Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|005540
Gene name
Locationscaffold_1:1371536..1373622
Strand+
Gene length (bp)2086
Transcript length (bp)1929
Coding sequence length (bp)1929
Protein length (aa) 643

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 5.7E-09 113 154
PF13639 zf-RING_2 Ring finger domain 8.4E-08 112 154
PF13445 zf-RING_UBOX RING-type zinc-finger 4.2E-08 113 152
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.6E-06 113 154

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q32NQ8|RNF10_XENLA RING finger protein 10 OS=Xenopus laevis GN=rnf10 PE=2 SV=1 12 535 4.0E-54
sp|Q08E13|RNF10_BOVIN RING finger protein 10 OS=Bos taurus GN=RNF10 PE=2 SV=1 12 509 3.0E-51
sp|Q8N5U6|RNF10_HUMAN RING finger protein 10 OS=Homo sapiens GN=RNF10 PE=1 SV=2 12 509 4.0E-51
sp|Q5XI59|RNF10_RAT RING finger protein 10 OS=Rattus norvegicus GN=Rnf10 PE=2 SV=1 12 307 2.0E-37
sp|Q3UIW5|RNF10_MOUSE RING finger protein 10 OS=Mus musculus GN=Rnf10 PE=2 SV=2 12 303 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q32NQ8|RNF10_XENLA RING finger protein 10 OS=Xenopus laevis GN=rnf10 PE=2 SV=1 12 535 4.0E-54
sp|Q08E13|RNF10_BOVIN RING finger protein 10 OS=Bos taurus GN=RNF10 PE=2 SV=1 12 509 3.0E-51
sp|Q8N5U6|RNF10_HUMAN RING finger protein 10 OS=Homo sapiens GN=RNF10 PE=1 SV=2 12 509 4.0E-51
sp|Q5XI59|RNF10_RAT RING finger protein 10 OS=Rattus norvegicus GN=Rnf10 PE=2 SV=1 12 307 2.0E-37
sp|Q3UIW5|RNF10_MOUSE RING finger protein 10 OS=Mus musculus GN=Rnf10 PE=2 SV=2 12 303 2.0E-37
sp|O94271|YORN_SCHPO Uncharacterized RING finger protein P8B7.23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.23 PE=3 SV=1 6 271 7.0E-34
sp|O94271|YORN_SCHPO Uncharacterized RING finger protein P8B7.23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.23 PE=3 SV=1 408 581 3.0E-20
sp|Q06436|MAG2_YEAST RING-finger protein MAG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAG2 PE=1 SV=1 17 170 5.0E-16
sp|Q5XI59|RNF10_RAT RING finger protein 10 OS=Rattus norvegicus GN=Rnf10 PE=2 SV=1 408 509 1.0E-09
sp|Q3UIW5|RNF10_MOUSE RING finger protein 10 OS=Mus musculus GN=Rnf10 PE=2 SV=2 407 509 1.0E-09
sp|Q06436|MAG2_YEAST RING-finger protein MAG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAG2 PE=1 SV=1 404 481 4.0E-08
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 106 163 5.0E-08
sp|Q864U1|BRCA1_BOVIN Breast cancer type 1 susceptibility protein homolog OS=Bos taurus GN=BRCA1 PE=1 SV=1 113 175 2.0E-06
sp|Q6J6J0|BRCA1_PONPY Breast cancer type 1 susceptibility protein homolog OS=Pongo pygmaeus GN=BRCA1 PE=3 SV=1 113 175 2.0E-06
sp|P38398|BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens GN=BRCA1 PE=1 SV=2 113 175 2.0E-06
sp|O54952|BRCA1_RAT Breast cancer type 1 susceptibility protein homolog OS=Rattus norvegicus GN=Brca1 PE=1 SV=1 113 182 2.0E-06
sp|Q6J6I9|BRCA1_MACMU Breast cancer type 1 susceptibility protein homolog OS=Macaca mulatta GN=BRCA1 PE=3 SV=1 113 175 2.0E-06
sp|Q9GKK8|BRCA1_PANTR Breast cancer type 1 susceptibility protein homolog OS=Pan troglodytes GN=BRCA1 PE=2 SV=2 113 175 2.0E-06
sp|Q6J6I8|BRCA1_GORGO Breast cancer type 1 susceptibility protein homolog OS=Gorilla gorilla gorilla GN=BRCA1 PE=3 SV=1 113 175 2.0E-06
sp|Q95153|BRCA1_CANLF Breast cancer type 1 susceptibility protein homolog OS=Canis lupus familiaris GN=BRCA1 PE=3 SV=1 113 175 3.0E-06
sp|Q5PPX5|RN170_XENLA E3 ubiquitin-protein ligase RNF170 OS=Xenopus laevis GN=rnf170 PE=2 SV=1 102 159 3.0E-06
sp|Q28DS3|RN170_XENTR E3 ubiquitin-protein ligase RNF170 OS=Xenopus tropicalis GN=rnf170 PE=2 SV=1 102 159 5.0E-06
sp|Q8CBG9|RN170_MOUSE E3 ubiquitin-protein ligase RNF170 OS=Mus musculus GN=Rnf170 PE=1 SV=1 101 159 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|005540
MSGLPSHRTAKPAASNLNHLLNFSLPPRQSRPLSSLPRRARKTGNSHGIWNKERFVNAQYRFVMNPNGDYTAHFA
DPDIFFQWQDILQVIIPRSPVLTFASPSFSQDDNQTACPICLSPPTAPRMTKCGHIFCFSCILHYLSTSDNKWVR
CPICFDSVTERQLKSVKWFDGLVHDSDNVVDSPPVPSSSSSVIDNTFESMPALGSSLSMRLIQRPQITTLALPRS
HTWPSDLLPPHQAPFHFLPDVYSFAKFMLATPAHLISDLTGDLDQLASERRTLASFDDDLGTCFIDAAETRVRLQ
IAAAAALDTPALKAKVEKAIRDKTDLEERTAFHQMRRKNEQLARKVPQEEVPVDFLAIKSPSTHSSAPSTPAEFE
TDTPREVSARLQPRNHPKQRRNVNPPPPNTQTYYYYQAASGLPIYLHPLDIRILLSHFGTYPAFPGTITVKVEGY
SESTIDDNLRKRCKYLAHLPEGADVVFVEADLEDVVGADSLKNFESLLKSRILRRKEKGKKDDKAKARAEERERE
REKHWASSLVYSSSRPEAIAIQEIVDHSSSSTSELENSSSLPRQNSGAWGTKSFASALHSPSTPVNDNRGQDKPR
EKKEDEWDMDAAWHELQQQRSGGGKKKNTKLVILGGGGGRRR*
Coding >AgabiH97|005540
ATGTCTGGCCTGCCCTCCCACCGCACGGCCAAGCCTGCTGCATCCAATCTGAACCATCTCCTCAACTTCTCCCTC
CCTCCTAGACAGTCTCGGCCGCTTTCCTCCCTCCCCCGCAGGGCCAGAAAGACAGGAAACAGCCATGGCATCTGG
AACAAAGAACGCTTCGTCAATGCCCAGTATCGGTTCGTCATGAACCCCAACGGCGACTACACCGCCCATTTCGCA
GATCCAGACATTTTCTTCCAGTGGCAGGACATACTGCAGGTCATCATACCCCGGTCGCCGGTCCTGACGTTTGCT
TCCCCCTCGTTCTCTCAGGACGATAATCAGACTGCCTGCCCTATTTGCCTATCTCCCCCTACCGCCCCTCGTATG
ACCAAGTGTGGCCATATCTTCTGTTTCTCGTGCATCCTCCATTACCTGAGCACTTCAGACAATAAATGGGTCCGC
TGCCCAATCTGCTTTGACTCGGTCACCGAACGCCAGCTCAAGTCTGTCAAGTGGTTCGATGGGCTCGTCCATGAC
TCTGATAATGTCGTGGATTCTCCGCCAGTACCCTCATCGTCTTCGTCCGTCATTGATAACACCTTTGAGAGTATG
CCTGCCCTGGGATCGTCTCTGAGTATGCGCCTTATACAGCGGCCGCAAATAACTACACTAGCTCTACCCCGTTCG
CATACATGGCCTTCTGATCTGCTGCCGCCCCACCAGGCCCCGTTCCACTTTCTCCCCGATGTCTACAGTTTCGCT
AAATTCATGCTCGCCACGCCGGCACATCTCATCTCGGATCTCACTGGTGATTTGGATCAATTGGCTTCCGAGCGT
CGGACGCTCGCAAGCTTCGACGACGACCTAGGAACCTGTTTCATTGATGCGGCCGAAACTAGAGTGCGTCTTCAG
ATCGCAGCGGCGGCGGCTCTAGATACTCCTGCTTTGAAGGCCAAGGTTGAAAAGGCTATCAGGGATAAAACTGAT
CTCGAGGAGCGAACGGCTTTCCATCAAATGAGGAGAAAAAATGAGCAACTTGCACGCAAAGTACCTCAGGAAGAA
GTACCGGTGGATTTTCTTGCTATCAAATCACCAAGCACCCATTCGTCCGCACCATCTACACCCGCCGAATTCGAG
ACGGATACCCCTCGCGAGGTCTCGGCACGCCTACAACCTCGCAATCACCCCAAACAACGACGCAACGTCAATCCG
CCGCCACCAAATACCCAGACGTATTACTACTATCAGGCTGCGTCTGGCTTACCGATCTACCTCCATCCACTCGAT
ATCCGAATATTGCTCTCGCATTTTGGCACCTATCCCGCATTCCCCGGCACTATCACTGTGAAAGTTGAGGGCTAC
TCGGAGAGTACAATTGACGACAACCTACGGAAACGCTGTAAATATCTTGCGCATCTACCAGAGGGTGCCGATGTT
GTATTCGTAGAAGCCGACCTAGAAGATGTCGTGGGTGCTGACTCACTCAAGAATTTTGAGTCGTTGCTGAAATCC
CGGATTCTACGGAGGAAAGAGAAAGGAAAGAAGGATGACAAGGCAAAGGCGAGGGCGGAGGAACGAGAGAGGGAG
AGAGAGAAGCATTGGGCGTCGTCTCTGGTCTATTCTAGCTCTCGACCAGAAGCAATTGCAATTCAGGAAATTGTG
GACCACTCCTCGTCGTCCACTTCGGAATTAGAGAATTCATCGTCACTGCCCCGACAGAACTCAGGCGCATGGGGC
ACCAAGAGCTTTGCGTCGGCGCTGCATTCGCCTTCAACGCCTGTCAATGATAATCGTGGACAAGATAAGCCAAGA
GAAAAGAAAGAGGATGAATGGGATATGGATGCGGCTTGGCATGAGTTGCAACAACAGAGGAGTGGTGGTGGCAAG
AAGAAGAATACAAAGCTTGTAATTCTTGGGGGCGGAGGTGGGAGACGGCGTTGA
Transcript >AgabiH97|005540
ATGTCTGGCCTGCCCTCCCACCGCACGGCCAAGCCTGCTGCATCCAATCTGAACCATCTCCTCAACTTCTCCCTC
CCTCCTAGACAGTCTCGGCCGCTTTCCTCCCTCCCCCGCAGGGCCAGAAAGACAGGAAACAGCCATGGCATCTGG
AACAAAGAACGCTTCGTCAATGCCCAGTATCGGTTCGTCATGAACCCCAACGGCGACTACACCGCCCATTTCGCA
GATCCAGACATTTTCTTCCAGTGGCAGGACATACTGCAGGTCATCATACCCCGGTCGCCGGTCCTGACGTTTGCT
TCCCCCTCGTTCTCTCAGGACGATAATCAGACTGCCTGCCCTATTTGCCTATCTCCCCCTACCGCCCCTCGTATG
ACCAAGTGTGGCCATATCTTCTGTTTCTCGTGCATCCTCCATTACCTGAGCACTTCAGACAATAAATGGGTCCGC
TGCCCAATCTGCTTTGACTCGGTCACCGAACGCCAGCTCAAGTCTGTCAAGTGGTTCGATGGGCTCGTCCATGAC
TCTGATAATGTCGTGGATTCTCCGCCAGTACCCTCATCGTCTTCGTCCGTCATTGATAACACCTTTGAGAGTATG
CCTGCCCTGGGATCGTCTCTGAGTATGCGCCTTATACAGCGGCCGCAAATAACTACACTAGCTCTACCCCGTTCG
CATACATGGCCTTCTGATCTGCTGCCGCCCCACCAGGCCCCGTTCCACTTTCTCCCCGATGTCTACAGTTTCGCT
AAATTCATGCTCGCCACGCCGGCACATCTCATCTCGGATCTCACTGGTGATTTGGATCAATTGGCTTCCGAGCGT
CGGACGCTCGCAAGCTTCGACGACGACCTAGGAACCTGTTTCATTGATGCGGCCGAAACTAGAGTGCGTCTTCAG
ATCGCAGCGGCGGCGGCTCTAGATACTCCTGCTTTGAAGGCCAAGGTTGAAAAGGCTATCAGGGATAAAACTGAT
CTCGAGGAGCGAACGGCTTTCCATCAAATGAGGAGAAAAAATGAGCAACTTGCACGCAAAGTACCTCAGGAAGAA
GTACCGGTGGATTTTCTTGCTATCAAATCACCAAGCACCCATTCGTCCGCACCATCTACACCCGCCGAATTCGAG
ACGGATACCCCTCGCGAGGTCTCGGCACGCCTACAACCTCGCAATCACCCCAAACAACGACGCAACGTCAATCCG
CCGCCACCAAATACCCAGACGTATTACTACTATCAGGCTGCGTCTGGCTTACCGATCTACCTCCATCCACTCGAT
ATCCGAATATTGCTCTCGCATTTTGGCACCTATCCCGCATTCCCCGGCACTATCACTGTGAAAGTTGAGGGCTAC
TCGGAGAGTACAATTGACGACAACCTACGGAAACGCTGTAAATATCTTGCGCATCTACCAGAGGGTGCCGATGTT
GTATTCGTAGAAGCCGACCTAGAAGATGTCGTGGGTGCTGACTCACTCAAGAATTTTGAGTCGTTGCTGAAATCC
CGGATTCTACGGAGGAAAGAGAAAGGAAAGAAGGATGACAAGGCAAAGGCGAGGGCGGAGGAACGAGAGAGGGAG
AGAGAGAAGCATTGGGCGTCGTCTCTGGTCTATTCTAGCTCTCGACCAGAAGCAATTGCAATTCAGGAAATTGTG
GACCACTCCTCGTCGTCCACTTCGGAATTAGAGAATTCATCGTCACTGCCCCGACAGAACTCAGGCGCATGGGGC
ACCAAGAGCTTTGCGTCGGCGCTGCATTCGCCTTCAACGCCTGTCAATGATAATCGTGGACAAGATAAGCCAAGA
GAAAAGAAAGAGGATGAATGGGATATGGATGCGGCTTGGCATGAGTTGCAACAACAGAGGAGTGGTGGTGGCAAG
AAGAAGAATACAAAGCTTGTAATTCTTGGGGGCGGAGGTGGGAGACGGCGTTGA
Gene >AgabiH97|005540
ATGTCTGGCCTGCCCTCCCACCGCACGGCCAAGCCTGCTGCATCCAATCTGAACCATCTCCTCAACTTCTCCCTC
CCTCCTAGACAGTCTCGGCCGCTTTCCTCCCTCCCCCGCAGGGCCAGAAAGACAGGAAACAGCCATGGCATCTGG
AACAAAGAACGTGAGCTCCCCGTCGTTTTTCTCTCTTTGCTCACCCTCAGCACCCCCCAGGCTTCGTCAATGCCC
AGTATCGGTTCGTCATGAACCCCAACGGCGACTACACCGCCCATTTCGCAGATCCAGACATGCACGTATCTCACA
CTACGTCTCTTGACCCCCCTTGTTCATCCCCTGTGCTAGTTTCTTCCAGTGGCAGGACATACTGCAGGTCATCAT
ACCCCGGTCGCCGGTCCTGACGTTTGCTTCCCCCTCGTTCTCTCAGGACGATAATCAGACTGCCTGCCCTATTTG
CCTATCTCCCCCTACCGCCCCTCGTATGACCAAGTGTGGCCATGTAAGTCCCCTATCGTATTTCTCCTACTTATC
CTTATGATTCGCCCCTATCTAGATCTTCTGTTTCTCGTGCATCCTCCATTACCTGAGCACTTCAGACAATAAATG
GGTCCGCTGCCCAATCTGCTTTGACTCGGTCACCGAACGCCAGCTCAAGTCTGTCAAGTGGTTCGATGGGCTCGT
CCATGACTCTGATAATGTCGTGGATTCTCCGCCAGTACCCTCATCGTCTTCGTCCGTCATTGATAACACCTTTGA
GAGTATGCCTGCCCTGGGATCGTCTCTGAGTATGCGCCTTATACAGCGGCCGCAAATAACTACACTAGCTCTACC
CCGTTCGCATACATGGCCTTCTGATCTGCTGCCGCCCCACCAGGCCCCGTTCCACTTTCTCCCCGATGTCTACAG
TTTCGCTAAATTCATGCTCGCCACGCCGGCACATCTCATCTCGGATCTCACTGGTGATTTGGATCAATTGGCTTC
CGAGCGTCGGACGCTCGCAAGCTTCGACGACGACCTAGGAACCTGTTTCATTGATGCGGCCGAAACTAGAGTGCG
TCTTCAGATCGCAGCGGCGGCGGCTCTAGATACTCCTGCTTTGAAGGCCAAGGTTGAAAAGGCTATCAGGGATAA
AACTGATCTCGAGGAGCGAACGGCTTTCCATCAAATGAGGAGAAAAAATGAGCAACTTGCACGCAAAGTACCTCA
GGAAGAAGTACCGGTGGATTTTCTTGCTATCAAATCACCAAGCACCCATTCGTCCGCACCATCTACACCCGCCGA
ATTCGAGACGGATACCCCTCGCGAGGTCTCGGCACGCCTACAACCTCGCAATCACCCCAAACAACGACGCAACGT
CAATCCGCCGCCACCAAATACCCAGACGTATTACTACTATCAGGCTGCGTCTGGCTTACCGATCTACCTCCATCC
ACTCGATATCCGAATATTGCTCTCGCATTTTGGCACCTATCCCGCATTCCCCGGCACTATCACTGTGAAAGTTGA
GGGCTACTCGGAGAGTACAATTGACGACAACCTACGGAAACGCTGTAAATATCTTGCGCATCTACCAGAGGGTGC
CGATGTTGTATTCGTAGAAGCCGACCTAGAAGATGTCGTGGGTGCTGACTCACTCAAGAATTTTGAGTCGTTGCT
GAAATCCCGGATTCTACGGAGGAAAGAGAAAGGAAAGAAGGATGACAAGGCAAAGGCGAGGGCGGAGGAACGAGA
GAGGGAGAGAGAGAAGCATTGGGCGTCGTCTCTGGTCTATTCTAGCTCTCGACCAGAAGCAATTGCAATTCAGGA
AATTGTGGACCACTCCTCGTCGTCCACTTCGGAATTAGAGAATTCATCGTCACTGCCCCGACAGAACTCAGGCGC
ATGGGGCACCAAGAGCTTTGCGTCGGCGCTGCATTCGCCTTCAACGCCTGTCAATGATAATCGTGGACAAGATAA
GCCAAGAGAAAAGAAAGAGGATGAATGGGATATGGATGCGGCTTGGCATGAGTTGCAACAACAGAGGAGTGGTGG
TGGCAAGAAGAAGAATACAAAGCTTGTAATTCTTGGGGGCGGAGGTGGGAGACGGCGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail