALSPMVAPGYVLLSQQFALSVDDVASAFGSILLGLGCFMLAQNALAAKFGQRIVYLASVFLMFIS
CIWCALSPSISSIRASRVFQGFGMSALQSLVASTLEQIYFVHERGSRNVIWHFSILSGITLGPLLYSYVIQNLSW
QMGFWFVSIPLGLAVILVFFFVPETTFIRETNNGLSEGHRSSDSKGIDNCVNDEEKSSSSSNHVSPSRASYPQQL
KIWHGTFTNVNLFKLFLRPFPFLLSPVFWFVFLAYGMQTAWLSLLPICSSTIFTIEYNFTASQIGLTNLGGLVGI
VLATLISGPLTDWGTVWLAKYNKGIYEPEFRIWFVSTMVLGVFGYAGWAVGTTHNMPWIGAVACMAMANFSMVMS
GSASITYLLDTHGPHALHVLAVVNFTKNMVLYGFTFFVNGMVESRGVKTSLLILAGCQAFCWLASIPMYVFGKRA
RSFIARHPRLFTVGDDGVPSH*
Coding >AgabiH97|005680
ATGGCGTTTGGAATACTCGAGGACCATTACTTAGAAAACGTTCCGGGAACAGCGCTGCTCACCGACCTCAGTGTG
AGCAGAGGTAAACAGGTCGTCATCAATGAAGCACGAAAAATGAAAATGGGAAGTGGCCAATACTCTCATATAGTC
CTAGTGCCCCAGCCATCTGATGATCCAAACGACCCCTTGAATTGGCCTCGATGGAAGAAGGAACTATGCTTCTGG
ACGCTAGCCTTTGCGGCGTCATTAGACGGCGCCCTTAGTCCCATGGTCGCTCCAGGATATGTTTTACTCTCACAG
CAATTTGCTCTCAGTGTAGACGATGTCGCTTCTGCATTTGGGTCAATTTTGCTCGGCTTGGGTTGCTTCATGCTA
GCTCAGAATGCCTTAGCCGCCAAGTTTGGACAAAGAATAGTGTATCTAGCCTCTGTTTTCTTGATGTTCATTTCA
TGCATCTGGTGCGCACTTAGCCCCAGCATTTCATCAATTCGCGCGTCCCGTGTATTTCAAGGCTTTGGGATGTCG
GCCTTGCAAAGTCTCGTCGCATCGACGCTCGAACAAATTTACTTTGTCCACGAACGAGGCAGTCGCAACGTCATT
TGGCATTTTTCAATCTTGTCAGGCATTACGCTCGGACCTCTGTTATATAGCTATGTCATACAGAACCTATCATGG
CAGATGGGTTTCTGGTTTGTATCAATTCCTCTTGGACTTGCAGTGATACTTGTGTTTTTCTTCGTGCCGGAGACG
ACCTTTATTCGAGAAACCAACAATGGCCTGAGCGAGGGGCATCGTTCTTCGGATTCCAAAGGAATCGATAATTGT
GTCAATGACGAAGAAAAAAGTTCTAGCTCCAGCAACCATGTGTCACCCTCCCGCGCGAGCTATCCCCAACAATTA
AAGATCTGGCACGGCACGTTCACCAACGTCAACTTGTTTAAACTGTTTCTCCGGCCATTTCCCTTCCTCCTCTCT
CCAGTGTTCTGGTTTGTATTTCTAGCGTATGGAATGCAAACTGCTTGGCTCAGTTTGTTGCCAATCTGCTCCTCC
ACCATCTTTACCATTGAATACAATTTCACTGCTTCTCAAATTGGTTTAACGAATCTCGGAGGACTTGTTGGTATT
GTGTTAGCAACTTTGATATCAGGTCCCTTGACGGATTGGGGAACCGTATGGTTGGCAAAGTATAATAAGGGTATT
TATGAACCCGAATTCAGAATATGGTTCGTCTCTACAATGGTACTTGGTGTCTTTGGGTATGCGGGCTGGGCAGTT
GGCACGACACATAATATGCCTTGGATAGGAGCCGTCGCTTGCATGGCAATGGCTAACTTCAGCATGGTTATGAGT
GGTTCAGCATCGATCACTTATTTGTTGGATACTCATGGACCTCACGCATTGCATGTGCTGGCTGTGGTCAATTTC
ACAAAAAACATGGTCTTATATGGGTTCACGTTCTTCGTGAATGGCATGGTCGAGAGCAGAGGTGTCAAGACATCT
TTGTTGATTTTGGCTGGGTGCCAAGCCTTCTGTTGGCTTGCATCAATTCCCATGTATGTCTTCGGAAAGAGAGCC
CGGTCATTTATTGCCAGGCACCCAAGACTCTTCACAGTTGGAGACGATGGTGTTCCTTCTCATTAA
Transcript >AgabiH97|005680
ATGGCGTTTGGAATACTCGAGGACCATTACTTAGAAAACGTTCCGGGAACAGCGCTGCTCACCGACCTCAGTGTG
AGCAGAGGTAAACAGGTCGTCATCAATGAAGCACGAAAAATGAAAATGGGAAGTGGCCAATACTCTCATATAGTC
CTAGTGCCCCAGCCATCTGATGATCCAAACGACCCCTTGAATTGGCCTCGATGGAAGAAGGAACTATGCTTCTGG
ACGCTAGCCTTTGCGGCGTCATTAGACGGCGCCCTTAGTCCCATGGTCGCTCCAGGATATGTTTTACTCTCACAG
CAATTTGCTCTCAGTGTAGACGATGTCGCTTCTGCATTTGGGTCAATTTTGCTCGGCTTGGGTTGCTTCATGCTA
GCTCAGAATGCCTTAGCCGCCAAGTTTGGACAAAGAATAGTGTATCTAGCCTCTGTTTTCTTGATGTTCATTTCA
TGCATCTGGTGCGCACTTAGCCCCAGCATTTCATCAATTCGCGCGTCCCGTGTATTTCAAGGCTTTGGGATGTCG
GCCTTGCAAAGTCTCGTCGCATCGACGCTCGAACAAATTTACTTTGTCCACGAACGAGGCAGTCGCAACGTCATT
TGGCATTTTTCAATCTTGTCAGGCATTACGCTCGGACCTCTGTTATATAGCTATGTCATACAGAACCTATCATGG
CAGATGGGTTTCTGGTTTGTATCAATTCCTCTTGGACTTGCAGTGATACTTGTGTTTTTCTTCGTGCCGGAGACG
ACCTTTATTCGAGAAACCAACAATGGCCTGAGCGAGGGGCATCGTTCTTCGGATTCCAAAGGAATCGATAATTGT
GTCAATGACGAAGAAAAAAGTTCTAGCTCCAGCAACCATGTGTCACCCTCCCGCGCGAGCTATCCCCAACAATTA
AAGATCTGGCACGGCACGTTCACCAACGTCAACTTGTTTAAACTGTTTCTCCGGCCATTTCCCTTCCTCCTCTCT
CCAGTGTTCTGGTTTGTATTTCTAGCGTATGGAATGCAAACTGCTTGGCTCAGTTTGTTGCCAATCTGCTCCTCC
ACCATCTTTACCATTGAATACAATTTCACTGCTTCTCAAATTGGTTTAACGAATCTCGGAGGACTTGTTGGTATT
GTGTTAGCAACTTTGATATCAGGTCCCTTGACGGATTGGGGAACCGTATGGTTGGCAAAGTATAATAAGGGTATT
TATGAACCCGAATTCAGAATATGGTTCGTCTCTACAATGGTACTTGGTGTCTTTGGGTATGCGGGCTGGGCAGTT
GGCACGACACATAATATGCCTTGGATAGGAGCCGTCGCTTGCATGGCAATGGCTAACTTCAGCATGGTTATGAGT
GGTTCAGCATCGATCACTTATTTGTTGGATACTCATGGACCTCACGCATTGCATGTGCTGGCTGTGGTCAATTTC
ACAAAAAACATGGTCTTATATGGGTTCACGTTCTTCGTGAATGGCATGGTCGAGAGCAGAGGTGTCAAGACATCT
TTGTTGATTTTGGCTGGGTGCCAAGCCTTCTGTTGGCTTGCATCAATTCCCATGTATGTCTTCGGAAAGAGAGCC
CGGTCATTTATTGCCAGGCACCCAAGACTCTTCACAGTTGGAGACGATGGTGTTCCTTCTCATTAA
Gene >AgabiH97|005680
ATGGCGTTTGGAATACTCGGTAAACTCTCTTCGATCGCCTTACACGGGCACACTCATAACTTGAACCAGAGGACC
ATTACTTAGAAAACGTTCCGGGAACAGCGCTGCTCACCGACCTCAGTGTGAGCAGAGGTAAACAGGTGACCTGAT
TTGCTTTCTATGTCGAGATACACCGTCAAATCAATACCGATTATAGGTCGTCATCAATGAAGCACGAAAAATGAA
AATGGGAAGTGGCCAATACTCTCATATAGTCCTAGTGCCCCAGCCATCTGATGATCCAAACGACCCGTAAGTCTT
GGCTGAGTAACCACCCACCTTTATGGCTTGACCACATCCACGATAATAGCTTGAATTGGCCTCGATGGAAGAAGG
AACTATGCTTCTGGACGCTGTAAGTTGCAAACACATTATGAGCTACTTGTTAATGGAATATGATATAGAGCCTTT
GCGGCGTCATTAGACGGCGCCCTTAGTCCCATGGTCGCTCCAGGATATGTTTTACTCTCACAGCAATTTGCTCTC
AGTGTAGACGATGTCGCTTCTGCATTTGGGTCAATTTTGCTCGGCTTGGGTTGCTTCATGTACGAGGTTTCTCAT
AGACAAGAATCTCTTCAAAGCTTACGGTTGTTTAGGCTAGCTCAGAATGCCTTAGCCGCCAAGTTTGGACAAAGA
ATAGTGTATCTAGCCTCTGTTTTCTTGGTATGTCAGGGGGGGGTAGAAAGAACTCACGATTTGCTTATAAAATCT
AGATGTTCATTTCATGCATCTGGTGCGCACTTAGCCCCAGCATTTCATCAATTCGCGCGTCCCGTGTATTTCAAG
GCTTTGGGATGTCGGCCTTGCAAAGGTGGTTTCACCTCTGAATATCTTTCCAGGGTCGATGGTTTACTGATGGAT
GTAAACTTTCACCAGTCTCGTCGCATCGACGCTCGAACAAATTTACTTGTACGACCTTTAGTTTTATGTCACAGC
TATGCAGACCGAGTTGACTTTTGTGTTCAGTGTCCACGAACGAGGCAGTCGCAACGTCATTTGGCATTTTTCAAT
CTTGTCAGGCATTACGCTGTCAGTGTTGTTTACGTTGGAGAACAAGAGATCATTTGAGACAGCTTAAACTTTCCC
AACAGCGGACCTCTGTTATATAGCTATGTCATACAGAACCTATCATGGCAGATGGGTTTCTGGTTTGTATCAATT
CCTCTTGGACTTGCAGTGATACTTGTGTTTTTCTTCGTGCCGGAGGTTAGTGAACTTTTCCAGGTCGCTTTCAGA
GGTTGACCACCGATTTCTGGCTTTAGACGACCTTTATTCGAGAAACCAACAATGGCCTGAGCGAGGGGCATCGTT
CTTCGGATTCCAAAGGAATCGATAATTGTGTCAATGACGAAGAAAAAAGTTCTAGCTCCAGCAACCATGTGTCAC
CCTCCCGCGCGAGCTATCCCCAACAATTAAAGATCTGGCACGGCACGTTCACCAACGTCAACTTGTTTAAACTGT
TTCTCCGGCCATTTCCCTTCCTCCTCTCTCCAGTGGTGAGTATTCTGAGTGTTATCACCGTTGTACTTGATTGCA
TATACTGATGAACAATACTCAGTTCTGGTTTGTATTTCTAGCGTATGGAATGCAAACTGCTTGGCTCAGTACGCT
GTTCAGTTGTTGTTTCCATTGCTTAGGATGCTGACGAACACCATAGGTTTGTTGCCAATCTGCTCCTCCACCATC
TTTACCATTGAATACAATTTCACTGCTTCTCAAATTGTGAGTTTTGGTCTTCTCAGGAGCATCTTTTATTTATCA
TCACAAATATTAAGGGTTTAACGAATCTCGGAGGACTTGTTGGTATTGTGTTAGCAACTTTGATATCAGGTCCCT
TGACGGATTGGGGAACCGTATGGTTGGCAAAGTATAATAAGGGTATTTATGAACCCGAATTCAGAATATGGTTCG
TCTCTACAATGGTACTTGGTGTCTTTGGGTATGCGGGCTGGGCAGGTGAGTGATCAACTGATACATTGTCGCATC
TCTTAACCTTTATGACATTAGTTGGCACGACACATAATATGCCTTGGATAGGAGCCGTCGCTTGCATGGCGTTCG
TCAATTCATCCACCCTTCAAGCTTCAGATATGACCATGACTGATCACATTACATAGAATGGCTAACTTCAGCATG
GTTATGAGTGGTTCAGCATCGATCACTTATTTGTTGGATACTCATGGACCTCACGCATTGCATGTGCTGGCTGTG
GTCAATTTCACAAAAAACATGGTCTTATATGGGTTCACGTTCTTCGTGAATGGCATGGTCGAGAGCAGAGGTGTC
AAGACATCTTTGTTGATTTTGGCTGGGTGCCAAGCCTTCTGTTGGCTTGCATCAATTCCCATGTATGTCTTCGGA
AAGAGAGCCCGGTCATTTGTGAGTAGCACCCATTTTCAAGGCAAGGCGTACAGTAATAGTAGTTCAGATTGCCAG
GCACCCAAGACTCTTCACAGTTGGAGACGATGGTGTTCCTTCTCATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail